SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ONIVA07G04100.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA07G04100.1
Domain Number 1 Region: 115-231
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000196
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 431-533
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000222
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ONIVA07G04100.1
Sequence length 728
Comment pep:novel chromosome:AWHD00000000:7:3145344:3147990:-1 gene:ONIVA07G04100 transcript:ONIVA07G04100.1 description:""
Sequence
MAQPPDAAAAAAVPPPVVIDRDVWHACAVPYSGVLPGVGTLVYYIPHGHIEQCAEDPALL
LSRLPDPIHPVPCTVADLVLDVDAESGEAYATISLLPGSHDDTTARRQVPAHGEPGFRFF
EKQLSPADVTSNALVLPAGAEHVLPPLDIAAYQTARLFDVRDLRGKRFEFVHIWDKKRCR
YMLGDLGVNDNDGWRGFVKAKRLATRDTVVFMRRGGGDGDGDGELLVGVRRAPRARGGHH
PRPGVEDNKVVSEVWLAMQGVTPFEVTYYPREGTFEFVVSRDEYIGFSFSPFYPFVPGTT
VHLRMNPLQIAQSISGTVRTFDHLRPWRMLEVDWDQAASPISYKIHRQVNSWQVLRQPQP
AATTSAVRIRDAIVATPQVQIMAPPRPPPPTTTTGMVPSDDSYAMISLFPGDCYVTHRPL
PAARDPVGGQREFCFFDKKLSPSDAAANGGGSGALFVIPKPSAAEHVLPRIPDLRVTNLQ
GGRWEFGHTWSDADTDRRSSSHTLAAGWSAFVKAKRLCVGDTVIFMRRRPGGEPLAGVRR
KPHGGMPVGIPDKHVADAWLDASSAQPFRVTYCPWQGTAEFVVRREEVEGSPPLAPGTRV
RLLMNPDDARRRSQPPVYGTVRDVHSRSEWRMLEVDWDRDSPLAPTMNRRVNSWQVQPVQ
LALPPQGSDEEAAAATTSTAHAGDATTSAPSLALQLQTMASSSSSSAPIIPSRGSAFRIV
NPRDGSQG
Download sequence
Identical sequences A0A0E0HXG9
ONIVA07G04100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]