SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339631242|ref|YP_004722884.1| from Mycobacterium africanum GM041182

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339631242|ref|YP_004722884.1|
Domain Number 1 Region: 1-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.53e-105
Family FMN-linked oxidoreductases 0.0000000147
Further Details:      
 
Domain Number 2 Region: 335-517
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.77e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000219
Further Details:      
 
Domain Number 3 Region: 462-520,555-652
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.26e-18
Family C-terminal domain of adrenodoxin reductase-like 0.0000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339631242|ref|YP_004722884.1|
Sequence length 674
Comment NADPH-dependent 2,4-dienoyl-CoA reductase [Mycobacterium africanum GM041182]
Sequence
MTNPYPNLLSPLDLGFTTLRNRVVMGSMHTGLEDRARHIDRLADYFAERARGGVGLIITG
GYAPNRTGWLLPFASELVTSAQARRHRRITRAVHDSGAKILLQILHAGRYAYHPLAVSAS
PIKAPITPFRPRALSARGVEATIADFARCAQLARDAGYDGVEIMGSEGYLLNQFLAPRTN
KRTDSWGGTPANRRRFPVEIIRRSRAAVGSDFIICYRLSMADYVAEGQSWDEIVALATEV
EGAGATIINSGFGWHEARVPTIVTSVPGGAFVDISSAVAEHVTIPVVASNRINMPQAAER
ILAETQVRLISMARPMLSDPDWVLKAQSNRVDEINTCISCNQACLDHAFARKTVSCLLNP
RAGRETQLVLSPTRRARSVAVVGAGPAGLATAANAAQRGHRVTLFEANDFIGGQFDMARR
IPGKEEFSETIRYFSTILAKHGVEVRLGTRVAAQELTGYDEVVLATGVAPRIPAIPGIDH
PMVLTYAEAITGVRPVGRTVAVVGAGGIGFDVTELLVTDSSPTLNLKEWKAEWGVADPRE
ARGALTTPLPAPPAREVYLLQRTKGPQGKRLGKTTGWVHRASLKAKGVHQLSGVNYEQIN
DDGLHISFGPKRRRPQLLAVDNVVVCAGQEPVRDLESELRRHGINPHISGGAAVAAELDA
KRAIKQGTELAARL
Download sequence
Identical sequences A0A109SM44 A0A109SVR0 A0A197IZW4 A0A1S1BA88 F8M5X2
gi|339631242|ref|YP_004722884.1| WP_003910297.1.100395 WP_003910297.1.15172 WP_003910297.1.15827 WP_003910297.1.16421 WP_003910297.1.2253 WP_003910297.1.22797 WP_003910297.1.24244 WP_003910297.1.24767 WP_003910297.1.30211 WP_003910297.1.35100 WP_003910297.1.35602 WP_003910297.1.3949 WP_003910297.1.40543 WP_003910297.1.45989 WP_003910297.1.52106 WP_003910297.1.53609 WP_003910297.1.59388 WP_003910297.1.61793 WP_003910297.1.61925 WP_003910297.1.63538 WP_003910297.1.6935 WP_003910297.1.71128 WP_003910297.1.75045 WP_003910297.1.82309 WP_003910297.1.82836 WP_003910297.1.87162 WP_003910297.1.92416 WP_003910297.1.92706 WP_003910297.1.94184 WP_003910297.1.94470 WP_003910297.1.94525 WP_003910297.1.99379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]