SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ONIVA10G05120.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA10G05120.1
Domain Number 1 Region: 92-172
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000196
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 242-314
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000147
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA10G05120.1
Sequence length 317
Comment pep:novel chromosome:AWHD00000000:10:5897356:5917092:1 gene:ONIVA10G05120 transcript:ONIVA10G05120.1 description:""
Sequence
MEGSLSGGADQRWARRCERGWSSSSSRRHPPRPSKPQANKEKKGAIQRVVQAQCSLSTSL
RLTAHVTSSIVHEQSSNIRYGENRKHGQRYAYHEPLPPEIVARCNGHDGKHLTLVTRNSK
PVNVRLEKRGQSFYISKGWKKFVELTDLRVGQCVRFSVSSPSTLDLLILDKHGTSLAIPP
SKRDLKLKSKRSTHQDSKGHPSNTDPGPSRIINRRVTKSANNKPKFADLCFCAENYFSKR
YPIDHLEQLMTGRTEDIEVQTLVGPSVNMVLHTSTDHRCNLKKGWTDFALSNGIKLNTVC
IFHFYKTTHLGVIVDIF
Download sequence
Identical sequences A0A0E0IQI6
ONIVA10G05120.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]