SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ONIVA12G07730.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA12G07730.1
Domain Number 1 Region: 447-707
Classification Level Classification E-value
Superfamily L domain-like 5.55e-19
Family Polygalacturonase inhibiting protein PGIP 0.048
Further Details:      
 
Domain Number 2 Region: 255-343
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000432
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ONIVA12G07730.1
Sequence length 846
Comment pep:novel chromosome:AWHD00000000:12:7433390:7441521:-1 gene:ONIVA12G07730 transcript:ONIVA12G07730.1 description:""
Sequence
MAGAIVSASVGVLNPLLTKLSSLIEGEYNLLKSVKKDIIFLRNELSSISVLLEHLSNKED
KLDGPTMEWRNNMLELAYDIEDCIDLFIHKLSCGDANANFVRKIGSKIKKLWGKHQITEC
IQELKNRVMEEDQRRKRYQIDDFISEPSMVEIDPRLPALYEEVERLVGIDGPREKIVKWI
MHKDWSSEQRKVVSIVGWVGRSSMSDATADAEDCSAKSLMPESKKEEGKGEMGGVVRSFS
TQFAEFEVNSASNLPKIPLYVYEIHKTNLKKGKMAFSIPFSEQYINEHLPIEDLLVTVVG
STVSYPMRLMKSKDKQANFTTGWNKLVGDKLFELCDVCVFMFNPFTYRKAKLVMTGMFSC
ITNTESYLRAHCNNSYSHHIITVNERTKSSKSSRQDLIWRWIAEGFIVEVKNQTQEQVGE
NYFNELINRSLIQPVSIQYDGSAKYCRVHDIVLDLIISLSTGQNFVAIVDEQQHWSSFKK
IRRTWFPSNGTDNRIVKKITNNCSQVRSLLFFENPKPKQIPQFKKCHALRLKYLKVFGVN
VTELPKDIGRLQQLETLTIHAGDVDEINIPSSVCRLQKLQRLNFNYPMRLPDGIGVLQAL
EVLYLDSIRYSIKCLQELCWLTRLRQLRILCPGIYDFGGDVARFQRYKEAFYFTLNELGK
NSLRSLHVTCSPEFSDTLMDSCCSSAPDLKELFIDGNGISKFSDRMILPLFVSGILQALI
RKWSSSLGIPKLLYLEVFLSRGLGDGLTRLCFSLYAREAASNLGLEQSYVHLSSLQHLTF
YLCCTNATITDVKAAEAAIRNVISIHTRRPTLVLRRYLQDRMVKEDEEEQLKDSTDGCGV
EEHHIQ
Download sequence
Identical sequences A0A0E0J8S2
ONIVA12G07730.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]