SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339631473|ref|YP_004723115.1| from Mycobacterium africanum GM041182

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339631473|ref|YP_004723115.1|
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Formyltransferase 9.81e-55
Family Formyltransferase 0.0000168
Further Details:      
 
Domain Number 2 Region: 205-301
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.14e-24
Family Post formyltransferase domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339631473|ref|YP_004723115.1|
Sequence length 312
Comment methionyl-tRNA formyltransferase [Mycobacterium africanum GM041182]
Sequence
MRLVFAGTPEPALASLRRLIESPSHDVIAVLTRPDAASGRRGKPQPSPVAREAAERGIPV
LRPSRPNSAEFVAELSDLAPECCAVVAYGALLGGPLLAVPPHGWVNLHFSLLPAWRGAAP
VQAAIAAGDTITGATTFQIEPSLDSGPIYGVVTEVIQPTDTAGDLLKRLAVSGAALLSTT
LDGIADQRLTPRPQPADGVSVAPKITVANARVRWDLPAAVVERRIRAVTPNPGAWTLIGD
LRVKLGPVHLDAAHRPSKPLPPGGIHVERTSVWIGTGSEPVRLGQIQPPGKKLMNAADWA
RGARLDLAARAT
Download sequence
Identical sequences A0A045H2S8 A0A083WCP1 A0A0H3L9E5 A0A0K2HV93 A0A109SMR2 A0A120J0R5 A0A197IWX4 A0A1S1B6K9 A1KIJ5 A5U2A8 C1AN51 F8M7B2 G0TIL0 I6YAG9 P64135 P9WND2 P9WND3
gi|433626505|ref|YP_007260134.1| gi|15608544|ref|NP_215922.1| gi|494699818|ref|YP_007965300.1| NP_215922.1.84033 WP_003900336.1.100000 WP_003900336.1.100021 WP_003900336.1.100069 WP_003900336.1.100087 WP_003900336.1.10015 WP_003900336.1.100208 WP_003900336.1.100216 WP_003900336.1.10022 WP_003900336.1.100255 WP_003900336.1.100260 WP_003900336.1.100270 WP_003900336.1.100279 WP_003900336.1.100286 WP_003900336.1.100308 WP_003900336.1.100309 WP_003900336.1.100318 WP_003900336.1.100337 WP_003900336.1.100338 WP_003900336.1.10037 WP_003900336.1.100383 WP_003900336.1.100395 WP_003900336.1.100396 WP_003900336.1.1004 WP_003900336.1.100459 WP_003900336.1.100460 WP_003900336.1.100552 WP_003900336.1.100581 WP_003900336.1.100600 WP_003900336.1.100625 WP_003900336.1.10064 WP_003900336.1.100666 WP_003900336.1.100671 WP_003900336.1.100677 WP_003900336.1.100682 WP_003900336.1.100697 WP_003900336.1.100703 WP_003900336.1.100716 WP_003900336.1.100722 WP_003900336.1.100754 WP_003900336.1.100757 WP_003900336.1.100772 WP_003900336.1.1008 WP_003900336.1.100812 WP_003900336.1.100845 WP_003900336.1.100866 WP_003900336.1.10088 WP_003900336.1.100889 WP_003900336.1.10090 WP_003900336.1.100910 WP_003900336.1.100915 WP_003900336.1.100918 WP_003900336.1.100935 WP_003900336.1.100984 WP_003900336.1.100992 WP_003900336.1.100998 WP_003900336.1.101 WP_003900336.1.101025 WP_003900336.1.101028 WP_003900336.1.10104 WP_003900336.1.101048 WP_003900336.1.101054 WP_003900336.1.101075 WP_003900336.1.101143 WP_003900336.1.101146 WP_003900336.1.10116 WP_003900336.1.10117 WP_003900336.1.101209 WP_003900336.1.10125 WP_003900336.1.101290 WP_003900336.1.101323 WP_003900336.1.101324 WP_003900336.1.101350 WP_003900336.1.101367 WP_003900336.1.101398 WP_003900336.1.101403 WP_003900336.1.101421 WP_003900336.1.10144 WP_003900336.1.101442 WP_003900336.1.10145 WP_003900336.1.101452 WP_003900336.1.101456 WP_003900336.1.101481 WP_003900336.1.101493 WP_003900336.1.101496 WP_003900336.1.101525 WP_003900336.1.101533 WP_003900336.1.101535 WP_003900336.1.101553 WP_003900336.1.101558 WP_003900336.1.10156 WP_003900336.1.101573 WP_003900336.1.101576 WP_003900336.1.10159 WP_003900336.1.101592 WP_003900336.1.101604 WP_003900336.1.101607 WP_003900336.1.101622 WP_003900336.1.101644 WP_003900336.1.101659 WP_003900336.1.101671 WP_003900336.1.101687 WP_003900336.1.101698 WP_003900336.1.10170 WP_003900336.1.101713 WP_003900336.1.101722 WP_003900336.1.101733 WP_003900336.1.101743 WP_003900336.1.101753 WP_003900336.1.101754 WP_003900336.1.101764 WP_003900336.1.101795 WP_003900336.1.101797 WP_003900336.1.101798 WP_003900336.1.101802 WP_003900336.1.101826 WP_003900336.1.101836 WP_003900336.1.101858 WP_003900336.1.101859 WP_003900336.1.101862 WP_003900336.1.101888 WP_003900336.1.101894 WP_003900336.1.101899 WP_003900336.1.1019 WP_003900336.1.101923 WP_003900336.1.101925 WP_003900336.1.10193 WP_003900336.1.101996 WP_003900336.1.102 WP_003900336.1.102008 WP_003900336.1.102017 WP_003900336.1.102053 WP_003900336.1.102055 WP_003900336.1.102063 WP_003900336.1.102099 WP_003900336.1.1021 WP_003900336.1.10211 WP_003900336.1.102121 WP_003900336.1.102143 WP_003900336.1.10216 WP_003900336.1.10224 WP_003900336.1.10253 WP_003900336.1.10262 WP_003900336.1.10272 WP_003900336.1.10277 WP_003900336.1.1033 WP_003900336.1.10350 WP_003900336.1.10362 WP_003900336.1.10366 WP_003900336.1.10376 WP_003900336.1.10396 WP_003900336.1.10410 WP_003900336.1.10414 WP_003900336.1.10430 WP_003900336.1.1044 WP_003900336.1.10440 WP_003900336.1.10445 WP_003900336.1.10471 WP_003900336.1.10472 WP_003900336.1.10489 WP_003900336.1.105 WP_003900336.1.10518 WP_003900336.1.10523 WP_003900336.1.10545 WP_003900336.1.1057 WP_003900336.1.10594 WP_003900336.1.10603 WP_003900336.1.10606 WP_003900336.1.10615 WP_003900336.1.10623 WP_003900336.1.10635 WP_003900336.1.10643 WP_003900336.1.10648 WP_003900336.1.10662 WP_003900336.1.10735 WP_003900336.1.10740 WP_003900336.1.10756 WP_003900336.1.1078 WP_003900336.1.10791 WP_003900336.1.10799 WP_003900336.1.10825 WP_003900336.1.10863 WP_003900336.1.10879 WP_003900336.1.10912 WP_003900336.1.10916 WP_003900336.1.10923 WP_003900336.1.10927 WP_003900336.1.1095 WP_003900336.1.10956 WP_003900336.1.10958 WP_003900336.1.10962 WP_003900336.1.10980 WP_003900336.1.10981 WP_003900336.1.10993 WP_003900336.1.1100 WP_003900336.1.11040 WP_003900336.1.11061 WP_003900336.1.11070 WP_003900336.1.11141 WP_003900336.1.11171 WP_003900336.1.11175 WP_003900336.1.11176 WP_003900336.1.11222 WP_003900336.1.11236 WP_003900336.1.11329 WP_003900336.1.1133 WP_003900336.1.11342 WP_003900336.1.11373 WP_003900336.1.11376 WP_003900336.1.11390 WP_003900336.1.11402 WP_003900336.1.11481 WP_003900336.1.11487 WP_003900336.1.11491 WP_003900336.1.11514 WP_003900336.1.11587 WP_003900336.1.11589 WP_003900336.1.11596 WP_003900336.1.11604 WP_003900336.1.11610 WP_003900336.1.11697 WP_003900336.1.11707 WP_003900336.1.11752 WP_003900336.1.11758 WP_003900336.1.11761 WP_003900336.1.11775 WP_003900336.1.11804 WP_003900336.1.11822 WP_003900336.1.11826 WP_003900336.1.11856 WP_003900336.1.11898 WP_003900336.1.11906 WP_003900336.1.11939 WP_003900336.1.11960 WP_003900336.1.11961 WP_003900336.1.11972 WP_003900336.1.11984 WP_003900336.1.120 WP_003900336.1.12001 WP_003900336.1.12049 WP_003900336.1.12052 WP_003900336.1.12100 WP_003900336.1.12116 WP_003900336.1.12130 WP_003900336.1.12133 WP_003900336.1.12161 WP_003900336.1.12165 WP_003900336.1.12184 WP_003900336.1.12187 WP_003900336.1.12190 WP_003900336.1.12216 WP_003900336.1.12265 WP_003900336.1.12275 WP_003900336.1.12293 WP_003900336.1.12294 WP_003900336.1.123 WP_003900336.1.1231 WP_003900336.1.12314 WP_003900336.1.12327 WP_003900336.1.12338 WP_003900336.1.1236 WP_003900336.1.12371 WP_003900336.1.12372 WP_003900336.1.12389 WP_003900336.1.12406 WP_003900336.1.1241 WP_003900336.1.12421 WP_003900336.1.12424 WP_003900336.1.12446 WP_003900336.1.12464 WP_003900336.1.12479 WP_003900336.1.12519 WP_003900336.1.12523 WP_003900336.1.12526 WP_003900336.1.1255 WP_003900336.1.12550 WP_003900336.1.12551 WP_003900336.1.12563 WP_003900336.1.12611 WP_003900336.1.12669 WP_003900336.1.1267 WP_003900336.1.12672 WP_003900336.1.12692 WP_003900336.1.1271 WP_003900336.1.12710 WP_003900336.1.12768 WP_003900336.1.1279 WP_003900336.1.12794 WP_003900336.1.12801 WP_003900336.1.12804 WP_003900336.1.12841 WP_003900336.1.12854 WP_003900336.1.12871 WP_003900336.1.12901 WP_003900336.1.12941 WP_003900336.1.12947 WP_003900336.1.12957 WP_003900336.1.12972 WP_003900336.1.13028 WP_003900336.1.13043 WP_003900336.1.13086 WP_003900336.1.13087 WP_003900336.1.13090 WP_003900336.1.13096 WP_003900336.1.13163 WP_003900336.1.13175 WP_003900336.1.13183 WP_003900336.1.132 WP_003900336.1.13249 WP_003900336.1.13282 WP_003900336.1.13284 WP_003900336.1.13296 WP_003900336.1.13298 WP_003900336.1.13306 WP_003900336.1.13312 WP_003900336.1.13313 WP_003900336.1.13345 WP_003900336.1.13358 WP_003900336.1.13370 WP_003900336.1.1338 WP_003900336.1.13420 WP_003900336.1.13433 WP_003900336.1.13435 WP_003900336.1.13438 WP_003900336.1.13461 WP_003900336.1.13466 WP_003900336.1.13489 WP_003900336.1.13526 WP_003900336.1.13551 WP_003900336.1.13561 WP_003900336.1.13564 WP_003900336.1.13579 WP_003900336.1.13647 WP_003900336.1.13667 WP_003900336.1.13687 WP_003900336.1.13697 WP_003900336.1.13719 WP_003900336.1.13763 WP_003900336.1.1377 WP_003900336.1.13774 WP_003900336.1.13786 WP_003900336.1.13793 WP_003900336.1.13794 WP_003900336.1.13817 WP_003900336.1.13834 WP_003900336.1.13866 WP_003900336.1.13880 WP_003900336.1.13899 WP_003900336.1.13909 WP_003900336.1.13910 WP_003900336.1.13920 WP_003900336.1.13952 WP_003900336.1.13953 WP_003900336.1.13962 WP_003900336.1.1398 WP_003900336.1.13988 WP_003900336.1.14027 WP_003900336.1.14046 WP_003900336.1.14115 WP_003900336.1.1415 WP_003900336.1.14152 WP_003900336.1.14158 WP_003900336.1.14162 WP_003900336.1.14175 WP_003900336.1.14178 WP_003900336.1.14194 WP_003900336.1.14195 WP_003900336.1.14208 WP_003900336.1.14238 WP_003900336.1.14266 WP_003900336.1.14273 WP_003900336.1.14303 WP_003900336.1.14306 WP_003900336.1.14310 WP_003900336.1.14341 WP_003900336.1.14382 WP_003900336.1.14416 WP_003900336.1.14428 WP_003900336.1.14441 WP_003900336.1.14469 WP_003900336.1.14477 WP_003900336.1.14504 WP_003900336.1.14514 WP_003900336.1.1452 WP_003900336.1.14527 WP_003900336.1.1454 WP_003900336.1.14544 WP_003900336.1.14548 WP_003900336.1.14551 WP_003900336.1.14561 WP_003900336.1.14573 WP_003900336.1.1462 WP_003900336.1.14658 WP_003900336.1.14667 WP_003900336.1.14668 WP_003900336.1.14675 WP_003900336.1.14694 WP_003900336.1.14695 WP_003900336.1.14709 WP_003900336.1.14766 WP_003900336.1.14783 WP_003900336.1.14865 WP_003900336.1.14872 WP_003900336.1.14905 WP_003900336.1.14926 WP_003900336.1.14951 WP_003900336.1.14955 WP_003900336.1.15003 WP_003900336.1.15009 WP_003900336.1.15028 WP_003900336.1.15040 WP_003900336.1.15052 WP_003900336.1.15065 WP_003900336.1.15072 WP_003900336.1.15089 WP_003900336.1.1509 WP_003900336.1.15126 WP_003900336.1.15131 WP_003900336.1.15168 WP_003900336.1.15172 WP_003900336.1.15174 WP_003900336.1.15187 WP_003900336.1.15196 WP_003900336.1.15210 WP_003900336.1.15216 WP_003900336.1.15217 WP_003900336.1.1523 WP_003900336.1.15232 WP_003900336.1.15238 WP_003900336.1.15240 WP_003900336.1.15253 WP_003900336.1.15267 WP_003900336.1.1527 WP_003900336.1.15292 WP_003900336.1.15299 WP_003900336.1.15302 WP_003900336.1.15322 WP_003900336.1.1534 WP_003900336.1.15345 WP_003900336.1.15365 WP_003900336.1.15372 WP_003900336.1.15386 WP_003900336.1.15387 WP_003900336.1.15442 WP_003900336.1.15447 WP_003900336.1.15449 WP_003900336.1.15477 WP_003900336.1.15481 WP_003900336.1.15492 WP_003900336.1.15511 WP_003900336.1.15512 WP_003900336.1.15558 WP_003900336.1.15559 WP_003900336.1.15566 WP_003900336.1.15599 WP_003900336.1.1560 WP_003900336.1.15611 WP_003900336.1.1563 WP_003900336.1.15633 WP_003900336.1.15643 WP_003900336.1.15688 WP_003900336.1.15755 WP_003900336.1.15763 WP_003900336.1.15774 WP_003900336.1.1578 WP_003900336.1.15780 WP_003900336.1.15827 WP_003900336.1.15834 WP_003900336.1.15842 WP_003900336.1.15848 WP_003900336.1.15853 WP_003900336.1.15870 WP_003900336.1.15877 WP_003900336.1.15893 WP_003900336.1.15896 WP_003900336.1.15926 WP_003900336.1.15933 WP_003900336.1.15946 WP_003900336.1.15958 WP_003900336.1.15973 WP_003900336.1.15987 WP_003900336.1.15993 WP_003900336.1.16009 WP_003900336.1.16025 WP_003900336.1.16043 WP_003900336.1.16055 WP_003900336.1.16066 WP_003900336.1.16069 WP_003900336.1.16077 WP_003900336.1.16106 WP_003900336.1.16108 WP_003900336.1.16110 WP_003900336.1.16130 WP_003900336.1.16136 WP_003900336.1.16139 WP_003900336.1.16141 WP_003900336.1.16143 WP_003900336.1.1630 WP_003900336.1.16318 WP_003900336.1.1632 WP_003900336.1.16327 WP_003900336.1.16334 WP_003900336.1.16341 WP_003900336.1.16345 WP_003900336.1.16374 WP_003900336.1.16384 WP_003900336.1.16386 WP_003900336.1.164 WP_003900336.1.1642 WP_003900336.1.16421 WP_003900336.1.16424 WP_003900336.1.16426 WP_003900336.1.16431 WP_003900336.1.16438 WP_003900336.1.1644 WP_003900336.1.16442 WP_003900336.1.16448 WP_003900336.1.16451 WP_003900336.1.16476 WP_003900336.1.16480 WP_003900336.1.16494 WP_003900336.1.1652 WP_003900336.1.16549 WP_003900336.1.16560 WP_003900336.1.16598 WP_003900336.1.16609 WP_003900336.1.16619 WP_003900336.1.16620 WP_003900336.1.16622 WP_003900336.1.16637 WP_003900336.1.1669 WP_003900336.1.16707 WP_003900336.1.16724 WP_003900336.1.16731 WP_003900336.1.16743 WP_003900336.1.1683 WP_003900336.1.16837 WP_003900336.1.16852 WP_003900336.1.16937 WP_003900336.1.16940 WP_003900336.1.16950 WP_003900336.1.16959 WP_003900336.1.16968 WP_003900336.1.1697 WP_003900336.1.16973 WP_003900336.1.16977 WP_003900336.1.16987 WP_003900336.1.17005 WP_003900336.1.17006 WP_003900336.1.17010 WP_003900336.1.17015 WP_003900336.1.17019 WP_003900336.1.17039 WP_003900336.1.17041 WP_003900336.1.17052 WP_003900336.1.17057 WP_003900336.1.17062 WP_003900336.1.1707 WP_003900336.1.17094 WP_003900336.1.17130 WP_003900336.1.17138 WP_003900336.1.17147 WP_003900336.1.17167 WP_003900336.1.17224 WP_003900336.1.17251 WP_003900336.1.17288 WP_003900336.1.17304 WP_003900336.1.17314 WP_003900336.1.17345 WP_003900336.1.17381 WP_003900336.1.17391 WP_003900336.1.17412 WP_003900336.1.1743 WP_003900336.1.17440 WP_003900336.1.17466 WP_003900336.1.17477 WP_003900336.1.17483 WP_003900336.1.17505 WP_003900336.1.17527 WP_003900336.1.17535 WP_003900336.1.17540 WP_003900336.1.17553 WP_003900336.1.17558 WP_003900336.1.17599 WP_003900336.1.17635 WP_003900336.1.17655 WP_003900336.1.17679 WP_003900336.1.1768 WP_003900336.1.17687 WP_003900336.1.17700 WP_003900336.1.17710 WP_003900336.1.17713 WP_003900336.1.17722 WP_003900336.1.17746 WP_003900336.1.17788 WP_003900336.1.17798 WP_003900336.1.17803 WP_003900336.1.17816 WP_003900336.1.17821 WP_003900336.1.17830 WP_003900336.1.17868 WP_003900336.1.17878 WP_003900336.1.1792 WP_003900336.1.17923 WP_003900336.1.1795 WP_003900336.1.17955 WP_003900336.1.17973 WP_003900336.1.18009 WP_003900336.1.18013 WP_003900336.1.18033 WP_003900336.1.18057 WP_003900336.1.18065 WP_003900336.1.18070 WP_003900336.1.18116 WP_003900336.1.18120 WP_003900336.1.18126 WP_003900336.1.1817 WP_003900336.1.18170 WP_003900336.1.18206 WP_003900336.1.18216 WP_003900336.1.18240 WP_003900336.1.18297 WP_003900336.1.18306 WP_003900336.1.18364 WP_003900336.1.18399 WP_003900336.1.18411 WP_003900336.1.18444 WP_003900336.1.18448 WP_003900336.1.18467 WP_003900336.1.18476 WP_003900336.1.18522 WP_003900336.1.18580 WP_003900336.1.18582 WP_003900336.1.18587 WP_003900336.1.186 WP_003900336.1.18601 WP_003900336.1.18639 WP_003900336.1.18646 WP_003900336.1.18647 WP_003900336.1.1868 WP_003900336.1.18694 WP_003900336.1.18710 WP_003900336.1.18751 WP_003900336.1.18781 WP_003900336.1.18793 WP_003900336.1.18804 WP_003900336.1.18816 WP_003900336.1.18823 WP_003900336.1.18827 WP_003900336.1.18849 WP_003900336.1.18856 WP_003900336.1.18945 WP_003900336.1.1898 WP_003900336.1.19005 WP_003900336.1.19056 WP_003900336.1.19063 WP_003900336.1.19066 WP_003900336.1.19071 WP_003900336.1.19085 WP_003900336.1.19094 WP_003900336.1.19144 WP_003900336.1.19159 WP_003900336.1.19193 WP_003900336.1.19231 WP_003900336.1.19243 WP_003900336.1.19264 WP_003900336.1.19295 WP_003900336.1.19307 WP_003900336.1.19326 WP_003900336.1.1933 WP_003900336.1.19364 WP_003900336.1.19382 WP_003900336.1.19400 WP_003900336.1.19426 WP_003900336.1.19429 WP_003900336.1.19480 WP_003900336.1.19512 WP_003900336.1.19553 WP_003900336.1.19562 WP_003900336.1.19564 WP_003900336.1.19568 WP_003900336.1.19572 WP_003900336.1.19595 WP_003900336.1.19596 WP_003900336.1.19600 WP_003900336.1.1967 WP_003900336.1.19694 WP_003900336.1.1970 WP_003900336.1.19707 WP_003900336.1.19742 WP_003900336.1.19785 WP_003900336.1.19820 WP_003900336.1.19868 WP_003900336.1.19874 WP_003900336.1.19890 WP_003900336.1.19900 WP_003900336.1.19922 WP_003900336.1.19936 WP_003900336.1.19946 WP_003900336.1.19949 WP_003900336.1.19960 WP_003900336.1.19964 WP_003900336.1.20007 WP_003900336.1.20016 WP_003900336.1.20028 WP_003900336.1.2003 WP_003900336.1.20037 WP_003900336.1.20039 WP_003900336.1.20082 WP_003900336.1.20085 WP_003900336.1.20097 WP_003900336.1.20116 WP_003900336.1.20130 WP_003900336.1.20140 WP_003900336.1.20141 WP_003900336.1.20142 WP_003900336.1.20158 WP_003900336.1.20239 WP_003900336.1.20243 WP_003900336.1.20259 WP_003900336.1.20262 WP_003900336.1.20268 WP_003900336.1.20272 WP_003900336.1.20280 WP_003900336.1.20294 WP_003900336.1.20309 WP_003900336.1.20322 WP_003900336.1.2037 WP_003900336.1.20372 WP_003900336.1.20381 WP_003900336.1.204 WP_003900336.1.20427 WP_003900336.1.20432 WP_003900336.1.20457 WP_003900336.1.20459 WP_003900336.1.20460 WP_003900336.1.20542 WP_003900336.1.20578 WP_003900336.1.20608 WP_003900336.1.20624 WP_003900336.1.20628 WP_003900336.1.2066 WP_003900336.1.20707 WP_003900336.1.20722 WP_003900336.1.20729 WP_003900336.1.20742 WP_003900336.1.20751 WP_003900336.1.20776 WP_003900336.1.20843 WP_003900336.1.20850 WP_003900336.1.2086 WP_003900336.1.20868 WP_003900336.1.20876 WP_003900336.1.20897 WP_003900336.1.20898 WP_003900336.1.2090 WP_003900336.1.20911 WP_003900336.1.20916 WP_003900336.1.20921 WP_003900336.1.20926 WP_003900336.1.20927 WP_003900336.1.20951 WP_003900336.1.20970 WP_003900336.1.2104 WP_003900336.1.21070 WP_003900336.1.21127 WP_003900336.1.21135 WP_003900336.1.21173 WP_003900336.1.21187 WP_003900336.1.212 WP_003900336.1.2120 WP_003900336.1.21218 WP_003900336.1.21219 WP_003900336.1.2123 WP_003900336.1.21231 WP_003900336.1.21234 WP_003900336.1.2126 WP_003900336.1.21292 WP_003900336.1.21307 WP_003900336.1.2131 WP_003900336.1.21311 WP_003900336.1.21321 WP_003900336.1.21365 WP_003900336.1.2137 WP_003900336.1.21392 WP_003900336.1.21397 WP_003900336.1.21403 WP_003900336.1.21415 WP_003900336.1.21418 WP_003900336.1.21430 WP_003900336.1.21434 WP_003900336.1.21444 WP_003900336.1.21468 WP_003900336.1.21498 WP_003900336.1.21509 WP_003900336.1.21513 WP_003900336.1.21560 WP_003900336.1.21565 WP_003900336.1.21586 WP_003900336.1.21591 WP_003900336.1.21594 WP_003900336.1.21602 WP_003900336.1.21615 WP_003900336.1.21638 WP_003900336.1.21639 WP_003900336.1.21655 WP_003900336.1.21658 WP_003900336.1.2168 WP_003900336.1.2174 WP_003900336.1.21741 WP_003900336.1.21742 WP_003900336.1.21777 WP_003900336.1.21786 WP_003900336.1.218 WP_003900336.1.21826 WP_003900336.1.21829 WP_003900336.1.21840 WP_003900336.1.21843 WP_003900336.1.21872 WP_003900336.1.21873 WP_003900336.1.2188 WP_003900336.1.21882 WP_003900336.1.21906 WP_003900336.1.21912 WP_003900336.1.2194 WP_003900336.1.21941 WP_003900336.1.21956 WP_003900336.1.21958 WP_003900336.1.21960 WP_003900336.1.21971 WP_003900336.1.21973 WP_003900336.1.21983 WP_003900336.1.22003 WP_003900336.1.22013 WP_003900336.1.22025 WP_003900336.1.22036 WP_003900336.1.22075 WP_003900336.1.22092 WP_003900336.1.2212 WP_003900336.1.22127 WP_003900336.1.22140 WP_003900336.1.22233 WP_003900336.1.22255 WP_003900336.1.22277 WP_003900336.1.22305 WP_003900336.1.22348 WP_003900336.1.22356 WP_003900336.1.22366 WP_003900336.1.2238 WP_003900336.1.22380 WP_003900336.1.22437 WP_003900336.1.22438 WP_003900336.1.22445 WP_003900336.1.22490 WP_003900336.1.22511 WP_003900336.1.22524 WP_003900336.1.2253 WP_003900336.1.22585 WP_003900336.1.22589 WP_003900336.1.22606 WP_003900336.1.22608 WP_003900336.1.22609 WP_003900336.1.22618 WP_003900336.1.2262 WP_003900336.1.22624 WP_003900336.1.22629 WP_003900336.1.22647 WP_003900336.1.22664 WP_003900336.1.22665 WP_003900336.1.22670 WP_003900336.1.22674 WP_003900336.1.22680 WP_003900336.1.22725 WP_003900336.1.22728 WP_003900336.1.22733 WP_003900336.1.22737 WP_003900336.1.2275 WP_003900336.1.22754 WP_003900336.1.22797 WP_003900336.1.22800 WP_003900336.1.22804 WP_003900336.1.22829 WP_003900336.1.22840 WP_003900336.1.22844 WP_003900336.1.22963 WP_003900336.1.22970 WP_003900336.1.22996 WP_003900336.1.22997 WP_003900336.1.22999 WP_003900336.1.23015 WP_003900336.1.23032 WP_003900336.1.231 WP_003900336.1.23101 WP_003900336.1.2312 WP_003900336.1.23140 WP_003900336.1.23153 WP_003900336.1.23171 WP_003900336.1.23199 WP_003900336.1.2320 WP_003900336.1.23204 WP_003900336.1.23216 WP_003900336.1.23229 WP_003900336.1.23233 WP_003900336.1.2326 WP_003900336.1.23261 WP_003900336.1.23272 WP_003900336.1.23289 WP_003900336.1.2329 WP_003900336.1.23308 WP_003900336.1.23316 WP_003900336.1.23321 WP_003900336.1.23325 WP_003900336.1.2339 WP_003900336.1.23406 WP_003900336.1.23438 WP_003900336.1.23445 WP_003900336.1.23447 WP_003900336.1.23452 WP_003900336.1.23461 WP_003900336.1.2349 WP_003900336.1.23496 WP_003900336.1.23497 WP_003900336.1.23506 WP_003900336.1.23530 WP_003900336.1.23539 WP_003900336.1.23546 WP_003900336.1.23551 WP_003900336.1.23573 WP_003900336.1.23583 WP_003900336.1.23588 WP_003900336.1.23628 WP_003900336.1.23677 WP_003900336.1.23683 WP_003900336.1.23692 WP_003900336.1.23694 WP_003900336.1.23699 WP_003900336.1.2371 WP_003900336.1.23803 WP_003900336.1.23807 WP_003900336.1.23825 WP_003900336.1.23832 WP_003900336.1.2384 WP_003900336.1.23843 WP_003900336.1.23863 WP_003900336.1.23894 WP_003900336.1.23993 WP_003900336.1.2400 WP_003900336.1.24007 WP_003900336.1.24008 WP_003900336.1.24046 WP_003900336.1.24057 WP_003900336.1.24062 WP_003900336.1.24113 WP_003900336.1.24119 WP_003900336.1.24128 WP_003900336.1.24140 WP_003900336.1.24176 WP_003900336.1.24190 WP_003900336.1.24202 WP_003900336.1.24244 WP_003900336.1.24261 WP_003900336.1.24284 WP_003900336.1.24294 WP_003900336.1.24357 WP_003900336.1.24396 WP_003900336.1.24414 WP_003900336.1.24423 WP_003900336.1.2443 WP_003900336.1.24446 WP_003900336.1.24461 WP_003900336.1.24500 WP_003900336.1.24507 WP_003900336.1.24509 WP_003900336.1.24529 WP_003900336.1.24553 WP_003900336.1.24599 WP_003900336.1.24629 WP_003900336.1.24638 WP_003900336.1.24648 WP_003900336.1.2466 WP_003900336.1.24767 WP_003900336.1.24824 WP_003900336.1.24831 WP_003900336.1.24840 WP_003900336.1.24848 WP_003900336.1.24857 WP_003900336.1.2487 WP_003900336.1.24893 WP_003900336.1.24907 WP_003900336.1.24933 WP_003900336.1.24956 WP_003900336.1.24958 WP_003900336.1.24985 WP_003900336.1.2499 WP_003900336.1.25004 WP_003900336.1.2505 WP_003900336.1.25051 WP_003900336.1.2507 WP_003900336.1.25096 WP_003900336.1.25103 WP_003900336.1.25129 WP_003900336.1.25171 WP_003900336.1.25184 WP_003900336.1.25247 WP_003900336.1.25252 WP_003900336.1.25278 WP_003900336.1.25283 WP_003900336.1.25309 WP_003900336.1.25313 WP_003900336.1.25338 WP_003900336.1.25342 WP_003900336.1.25343 WP_003900336.1.25367 WP_003900336.1.25393 WP_003900336.1.25406 WP_003900336.1.25435 WP_003900336.1.25437 WP_003900336.1.25445 WP_003900336.1.25455 WP_003900336.1.25473 WP_003900336.1.25504 WP_003900336.1.25513 WP_003900336.1.25542 WP_003900336.1.25579 WP_003900336.1.25594 WP_003900336.1.25606 WP_003900336.1.25645 WP_003900336.1.2566 WP_003900336.1.25673 WP_003900336.1.25674 WP_003900336.1.25693 WP_003900336.1.25699 WP_003900336.1.25727 WP_003900336.1.25736 WP_003900336.1.25738 WP_003900336.1.25756 WP_003900336.1.25759 WP_003900336.1.2580 WP_003900336.1.25813 WP_003900336.1.25853 WP_003900336.1.25854 WP_003900336.1.25874 WP_003900336.1.25885 WP_003900336.1.25892 WP_003900336.1.25906 WP_003900336.1.25914 WP_003900336.1.2594 WP_003900336.1.25954 WP_003900336.1.25965 WP_003900336.1.25972 WP_003900336.1.26017 WP_003900336.1.26038 WP_003900336.1.26072 WP_003900336.1.26089 WP_003900336.1.26097 WP_003900336.1.26098 WP_003900336.1.26108 WP_003900336.1.26109 WP_003900336.1.26118 WP_003900336.1.26126 WP_003900336.1.2614 WP_003900336.1.26168 WP_003900336.1.26182 WP_003900336.1.26190 WP_003900336.1.2620 WP_003900336.1.26234 WP_003900336.1.26243 WP_003900336.1.26265 WP_003900336.1.26267 WP_003900336.1.26292 WP_003900336.1.26310 WP_003900336.1.26328 WP_003900336.1.26349 WP_003900336.1.26366 WP_003900336.1.26374 WP_003900336.1.26407 WP_003900336.1.26412 WP_003900336.1.26454 WP_003900336.1.26464 WP_003900336.1.2653 WP_003900336.1.26560 WP_003900336.1.26571 WP_003900336.1.2659 WP_003900336.1.26597 WP_003900336.1.26603 WP_003900336.1.26629 WP_003900336.1.26651 WP_003900336.1.26702 WP_003900336.1.26707 WP_003900336.1.26710 WP_003900336.1.26719 WP_003900336.1.26737 WP_003900336.1.26738 WP_003900336.1.26745 WP_003900336.1.26756 WP_003900336.1.2676 WP_003900336.1.2677 WP_003900336.1.26779 WP_003900336.1.26780 WP_003900336.1.26854 WP_003900336.1.26868 WP_003900336.1.26876 WP_003900336.1.26888 WP_003900336.1.26945 WP_003900336.1.26959 WP_003900336.1.26969 WP_003900336.1.26984 WP_003900336.1.26992 WP_003900336.1.27004 WP_003900336.1.27017 WP_003900336.1.27045 WP_003900336.1.27074 WP_003900336.1.27075 WP_003900336.1.27128 WP_003900336.1.27130 WP_003900336.1.27139 WP_003900336.1.27152 WP_003900336.1.27162 WP_003900336.1.27164 WP_003900336.1.27193 WP_003900336.1.27235 WP_003900336.1.27254 WP_003900336.1.27278 WP_003900336.1.27343 WP_003900336.1.27352 WP_003900336.1.27369 WP_003900336.1.27391 WP_003900336.1.27398 WP_003900336.1.27402 WP_003900336.1.27410 WP_003900336.1.27411 WP_003900336.1.27449 WP_003900336.1.27460 WP_003900336.1.27463 WP_003900336.1.2749 WP_003900336.1.27492 WP_003900336.1.27528 WP_003900336.1.27541 WP_003900336.1.27576 WP_003900336.1.27582 WP_003900336.1.27596 WP_003900336.1.27607 WP_003900336.1.2766 WP_003900336.1.277 WP_003900336.1.27724 WP_003900336.1.27730 WP_003900336.1.27736 WP_003900336.1.27743 WP_003900336.1.27750 WP_003900336.1.27771 WP_003900336.1.27779 WP_003900336.1.27795 WP_003900336.1.27803 WP_003900336.1.27819 WP_003900336.1.27835 WP_003900336.1.27915 WP_003900336.1.27935 WP_003900336.1.27962 WP_003900336.1.28053 WP_003900336.1.28092 WP_003900336.1.28106 WP_003900336.1.28131 WP_003900336.1.28142 WP_003900336.1.28159 WP_003900336.1.2816 WP_003900336.1.28161 WP_003900336.1.28192 WP_003900336.1.28202 WP_003900336.1.28241 WP_003900336.1.28251 WP_003900336.1.28255 WP_003900336.1.28269 WP_003900336.1.28276 WP_003900336.1.28293 WP_003900336.1.28331 WP_003900336.1.28367 WP_003900336.1.28378 WP_003900336.1.28391 WP_003900336.1.2842 WP_003900336.1.28448 WP_003900336.1.2847 WP_003900336.1.28471 WP_003900336.1.28473 WP_003900336.1.28493 WP_003900336.1.28497 WP_003900336.1.28530 WP_003900336.1.28545 WP_003900336.1.28561 WP_003900336.1.28567 WP_003900336.1.28585 WP_003900336.1.286 WP_003900336.1.28610 WP_003900336.1.28617 WP_003900336.1.28634 WP_003900336.1.28642 WP_003900336.1.28671 WP_003900336.1.28682 WP_003900336.1.28698 WP_003900336.1.28703 WP_003900336.1.28739 WP_003900336.1.28758 WP_003900336.1.28781 WP_003900336.1.28787 WP_003900336.1.28827 WP_003900336.1.28839 WP_003900336.1.28847 WP_003900336.1.28850 WP_003900336.1.28851 WP_003900336.1.28865 WP_003900336.1.28897 WP_003900336.1.28914 WP_003900336.1.28935 WP_003900336.1.28936 WP_003900336.1.28939 WP_003900336.1.28943 WP_003900336.1.28952 WP_003900336.1.28975 WP_003900336.1.2899 WP_003900336.1.28993 WP_003900336.1.29000 WP_003900336.1.2901 WP_003900336.1.29028 WP_003900336.1.29033 WP_003900336.1.29058 WP_003900336.1.29078 WP_003900336.1.29102 WP_003900336.1.29115 WP_003900336.1.2916 WP_003900336.1.29217 WP_003900336.1.29223 WP_003900336.1.29234 WP_003900336.1.29264 WP_003900336.1.29275 WP_003900336.1.29306 WP_003900336.1.29339 WP_003900336.1.29348 WP_003900336.1.29364 WP_003900336.1.29367 WP_003900336.1.2938 WP_003900336.1.29399 WP_003900336.1.29426 WP_003900336.1.2944 WP_003900336.1.29449 WP_003900336.1.29450 WP_003900336.1.29452 WP_003900336.1.2949 WP_003900336.1.29510 WP_003900336.1.29515 WP_003900336.1.29525 WP_003900336.1.2953 WP_003900336.1.29559 WP_003900336.1.29587 WP_003900336.1.2959 WP_003900336.1.29592 WP_003900336.1.29599 WP_003900336.1.29611 WP_003900336.1.29632 WP_003900336.1.29649 WP_003900336.1.2965 WP_003900336.1.29659 WP_003900336.1.2969 WP_003900336.1.29696 WP_003900336.1.29698 WP_003900336.1.29718 WP_003900336.1.29745 WP_003900336.1.29747 WP_003900336.1.29769 WP_003900336.1.29825 WP_003900336.1.29830 WP_003900336.1.29847 WP_003900336.1.29861 WP_003900336.1.29869 WP_003900336.1.29883 WP_003900336.1.29890 WP_003900336.1.299 WP_003900336.1.29931 WP_003900336.1.29960 WP_003900336.1.30014 WP_003900336.1.3004 WP_003900336.1.30040 WP_003900336.1.30043 WP_003900336.1.30074 WP_003900336.1.30097 WP_003900336.1.30101 WP_003900336.1.30106 WP_003900336.1.30114 WP_003900336.1.30126 WP_003900336.1.30131 WP_003900336.1.30138 WP_003900336.1.30139 WP_003900336.1.30145 WP_003900336.1.30224 WP_003900336.1.30235 WP_003900336.1.30237 WP_003900336.1.3027 WP_003900336.1.30279 WP_003900336.1.30282 WP_003900336.1.30283 WP_003900336.1.30288 WP_003900336.1.30291 WP_003900336.1.30363 WP_003900336.1.30374 WP_003900336.1.30404 WP_003900336.1.3043 WP_003900336.1.30433 WP_003900336.1.30438 WP_003900336.1.30462 WP_003900336.1.30464 WP_003900336.1.30468 WP_003900336.1.30500 WP_003900336.1.3057 WP_003900336.1.30574 WP_003900336.1.30628 WP_003900336.1.30641 WP_003900336.1.30642 WP_003900336.1.30661 WP_003900336.1.30669 WP_003900336.1.30683 WP_003900336.1.30699 WP_003900336.1.30709 WP_003900336.1.30713 WP_003900336.1.30716 WP_003900336.1.30719 WP_003900336.1.30730 WP_003900336.1.30732 WP_003900336.1.30736 WP_003900336.1.30745 WP_003900336.1.30760 WP_003900336.1.30791 WP_003900336.1.308 WP_003900336.1.30818 WP_003900336.1.30824 WP_003900336.1.30848 WP_003900336.1.30877 WP_003900336.1.30888 WP_003900336.1.30901 WP_003900336.1.30903 WP_003900336.1.30912 WP_003900336.1.30913 WP_003900336.1.30914 WP_003900336.1.30919 WP_003900336.1.30977 WP_003900336.1.31002 WP_003900336.1.3101 WP_003900336.1.31034 WP_003900336.1.31047 WP_003900336.1.31070 WP_003900336.1.31074 WP_003900336.1.31102 WP_003900336.1.31127 WP_003900336.1.31184 WP_003900336.1.31199 WP_003900336.1.31226 WP_003900336.1.31233 WP_003900336.1.31263 WP_003900336.1.31264 WP_003900336.1.31270 WP_003900336.1.31287 WP_003900336.1.31290 WP_003900336.1.31304 WP_003900336.1.31346 WP_003900336.1.31348 WP_003900336.1.31354 WP_003900336.1.31390 WP_003900336.1.31414 WP_003900336.1.31417 WP_003900336.1.31428 WP_003900336.1.3143 WP_003900336.1.31458 WP_003900336.1.31483 WP_003900336.1.3149 WP_003900336.1.31498 WP_003900336.1.31537 WP_003900336.1.31548 WP_003900336.1.31569 WP_003900336.1.316 WP_003900336.1.31629 WP_003900336.1.31666 WP_003900336.1.31693 WP_003900336.1.31703 WP_003900336.1.31744 WP_003900336.1.31745 WP_003900336.1.31770 WP_003900336.1.31776 WP_003900336.1.31783 WP_003900336.1.318 WP_003900336.1.3184 WP_003900336.1.31840 WP_003900336.1.31880 WP_003900336.1.31911 WP_003900336.1.31930 WP_003900336.1.31932 WP_003900336.1.31955 WP_003900336.1.31985 WP_003900336.1.31991 WP_003900336.1.31995 WP_003900336.1.32004 WP_003900336.1.32039 WP_003900336.1.3204 WP_003900336.1.32045 WP_003900336.1.32071 WP_003900336.1.32098 WP_003900336.1.32132 WP_003900336.1.32157 WP_003900336.1.32164 WP_003900336.1.32179 WP_003900336.1.32198 WP_003900336.1.32297 WP_003900336.1.32317 WP_003900336.1.32403 WP_003900336.1.32416 WP_003900336.1.32421 WP_003900336.1.32433 WP_003900336.1.32461 WP_003900336.1.32482 WP_003900336.1.32503 WP_003900336.1.32556 WP_003900336.1.32562 WP_003900336.1.32569 WP_003900336.1.32592 WP_003900336.1.32620 WP_003900336.1.32647 WP_003900336.1.32653 WP_003900336.1.32654 WP_003900336.1.3268 WP_003900336.1.32695 WP_003900336.1.32706 WP_003900336.1.32716 WP_003900336.1.32738 WP_003900336.1.32752 WP_003900336.1.32780 WP_003900336.1.32781 WP_003900336.1.32793 WP_003900336.1.32799 WP_003900336.1.32822 WP_003900336.1.32833 WP_003900336.1.32862 WP_003900336.1.32880 WP_003900336.1.32897 WP_003900336.1.32909 WP_003900336.1.32935 WP_003900336.1.32974 WP_003900336.1.33007 WP_003900336.1.3302 WP_003900336.1.33028 WP_003900336.1.33035 WP_003900336.1.33044 WP_003900336.1.33054 WP_003900336.1.33082 WP_003900336.1.33141 WP_003900336.1.33148 WP_003900336.1.33155 WP_003900336.1.33168 WP_003900336.1.3321 WP_003900336.1.33215 WP_003900336.1.3325 WP_003900336.1.3327 WP_003900336.1.33278 WP_003900336.1.33288 WP_003900336.1.33305 WP_003900336.1.3331 WP_003900336.1.33319 WP_003900336.1.3333 WP_003900336.1.33393 WP_003900336.1.33403 WP_003900336.1.33452 WP_003900336.1.33467 WP_003900336.1.33477 WP_003900336.1.3349 WP_003900336.1.33519 WP_003900336.1.33542 WP_003900336.1.33601 WP_003900336.1.33602 WP_003900336.1.33633 WP_003900336.1.33646 WP_003900336.1.33673 WP_003900336.1.3369 WP_003900336.1.33705 WP_003900336.1.33762 WP_003900336.1.33783 WP_003900336.1.33789 WP_003900336.1.3383 WP_003900336.1.33832 WP_003900336.1.33848 WP_003900336.1.3387 WP_003900336.1.33886 WP_003900336.1.33895 WP_003900336.1.33906 WP_003900336.1.33912 WP_003900336.1.33954 WP_003900336.1.3399 WP_003900336.1.34042 WP_003900336.1.3405 WP_003900336.1.34055 WP_003900336.1.34056 WP_003900336.1.34065 WP_003900336.1.34090 WP_003900336.1.34109 WP_003900336.1.34111 WP_003900336.1.34131 WP_003900336.1.34152 WP_003900336.1.34153 WP_003900336.1.34163 WP_003900336.1.34181 WP_003900336.1.34197 WP_003900336.1.34198 WP_003900336.1.34215 WP_003900336.1.34219 WP_003900336.1.34255 WP_003900336.1.34260 WP_003900336.1.34275 WP_003900336.1.343 WP_003900336.1.34347 WP_003900336.1.34358 WP_003900336.1.34392 WP_003900336.1.344 WP_003900336.1.34428 WP_003900336.1.3443 WP_003900336.1.34435 WP_003900336.1.34446 WP_003900336.1.34499 WP_003900336.1.34505 WP_003900336.1.34516 WP_003900336.1.34529 WP_003900336.1.34551 WP_003900336.1.34563 WP_003900336.1.34576 WP_003900336.1.34581 WP_003900336.1.34588 WP_003900336.1.34596 WP_003900336.1.34599 WP_003900336.1.34639 WP_003900336.1.34673 WP_003900336.1.34724 WP_003900336.1.34740 WP_003900336.1.34755 WP_003900336.1.34777 WP_003900336.1.34783 WP_003900336.1.34841 WP_003900336.1.34908 WP_003900336.1.3492 WP_003900336.1.34933 WP_003900336.1.34945 WP_003900336.1.34946 WP_003900336.1.34954 WP_003900336.1.34960 WP_003900336.1.34961 WP_003900336.1.34963 WP_003900336.1.34965 WP_003900336.1.34968 WP_003900336.1.35023 WP_003900336.1.35069 WP_003900336.1.35072 WP_003900336.1.35078 WP_003900336.1.35100 WP_003900336.1.35146 WP_003900336.1.35160 WP_003900336.1.35162 WP_003900336.1.35173 WP_003900336.1.35176 WP_003900336.1.3520 WP_003900336.1.35213 WP_003900336.1.35221 WP_003900336.1.35246 WP_003900336.1.35278 WP_003900336.1.35301 WP_003900336.1.35311 WP_003900336.1.35312 WP_003900336.1.35317 WP_003900336.1.35319 WP_003900336.1.35347 WP_003900336.1.35363 WP_003900336.1.35382 WP_003900336.1.35385 WP_003900336.1.35396 WP_003900336.1.35397 WP_003900336.1.35403 WP_003900336.1.35426 WP_003900336.1.35439 WP_003900336.1.35455 WP_003900336.1.3548 WP_003900336.1.35484 WP_003900336.1.35492 WP_003900336.1.3553 WP_003900336.1.35553 WP_003900336.1.35555 WP_003900336.1.35561 WP_003900336.1.35602 WP_003900336.1.35610 WP_003900336.1.35635 WP_003900336.1.35657 WP_003900336.1.35687 WP_003900336.1.35689 WP_003900336.1.35707 WP_003900336.1.35732 WP_003900336.1.35754 WP_003900336.1.35767 WP_003900336.1.35770 WP_003900336.1.35771 WP_003900336.1.35780 WP_003900336.1.35805 WP_003900336.1.35811 WP_003900336.1.35821 WP_003900336.1.3584 WP_003900336.1.35848 WP_003900336.1.35864 WP_003900336.1.35874 WP_003900336.1.35876 WP_003900336.1.35897 WP_003900336.1.35899 WP_003900336.1.35923 WP_003900336.1.3593 WP_003900336.1.35954 WP_003900336.1.36005 WP_003900336.1.36014 WP_003900336.1.36023 WP_003900336.1.36051 WP_003900336.1.36053 WP_003900336.1.36075 WP_003900336.1.36089 WP_003900336.1.36097 WP_003900336.1.36098 WP_003900336.1.36116 WP_003900336.1.36145 WP_003900336.1.36156 WP_003900336.1.36205 WP_003900336.1.36228 WP_003900336.1.36246 WP_003900336.1.36252 WP_003900336.1.36260 WP_003900336.1.36270 WP_003900336.1.36271 WP_003900336.1.36303 WP_003900336.1.36309 WP_003900336.1.36315 WP_003900336.1.36319 WP_003900336.1.36321 WP_003900336.1.36326 WP_003900336.1.3634 WP_003900336.1.36356 WP_003900336.1.36357 WP_003900336.1.3636 WP_003900336.1.36385 WP_003900336.1.36399 WP_003900336.1.36436 WP_003900336.1.36465 WP_003900336.1.36469 WP_003900336.1.36473 WP_003900336.1.36485 WP_003900336.1.36508 WP_003900336.1.36540 WP_003900336.1.36561 WP_003900336.1.36571 WP_003900336.1.36573 WP_003900336.1.36578 WP_003900336.1.36585 WP_003900336.1.36597 WP_003900336.1.36614 WP_003900336.1.36657 WP_003900336.1.36674 WP_003900336.1.36720 WP_003900336.1.36727 WP_003900336.1.36733 WP_003900336.1.36810 WP_003900336.1.36844 WP_003900336.1.36851 WP_003900336.1.36862 WP_003900336.1.36893 WP_003900336.1.36901 WP_003900336.1.36935 WP_003900336.1.36941 WP_003900336.1.3695 WP_003900336.1.36951 WP_003900336.1.36968 WP_003900336.1.3700 WP_003900336.1.37004 WP_003900336.1.37012 WP_003900336.1.37071 WP_003900336.1.37088 WP_003900336.1.37157 WP_003900336.1.37175 WP_003900336.1.37188 WP_003900336.1.37213 WP_003900336.1.37229 WP_003900336.1.3724 WP_003900336.1.37277 WP_003900336.1.37305 WP_003900336.1.37330 WP_003900336.1.37389 WP_003900336.1.37400 WP_003900336.1.37440 WP_003900336.1.37459 WP_003900336.1.37468 WP_003900336.1.37475 WP_003900336.1.37484 WP_003900336.1.37601 WP_003900336.1.37612 WP_003900336.1.37632 WP_003900336.1.37643 WP_003900336.1.37655 WP_003900336.1.37660 WP_003900336.1.37674 WP_003900336.1.37700 WP_003900336.1.37701 WP_003900336.1.37709 WP_003900336.1.37711 WP_003900336.1.37721 WP_003900336.1.37722 WP_003900336.1.37747 WP_003900336.1.37765 WP_003900336.1.37772 WP_003900336.1.37804 WP_003900336.1.37809 WP_003900336.1.37859 WP_003900336.1.37877 WP_003900336.1.37912 WP_003900336.1.37913 WP_003900336.1.37943 WP_003900336.1.37950 WP_003900336.1.37973 WP_003900336.1.37975 WP_003900336.1.37983 WP_003900336.1.38002 WP_003900336.1.3802 WP_003900336.1.38039 WP_003900336.1.38040 WP_003900336.1.38067 WP_003900336.1.38068 WP_003900336.1.38135 WP_003900336.1.38138 WP_003900336.1.38144 WP_003900336.1.38158 WP_003900336.1.38159 WP_003900336.1.38210 WP_003900336.1.38233 WP_003900336.1.38240 WP_003900336.1.38299 WP_003900336.1.38332 WP_003900336.1.38347 WP_003900336.1.38354 WP_003900336.1.38380 WP_003900336.1.38384 WP_003900336.1.38389 WP_003900336.1.38398 WP_003900336.1.38402 WP_003900336.1.38418 WP_003900336.1.38421 WP_003900336.1.38466 WP_003900336.1.38477 WP_003900336.1.38483 WP_003900336.1.3849 WP_003900336.1.385 WP_003900336.1.38530 WP_003900336.1.38535 WP_003900336.1.38539 WP_003900336.1.38594 WP_003900336.1.38611 WP_003900336.1.38638 WP_003900336.1.38639 WP_003900336.1.38646 WP_003900336.1.38648 WP_003900336.1.38654 WP_003900336.1.38659 WP_003900336.1.38660 WP_003900336.1.38666 WP_003900336.1.38671 WP_003900336.1.38672 WP_003900336.1.38677 WP_003900336.1.38750 WP_003900336.1.38772 WP_003900336.1.38812 WP_003900336.1.38821 WP_003900336.1.38844 WP_003900336.1.38863 WP_003900336.1.38865 WP_003900336.1.38873 WP_003900336.1.3889 WP_003900336.1.38894 WP_003900336.1.38909 WP_003900336.1.38939 WP_003900336.1.38974 WP_003900336.1.38975 WP_003900336.1.38991 WP_003900336.1.39025 WP_003900336.1.39070 WP_003900336.1.39072 WP_003900336.1.39095 WP_003900336.1.39106 WP_003900336.1.39165 WP_003900336.1.39174 WP_003900336.1.39176 WP_003900336.1.39190 WP_003900336.1.39201 WP_003900336.1.39207 WP_003900336.1.39211 WP_003900336.1.39236 WP_003900336.1.39239 WP_003900336.1.39252 WP_003900336.1.39288 WP_003900336.1.39295 WP_003900336.1.39306 WP_003900336.1.39359 WP_003900336.1.39364 WP_003900336.1.39400 WP_003900336.1.39447 WP_003900336.1.3945 WP_003900336.1.39450 WP_003900336.1.39455 WP_003900336.1.3949 WP_003900336.1.39521 WP_003900336.1.39560 WP_003900336.1.39592 WP_003900336.1.39593 WP_003900336.1.396 WP_003900336.1.3960 WP_003900336.1.39616 WP_003900336.1.39654 WP_003900336.1.39657 WP_003900336.1.39661 WP_003900336.1.39674 WP_003900336.1.39678 WP_003900336.1.3968 WP_003900336.1.39694 WP_003900336.1.3971 WP_003900336.1.39718 WP_003900336.1.39728 WP_003900336.1.39739 WP_003900336.1.39748 WP_003900336.1.39751 WP_003900336.1.39759 WP_003900336.1.39801 WP_003900336.1.39804 WP_003900336.1.39848 WP_003900336.1.39877 WP_003900336.1.39925 WP_003900336.1.3994 WP_003900336.1.39959 WP_003900336.1.3996 WP_003900336.1.39960 WP_003900336.1.3997 WP_003900336.1.39980 WP_003900336.1.40000 WP_003900336.1.40028 WP_003900336.1.4003 WP_003900336.1.40094 WP_003900336.1.40096 WP_003900336.1.40150 WP_003900336.1.40156 WP_003900336.1.40174 WP_003900336.1.40186 WP_003900336.1.40276 WP_003900336.1.40277 WP_003900336.1.40323 WP_003900336.1.40336 WP_003900336.1.40353 WP_003900336.1.4036 WP_003900336.1.40372 WP_003900336.1.40402 WP_003900336.1.40413 WP_003900336.1.40446 WP_003900336.1.40451 WP_003900336.1.40455 WP_003900336.1.40523 WP_003900336.1.40543 WP_003900336.1.40641 WP_003900336.1.40646 WP_003900336.1.40651 WP_003900336.1.40653 WP_003900336.1.4067 WP_003900336.1.40705 WP_003900336.1.40723 WP_003900336.1.40731 WP_003900336.1.40735 WP_003900336.1.40795 WP_003900336.1.40799 WP_003900336.1.40852 WP_003900336.1.40876 WP_003900336.1.40881 WP_003900336.1.40922 WP_003900336.1.40948 WP_003900336.1.4095 WP_003900336.1.40956 WP_003900336.1.40957 WP_003900336.1.40964 WP_003900336.1.4097 WP_003900336.1.410 WP_003900336.1.41000 WP_003900336.1.41055 WP_003900336.1.41108 WP_003900336.1.41123 WP_003900336.1.41177 WP_003900336.1.41202 WP_003900336.1.41219 WP_003900336.1.41231 WP_003900336.1.41249 WP_003900336.1.4127 WP_003900336.1.41296 WP_003900336.1.41355 WP_003900336.1.41376 WP_003900336.1.41430 WP_003900336.1.41447 WP_003900336.1.41469 WP_003900336.1.41504 WP_003900336.1.41553 WP_003900336.1.41564 WP_003900336.1.41583 WP_003900336.1.41616 WP_003900336.1.41632 WP_003900336.1.41635 WP_003900336.1.41636 WP_003900336.1.41648 WP_003900336.1.41660 WP_003900336.1.41685 WP_003900336.1.41695 WP_003900336.1.41704 WP_003900336.1.4171 WP_003900336.1.41719 WP_003900336.1.41733 WP_003900336.1.41744 WP_003900336.1.41774 WP_003900336.1.41791 WP_003900336.1.41820 WP_003900336.1.41828 WP_003900336.1.41829 WP_003900336.1.41860 WP_003900336.1.41912 WP_003900336.1.41921 WP_003900336.1.41933 WP_003900336.1.41944 WP_003900336.1.42043 WP_003900336.1.42075 WP_003900336.1.42078 WP_003900336.1.42094 WP_003900336.1.42112 WP_003900336.1.4212 WP_003900336.1.42122 WP_003900336.1.42134 WP_003900336.1.42183 WP_003900336.1.42188 WP_003900336.1.42201 WP_003900336.1.42202 WP_003900336.1.42208 WP_003900336.1.42247 WP_003900336.1.42255 WP_003900336.1.42273 WP_003900336.1.42278 WP_003900336.1.42304 WP_003900336.1.42309 WP_003900336.1.42370 WP_003900336.1.42385 WP_003900336.1.42400 WP_003900336.1.42409 WP_003900336.1.42414 WP_003900336.1.42417 WP_003900336.1.42430 WP_003900336.1.42461 WP_003900336.1.42465 WP_003900336.1.42467 WP_003900336.1.42473 WP_003900336.1.42474 WP_003900336.1.42494 WP_003900336.1.42519 WP_003900336.1.42524 WP_003900336.1.42534 WP_003900336.1.4255 WP_003900336.1.42562 WP_003900336.1.42568 WP_003900336.1.42570 WP_003900336.1.42618 WP_003900336.1.42660 WP_003900336.1.42695 WP_003900336.1.42704 WP_003900336.1.42705 WP_003900336.1.42722 WP_003900336.1.42777 WP_003900336.1.42782 WP_003900336.1.42835 WP_003900336.1.42839 WP_003900336.1.42842 WP_003900336.1.42905 WP_003900336.1.42916 WP_003900336.1.42930 WP_003900336.1.42971 WP_003900336.1.43005 WP_003900336.1.43009 WP_003900336.1.43053 WP_003900336.1.43082 WP_003900336.1.43087 WP_003900336.1.43098 WP_003900336.1.43208 WP_003900336.1.43236 WP_003900336.1.43246 WP_003900336.1.43255 WP_003900336.1.43266 WP_003900336.1.43269 WP_003900336.1.43273 WP_003900336.1.43296 WP_003900336.1.43306 WP_003900336.1.4335 WP_003900336.1.43368 WP_003900336.1.43395 WP_003900336.1.43457 WP_003900336.1.43462 WP_003900336.1.43475 WP_003900336.1.43478 WP_003900336.1.43484 WP_003900336.1.43557 WP_003900336.1.43578 WP_003900336.1.43588 WP_003900336.1.43643 WP_003900336.1.43664 WP_003900336.1.43684 WP_003900336.1.43686 WP_003900336.1.43706 WP_003900336.1.43716 WP_003900336.1.4377 WP_003900336.1.43781 WP_003900336.1.43794 WP_003900336.1.43815 WP_003900336.1.43846 WP_003900336.1.43861 WP_003900336.1.43863 WP_003900336.1.43866 WP_003900336.1.43872 WP_003900336.1.43885 WP_003900336.1.43897 WP_003900336.1.4390 WP_003900336.1.43902 WP_003900336.1.43921 WP_003900336.1.43936 WP_003900336.1.43937 WP_003900336.1.43960 WP_003900336.1.43965 WP_003900336.1.4399 WP_003900336.1.43993 WP_003900336.1.43996 WP_003900336.1.44 WP_003900336.1.44001 WP_003900336.1.44008 WP_003900336.1.44016 WP_003900336.1.44033 WP_003900336.1.44037 WP_003900336.1.44041 WP_003900336.1.44070 WP_003900336.1.44071 WP_003900336.1.44076 WP_003900336.1.44104 WP_003900336.1.44111 WP_003900336.1.44124 WP_003900336.1.44169 WP_003900336.1.44219 WP_003900336.1.44237 WP_003900336.1.44277 WP_003900336.1.44279 WP_003900336.1.44336 WP_003900336.1.44355 WP_003900336.1.44358 WP_003900336.1.4438 WP_003900336.1.44390 WP_003900336.1.44392 WP_003900336.1.4441 WP_003900336.1.44415 WP_003900336.1.44464 WP_003900336.1.44466 WP_003900336.1.44489 WP_003900336.1.44492 WP_003900336.1.44494 WP_003900336.1.44500 WP_003900336.1.44519 WP_003900336.1.44526 WP_003900336.1.44532 WP_003900336.1.44534 WP_003900336.1.44562 WP_003900336.1.44589 WP_003900336.1.44597 WP_003900336.1.44600 WP_003900336.1.44602 WP_003900336.1.44615 WP_003900336.1.4464 WP_003900336.1.44651 WP_003900336.1.44659 WP_003900336.1.44665 WP_003900336.1.44694 WP_003900336.1.44700 WP_003900336.1.44713 WP_003900336.1.44735 WP_003900336.1.44740 WP_003900336.1.44757 WP_003900336.1.4476 WP_003900336.1.44761 WP_003900336.1.44767 WP_003900336.1.44776 WP_003900336.1.44779 WP_003900336.1.44786 WP_003900336.1.44808 WP_003900336.1.44864 WP_003900336.1.44901 WP_003900336.1.44908 WP_003900336.1.44913 WP_003900336.1.4492 WP_003900336.1.44939 WP_003900336.1.44979 WP_003900336.1.44981 WP_003900336.1.45002 WP_003900336.1.45011 WP_003900336.1.4504 WP_003900336.1.45062 WP_003900336.1.45066 WP_003900336.1.45081 WP_003900336.1.45113 WP_003900336.1.45129 WP_003900336.1.45135 WP_003900336.1.45147 WP_003900336.1.45168 WP_003900336.1.4517 WP_003900336.1.45181 WP_003900336.1.45185 WP_003900336.1.45192 WP_003900336.1.45200 WP_003900336.1.45205 WP_003900336.1.45211 WP_003900336.1.45249 WP_003900336.1.4526 WP_003900336.1.45286 WP_003900336.1.45326 WP_003900336.1.45347 WP_003900336.1.45374 WP_003900336.1.45390 WP_003900336.1.454 WP_003900336.1.45407 WP_003900336.1.45451 WP_003900336.1.45453 WP_003900336.1.45460 WP_003900336.1.45463 WP_003900336.1.45470 WP_003900336.1.45474 WP_003900336.1.45491 WP_003900336.1.45510 WP_003900336.1.45563 WP_003900336.1.45584 WP_003900336.1.45590 WP_003900336.1.45619 WP_003900336.1.45626 WP_003900336.1.45631 WP_003900336.1.45666 WP_003900336.1.45697 WP_003900336.1.45731 WP_003900336.1.45743 WP_003900336.1.45765 WP_003900336.1.45776 WP_003900336.1.45783 WP_003900336.1.45805 WP_003900336.1.45815 WP_003900336.1.45849 WP_003900336.1.45867 WP_003900336.1.45884 WP_003900336.1.45923 WP_003900336.1.45926 WP_003900336.1.45963 WP_003900336.1.45989 WP_003900336.1.45992 WP_003900336.1.46025 WP_003900336.1.46083 WP_003900336.1.46090 WP_003900336.1.46092 WP_003900336.1.46100 WP_003900336.1.46101 WP_003900336.1.46103 WP_003900336.1.46107 WP_003900336.1.46127 WP_003900336.1.46128 WP_003900336.1.46129 WP_003900336.1.46141 WP_003900336.1.46150 WP_003900336.1.46201 WP_003900336.1.46226 WP_003900336.1.4624 WP_003900336.1.46253 WP_003900336.1.46268 WP_003900336.1.46285 WP_003900336.1.46300 WP_003900336.1.46313 WP_003900336.1.46336 WP_003900336.1.46365 WP_003900336.1.46370 WP_003900336.1.46381 WP_003900336.1.46402 WP_003900336.1.46411 WP_003900336.1.4644 WP_003900336.1.46442 WP_003900336.1.46453 WP_003900336.1.46463 WP_003900336.1.46478 WP_003900336.1.46492 WP_003900336.1.46521 WP_003900336.1.4653 WP_003900336.1.46532 WP_003900336.1.46539 WP_003900336.1.46568 WP_003900336.1.46585 WP_003900336.1.46609 WP_003900336.1.46613 WP_003900336.1.46625 WP_003900336.1.46642 WP_003900336.1.46647 WP_003900336.1.46674 WP_003900336.1.46724 WP_003900336.1.46773 WP_003900336.1.46777 WP_003900336.1.46786 WP_003900336.1.46792 WP_003900336.1.46847 WP_003900336.1.46851 WP_003900336.1.4687 WP_003900336.1.46897 WP_003900336.1.46936 WP_003900336.1.46980 WP_003900336.1.47011 WP_003900336.1.47012 WP_003900336.1.47066 WP_003900336.1.47077 WP_003900336.1.47106 WP_003900336.1.47142 WP_003900336.1.47147 WP_003900336.1.47166 WP_003900336.1.47178 WP_003900336.1.47179 WP_003900336.1.47194 WP_003900336.1.47207 WP_003900336.1.47210 WP_003900336.1.47261 WP_003900336.1.47262 WP_003900336.1.47402 WP_003900336.1.47423 WP_003900336.1.47467 WP_003900336.1.47502 WP_003900336.1.4751 WP_003900336.1.47511 WP_003900336.1.47537 WP_003900336.1.47540 WP_003900336.1.47568 WP_003900336.1.47572 WP_003900336.1.47588 WP_003900336.1.47636 WP_003900336.1.4764 WP_003900336.1.47653 WP_003900336.1.47679 WP_003900336.1.47681 WP_003900336.1.47690 WP_003900336.1.4771 WP_003900336.1.47717 WP_003900336.1.47743 WP_003900336.1.47754 WP_003900336.1.47773 WP_003900336.1.47776 WP_003900336.1.47780 WP_003900336.1.47805 WP_003900336.1.47832 WP_003900336.1.47847 WP_003900336.1.47858 WP_003900336.1.47861 WP_003900336.1.47868 WP_003900336.1.47893 WP_003900336.1.47899 WP_003900336.1.479 WP_003900336.1.47912 WP_003900336.1.47913 WP_003900336.1.4794 WP_003900336.1.47943 WP_003900336.1.47944 WP_003900336.1.47959 WP_003900336.1.47974 WP_003900336.1.47993 WP_003900336.1.48004 WP_003900336.1.48039 WP_003900336.1.48050 WP_003900336.1.48084 WP_003900336.1.48097 WP_003900336.1.48101 WP_003900336.1.48109 WP_003900336.1.4813 WP_003900336.1.48130 WP_003900336.1.48135 WP_003900336.1.48143 WP_003900336.1.48152 WP_003900336.1.48155 WP_003900336.1.48170 WP_003900336.1.48173 WP_003900336.1.48177 WP_003900336.1.48185 WP_003900336.1.48204 WP_003900336.1.48219 WP_003900336.1.4823 WP_003900336.1.48240 WP_003900336.1.48256 WP_003900336.1.48264 WP_003900336.1.48287 WP_003900336.1.48330 WP_003900336.1.48333 WP_003900336.1.48348 WP_003900336.1.48354 WP_003900336.1.48372 WP_003900336.1.48383 WP_003900336.1.48388 WP_003900336.1.48419 WP_003900336.1.48423 WP_003900336.1.48443 WP_003900336.1.48450 WP_003900336.1.48462 WP_003900336.1.48543 WP_003900336.1.48550 WP_003900336.1.48605 WP_003900336.1.48618 WP_003900336.1.4863 WP_003900336.1.48648 WP_003900336.1.48658 WP_003900336.1.48666 WP_003900336.1.48687 WP_003900336.1.48779 WP_003900336.1.4878 WP_003900336.1.48798 WP_003900336.1.48802 WP_003900336.1.48826 WP_003900336.1.48831 WP_003900336.1.48843 WP_003900336.1.48857 WP_003900336.1.4890 WP_003900336.1.48946 WP_003900336.1.48979 WP_003900336.1.49017 WP_003900336.1.49048 WP_003900336.1.49059 WP_003900336.1.4906 WP_003900336.1.4907 WP_003900336.1.49103 WP_003900336.1.49110 WP_003900336.1.49111 WP_003900336.1.49112 WP_003900336.1.4919 WP_003900336.1.49251 WP_003900336.1.49254 WP_003900336.1.49263 WP_003900336.1.49291 WP_003900336.1.49296 WP_003900336.1.49335 WP_003900336.1.49337 WP_003900336.1.49419 WP_003900336.1.49426 WP_003900336.1.49437 WP_003900336.1.49439 WP_003900336.1.49474 WP_003900336.1.49506 WP_003900336.1.49516 WP_003900336.1.49523 WP_003900336.1.49526 WP_003900336.1.49532 WP_003900336.1.49588 WP_003900336.1.4959 WP_003900336.1.49678 WP_003900336.1.49687 WP_003900336.1.49699 WP_003900336.1.49709 WP_003900336.1.4971 WP_003900336.1.4972 WP_003900336.1.49736 WP_003900336.1.49746 WP_003900336.1.49764 WP_003900336.1.49773 WP_003900336.1.49796 WP_003900336.1.49814 WP_003900336.1.49815 WP_003900336.1.49816 WP_003900336.1.49839 WP_003900336.1.49857 WP_003900336.1.49878 WP_003900336.1.49880 WP_003900336.1.49944 WP_003900336.1.4999 WP_003900336.1.49990 WP_003900336.1.50068 WP_003900336.1.50077 WP_003900336.1.5008 WP_003900336.1.50081 WP_003900336.1.50122 WP_003900336.1.50126 WP_003900336.1.50149 WP_003900336.1.50162 WP_003900336.1.5018 WP_003900336.1.50194 WP_003900336.1.50218 WP_003900336.1.50235 WP_003900336.1.50249 WP_003900336.1.50265 WP_003900336.1.50271 WP_003900336.1.50324 WP_003900336.1.50347 WP_003900336.1.50372 WP_003900336.1.50398 WP_003900336.1.50407 WP_003900336.1.50444 WP_003900336.1.50466 WP_003900336.1.50472 WP_003900336.1.5048 WP_003900336.1.50498 WP_003900336.1.5050 WP_003900336.1.50540 WP_003900336.1.50554 WP_003900336.1.50557 WP_003900336.1.50601 WP_003900336.1.50610 WP_003900336.1.50632 WP_003900336.1.50633 WP_003900336.1.50642 WP_003900336.1.50655 WP_003900336.1.50659 WP_003900336.1.50683 WP_003900336.1.50689 WP_003900336.1.50692 WP_003900336.1.50714 WP_003900336.1.50729 WP_003900336.1.50756 WP_003900336.1.50784 WP_003900336.1.50794 WP_003900336.1.50841 WP_003900336.1.50860 WP_003900336.1.50868 WP_003900336.1.50877 WP_003900336.1.5096 WP_003900336.1.50981 WP_003900336.1.50987 WP_003900336.1.51003 WP_003900336.1.51009 WP_003900336.1.51037 WP_003900336.1.51074 WP_003900336.1.51082 WP_003900336.1.51101 WP_003900336.1.51116 WP_003900336.1.51149 WP_003900336.1.51156 WP_003900336.1.51157 WP_003900336.1.51213 WP_003900336.1.51232 WP_003900336.1.51239 WP_003900336.1.51247 WP_003900336.1.51266 WP_003900336.1.51279 WP_003900336.1.51291 WP_003900336.1.51294 WP_003900336.1.51301 WP_003900336.1.51329 WP_003900336.1.51391 WP_003900336.1.51422 WP_003900336.1.51445 WP_003900336.1.51455 WP_003900336.1.51466 WP_003900336.1.51468 WP_003900336.1.51478 WP_003900336.1.51497 WP_003900336.1.51520 WP_003900336.1.51593 WP_003900336.1.51628 WP_003900336.1.5164 WP_003900336.1.51647 WP_003900336.1.51660 WP_003900336.1.51696 WP_003900336.1.51721 WP_003900336.1.51788 WP_003900336.1.51795 WP_003900336.1.51801 WP_003900336.1.51817 WP_003900336.1.51819 WP_003900336.1.51854 WP_003900336.1.51923 WP_003900336.1.51942 WP_003900336.1.51948 WP_003900336.1.51963 WP_003900336.1.51969 WP_003900336.1.52000 WP_003900336.1.52001 WP_003900336.1.52003 WP_003900336.1.52006 WP_003900336.1.52036 WP_003900336.1.52038 WP_003900336.1.52046 WP_003900336.1.52059 WP_003900336.1.52069 WP_003900336.1.52082 WP_003900336.1.52102 WP_003900336.1.52106 WP_003900336.1.52166 WP_003900336.1.52168 WP_003900336.1.52173 WP_003900336.1.52178 WP_003900336.1.52206 WP_003900336.1.52216 WP_003900336.1.52238 WP_003900336.1.52241 WP_003900336.1.52280 WP_003900336.1.52314 WP_003900336.1.52385 WP_003900336.1.52390 WP_003900336.1.524 WP_003900336.1.52460 WP_003900336.1.52485 WP_003900336.1.52486 WP_003900336.1.52495 WP_003900336.1.52504 WP_003900336.1.52522 WP_003900336.1.52531 WP_003900336.1.52533 WP_003900336.1.52545 WP_003900336.1.52553 WP_003900336.1.52563 WP_003900336.1.52564 WP_003900336.1.52574 WP_003900336.1.52641 WP_003900336.1.52673 WP_003900336.1.52674 WP_003900336.1.52708 WP_003900336.1.52713 WP_003900336.1.52761 WP_003900336.1.52778 WP_003900336.1.52791 WP_003900336.1.52797 WP_003900336.1.52818 WP_003900336.1.52872 WP_003900336.1.52873 WP_003900336.1.52891 WP_003900336.1.52909 WP_003900336.1.52970 WP_003900336.1.52998 WP_003900336.1.53053 WP_003900336.1.53056 WP_003900336.1.5306 WP_003900336.1.53088 WP_003900336.1.5309 WP_003900336.1.531 WP_003900336.1.53117 WP_003900336.1.53118 WP_003900336.1.53142 WP_003900336.1.53143 WP_003900336.1.53157 WP_003900336.1.53167 WP_003900336.1.53200 WP_003900336.1.53204 WP_003900336.1.53213 WP_003900336.1.53217 WP_003900336.1.53226 WP_003900336.1.53229 WP_003900336.1.53230 WP_003900336.1.53237 WP_003900336.1.53254 WP_003900336.1.53257 WP_003900336.1.5327 WP_003900336.1.53276 WP_003900336.1.53278 WP_003900336.1.53302 WP_003900336.1.53306 WP_003900336.1.5334 WP_003900336.1.5335 WP_003900336.1.53353 WP_003900336.1.53381 WP_003900336.1.53413 WP_003900336.1.53458 WP_003900336.1.53460 WP_003900336.1.53480 WP_003900336.1.53517 WP_003900336.1.53522 WP_003900336.1.53525 WP_003900336.1.53526 WP_003900336.1.53553 WP_003900336.1.53606 WP_003900336.1.53609 WP_003900336.1.53628 WP_003900336.1.53643 WP_003900336.1.53667 WP_003900336.1.53679 WP_003900336.1.53715 WP_003900336.1.53730 WP_003900336.1.53742 WP_003900336.1.53743 WP_003900336.1.53754 WP_003900336.1.53775 WP_003900336.1.53787 WP_003900336.1.53803 WP_003900336.1.53818 WP_003900336.1.53822 WP_003900336.1.53853 WP_003900336.1.53865 WP_003900336.1.53888 WP_003900336.1.53900 WP_003900336.1.53912 WP_003900336.1.53914 WP_003900336.1.53952 WP_003900336.1.53973 WP_003900336.1.5398 WP_003900336.1.5408 WP_003900336.1.54089 WP_003900336.1.54093 WP_003900336.1.54099 WP_003900336.1.54112 WP_003900336.1.54125 WP_003900336.1.54141 WP_003900336.1.54162 WP_003900336.1.54179 WP_003900336.1.54206 WP_003900336.1.54218 WP_003900336.1.54225 WP_003900336.1.54227 WP_003900336.1.54232 WP_003900336.1.54241 WP_003900336.1.54245 WP_003900336.1.54247 WP_003900336.1.54260 WP_003900336.1.54275 WP_003900336.1.54280 WP_003900336.1.5429 WP_003900336.1.54294 WP_003900336.1.54314 WP_003900336.1.54347 WP_003900336.1.54351 WP_003900336.1.54428 WP_003900336.1.54449 WP_003900336.1.54494 WP_003900336.1.54502 WP_003900336.1.54514 WP_003900336.1.54519 WP_003900336.1.5452 WP_003900336.1.54531 WP_003900336.1.54537 WP_003900336.1.54553 WP_003900336.1.54555 WP_003900336.1.54575 WP_003900336.1.54633 WP_003900336.1.54686 WP_003900336.1.54687 WP_003900336.1.54705 WP_003900336.1.54730 WP_003900336.1.54732 WP_003900336.1.5475 WP_003900336.1.54797 WP_003900336.1.54807 WP_003900336.1.54836 WP_003900336.1.54838 WP_003900336.1.54860 WP_003900336.1.54888 WP_003900336.1.54897 WP_003900336.1.54905 WP_003900336.1.54909 WP_003900336.1.54937 WP_003900336.1.54939 WP_003900336.1.54944 WP_003900336.1.54945 WP_003900336.1.54953 WP_003900336.1.54964 WP_003900336.1.55015 WP_003900336.1.55022 WP_003900336.1.55023 WP_003900336.1.55051 WP_003900336.1.55072 WP_003900336.1.55088 WP_003900336.1.55106 WP_003900336.1.55126 WP_003900336.1.55128 WP_003900336.1.55140 WP_003900336.1.55210 WP_003900336.1.55227 WP_003900336.1.55248 WP_003900336.1.55257 WP_003900336.1.55258 WP_003900336.1.55267 WP_003900336.1.55279 WP_003900336.1.55307 WP_003900336.1.55326 WP_003900336.1.55328 WP_003900336.1.5533 WP_003900336.1.55345 WP_003900336.1.55396 WP_003900336.1.55398 WP_003900336.1.55441 WP_003900336.1.55459 WP_003900336.1.55501 WP_003900336.1.55504 WP_003900336.1.55578 WP_003900336.1.55626 WP_003900336.1.55641 WP_003900336.1.5569 WP_003900336.1.55723 WP_003900336.1.55735 WP_003900336.1.5574 WP_003900336.1.55772 WP_003900336.1.55802 WP_003900336.1.55807 WP_003900336.1.55819 WP_003900336.1.55821 WP_003900336.1.5583 WP_003900336.1.55849 WP_003900336.1.55856 WP_003900336.1.55860 WP_003900336.1.55882 WP_003900336.1.55883 WP_003900336.1.55894 WP_003900336.1.55902 WP_003900336.1.55908 WP_003900336.1.55909 WP_003900336.1.5591 WP_003900336.1.55961 WP_003900336.1.55977 WP_003900336.1.55983 WP_003900336.1.56028 WP_003900336.1.56060 WP_003900336.1.56107 WP_003900336.1.56132 WP_003900336.1.56163 WP_003900336.1.56167 WP_003900336.1.56178 WP_003900336.1.56287 WP_003900336.1.56292 WP_003900336.1.56327 WP_003900336.1.56341 WP_003900336.1.56359 WP_003900336.1.56365 WP_003900336.1.56394 WP_003900336.1.56443 WP_003900336.1.56473 WP_003900336.1.56478 WP_003900336.1.56500 WP_003900336.1.56517 WP_003900336.1.56534 WP_003900336.1.56577 WP_003900336.1.56593 WP_003900336.1.56625 WP_003900336.1.56637 WP_003900336.1.56670 WP_003900336.1.56697 WP_003900336.1.567 WP_003900336.1.56701 WP_003900336.1.56709 WP_003900336.1.56729 WP_003900336.1.56743 WP_003900336.1.56755 WP_003900336.1.56764 WP_003900336.1.56769 WP_003900336.1.56795 WP_003900336.1.5681 WP_003900336.1.56827 WP_003900336.1.56839 WP_003900336.1.56863 WP_003900336.1.56868 WP_003900336.1.56869 WP_003900336.1.56915 WP_003900336.1.56926 WP_003900336.1.56961 WP_003900336.1.56971 WP_003900336.1.56972 WP_003900336.1.57023 WP_003900336.1.57035 WP_003900336.1.57077 WP_003900336.1.57087 WP_003900336.1.57134 WP_003900336.1.57151 WP_003900336.1.57169 WP_003900336.1.57208 WP_003900336.1.57212 WP_003900336.1.57230 WP_003900336.1.5724 WP_003900336.1.5725 WP_003900336.1.5727 WP_003900336.1.57273 WP_003900336.1.573 WP_003900336.1.57314 WP_003900336.1.57326 WP_003900336.1.57328 WP_003900336.1.57331 WP_003900336.1.57340 WP_003900336.1.57351 WP_003900336.1.57352 WP_003900336.1.57380 WP_003900336.1.57430 WP_003900336.1.5744 WP_003900336.1.57440 WP_003900336.1.5745 WP_003900336.1.57461 WP_003900336.1.57469 WP_003900336.1.57489 WP_003900336.1.575 WP_003900336.1.57509 WP_003900336.1.57519 WP_003900336.1.57525 WP_003900336.1.57551 WP_003900336.1.5758 WP_003900336.1.57596 WP_003900336.1.57604 WP_003900336.1.57616 WP_003900336.1.57617 WP_003900336.1.57619 WP_003900336.1.57627 WP_003900336.1.57642 WP_003900336.1.57658 WP_003900336.1.57667 WP_003900336.1.57675 WP_003900336.1.57708 WP_003900336.1.57794 WP_003900336.1.57821 WP_003900336.1.57825 WP_003900336.1.57843 WP_003900336.1.57906 WP_003900336.1.57924 WP_003900336.1.57926 WP_003900336.1.57930 WP_003900336.1.57957 WP_003900336.1.57960 WP_003900336.1.57964 WP_003900336.1.57991 WP_003900336.1.58000 WP_003900336.1.58086 WP_003900336.1.58101 WP_003900336.1.58103 WP_003900336.1.58108 WP_003900336.1.5811 WP_003900336.1.58121 WP_003900336.1.58145 WP_003900336.1.58164 WP_003900336.1.58174 WP_003900336.1.582 WP_003900336.1.58202 WP_003900336.1.58209 WP_003900336.1.5824 WP_003900336.1.58250 WP_003900336.1.58259 WP_003900336.1.58283 WP_003900336.1.58288 WP_003900336.1.5830 WP_003900336.1.58303 WP_003900336.1.58311 WP_003900336.1.58330 WP_003900336.1.58359 WP_003900336.1.58386 WP_003900336.1.58393 WP_003900336.1.58431 WP_003900336.1.5844 WP_003900336.1.58457 WP_003900336.1.58488 WP_003900336.1.58518 WP_003900336.1.58534 WP_003900336.1.58559 WP_003900336.1.58567 WP_003900336.1.58573 WP_003900336.1.58602 WP_003900336.1.58612 WP_003900336.1.58619 WP_003900336.1.58630 WP_003900336.1.5865 WP_003900336.1.58671 WP_003900336.1.58690 WP_003900336.1.58702 WP_003900336.1.58743 WP_003900336.1.58754 WP_003900336.1.5879 WP_003900336.1.5881 WP_003900336.1.58824 WP_003900336.1.58848 WP_003900336.1.58857 WP_003900336.1.58891 WP_003900336.1.58892 WP_003900336.1.5890 WP_003900336.1.58904 WP_003900336.1.58921 WP_003900336.1.58930 WP_003900336.1.58939 WP_003900336.1.58941 WP_003900336.1.58953 WP_003900336.1.58961 WP_003900336.1.5898 WP_003900336.1.59025 WP_003900336.1.59029 WP_003900336.1.59037 WP_003900336.1.59044 WP_003900336.1.59085 WP_003900336.1.59088 WP_003900336.1.59112 WP_003900336.1.59130 WP_003900336.1.5914 WP_003900336.1.59147 WP_003900336.1.59166 WP_003900336.1.59205 WP_003900336.1.59209 WP_003900336.1.59237 WP_003900336.1.59240 WP_003900336.1.59253 WP_003900336.1.59254 WP_003900336.1.59262 WP_003900336.1.59270 WP_003900336.1.5928 WP_003900336.1.59304 WP_003900336.1.59305 WP_003900336.1.59309 WP_003900336.1.59316 WP_003900336.1.59326 WP_003900336.1.59328 WP_003900336.1.59333 WP_003900336.1.59338 WP_003900336.1.59388 WP_003900336.1.59428 WP_003900336.1.59487 WP_003900336.1.59537 WP_003900336.1.59561 WP_003900336.1.59677 WP_003900336.1.59722 WP_003900336.1.59727 WP_003900336.1.59732 WP_003900336.1.59738 WP_003900336.1.59750 WP_003900336.1.59757 WP_003900336.1.59808 WP_003900336.1.59850 WP_003900336.1.59856 WP_003900336.1.59860 WP_003900336.1.59861 WP_003900336.1.5987 WP_003900336.1.59878 WP_003900336.1.59888 WP_003900336.1.59952 WP_003900336.1.5996 WP_003900336.1.59961 WP_003900336.1.59974 WP_003900336.1.6000 WP_003900336.1.60007 WP_003900336.1.60016 WP_003900336.1.6003 WP_003900336.1.60047 WP_003900336.1.6007 WP_003900336.1.60091 WP_003900336.1.60121 WP_003900336.1.60125 WP_003900336.1.60135 WP_003900336.1.60139 WP_003900336.1.60152 WP_003900336.1.60171 WP_003900336.1.60197 WP_003900336.1.6020 WP_003900336.1.60205 WP_003900336.1.60207 WP_003900336.1.60215 WP_003900336.1.60217 WP_003900336.1.60267 WP_003900336.1.60288 WP_003900336.1.60291 WP_003900336.1.60301 WP_003900336.1.60305 WP_003900336.1.60312 WP_003900336.1.60313 WP_003900336.1.60314 WP_003900336.1.60367 WP_003900336.1.60376 WP_003900336.1.60403 WP_003900336.1.60413 WP_003900336.1.60421 WP_003900336.1.60451 WP_003900336.1.60460 WP_003900336.1.60479 WP_003900336.1.60512 WP_003900336.1.60573 WP_003900336.1.60583 WP_003900336.1.60632 WP_003900336.1.60657 WP_003900336.1.60687 WP_003900336.1.60689 WP_003900336.1.60727 WP_003900336.1.60738 WP_003900336.1.60763 WP_003900336.1.6077 WP_003900336.1.60791 WP_003900336.1.60834 WP_003900336.1.60870 WP_003900336.1.60878 WP_003900336.1.60879 WP_003900336.1.60913 WP_003900336.1.60978 WP_003900336.1.61000 WP_003900336.1.61001 WP_003900336.1.61012 WP_003900336.1.61014 WP_003900336.1.61015 WP_003900336.1.61037 WP_003900336.1.61052 WP_003900336.1.61065 WP_003900336.1.61100 WP_003900336.1.61101 WP_003900336.1.61138 WP_003900336.1.61142 WP_003900336.1.61198 WP_003900336.1.612 WP_003900336.1.61234 WP_003900336.1.61256 WP_003900336.1.61281 WP_003900336.1.61314 WP_003900336.1.61321 WP_003900336.1.61326 WP_003900336.1.61328 WP_003900336.1.61368 WP_003900336.1.61391 WP_003900336.1.61406 WP_003900336.1.61409 WP_003900336.1.61420 WP_003900336.1.61422 WP_003900336.1.61425 WP_003900336.1.61428 WP_003900336.1.61469 WP_003900336.1.61494 WP_003900336.1.61522 WP_003900336.1.61552 WP_003900336.1.61557 WP_003900336.1.61567 WP_003900336.1.61571 WP_003900336.1.61573 WP_003900336.1.61584 WP_003900336.1.61586 WP_003900336.1.6159 WP_003900336.1.61592 WP_003900336.1.6160 WP_003900336.1.61614 WP_003900336.1.6163 WP_003900336.1.61655 WP_003900336.1.61665 WP_003900336.1.61669 WP_003900336.1.61682 WP_003900336.1.61692 WP_003900336.1.61719 WP_003900336.1.61728 WP_003900336.1.61750 WP_003900336.1.61754 WP_003900336.1.61755 WP_003900336.1.61757 WP_003900336.1.61778 WP_003900336.1.6179 WP_003900336.1.61793 WP_003900336.1.61816 WP_003900336.1.61842 WP_003900336.1.61850 WP_003900336.1.61862 WP_003900336.1.61865 WP_003900336.1.61868 WP_003900336.1.61911 WP_003900336.1.61925 WP_003900336.1.61941 WP_003900336.1.61953 WP_003900336.1.61979 WP_003900336.1.61986 WP_003900336.1.61987 WP_003900336.1.61998 WP_003900336.1.62021 WP_003900336.1.62087 WP_003900336.1.62089 WP_003900336.1.62101 WP_003900336.1.62104 WP_003900336.1.6211 WP_003900336.1.62132 WP_003900336.1.62162 WP_003900336.1.62225 WP_003900336.1.62230 WP_003900336.1.62238 WP_003900336.1.62249 WP_003900336.1.62270 WP_003900336.1.62281 WP_003900336.1.62307 WP_003900336.1.6231 WP_003900336.1.62359 WP_003900336.1.62360 WP_003900336.1.62371 WP_003900336.1.62379 WP_003900336.1.62395 WP_003900336.1.62408 WP_003900336.1.62449 WP_003900336.1.62468 WP_003900336.1.6248 WP_003900336.1.62508 WP_003900336.1.62565 WP_003900336.1.62594 WP_003900336.1.62606 WP_003900336.1.62616 WP_003900336.1.62666 WP_003900336.1.62687 WP_003900336.1.62715 WP_003900336.1.62730 WP_003900336.1.62738 WP_003900336.1.62761 WP_003900336.1.62766 WP_003900336.1.62786 WP_003900336.1.62813 WP_003900336.1.62839 WP_003900336.1.62841 WP_003900336.1.62936 WP_003900336.1.6294 WP_003900336.1.62962 WP_003900336.1.63007 WP_003900336.1.63019 WP_003900336.1.63032 WP_003900336.1.63037 WP_003900336.1.63064 WP_003900336.1.63066 WP_003900336.1.63072 WP_003900336.1.6308 WP_003900336.1.63081 WP_003900336.1.63096 WP_003900336.1.63106 WP_003900336.1.63144 WP_003900336.1.63154 WP_003900336.1.63160 WP_003900336.1.63161 WP_003900336.1.63166 WP_003900336.1.63175 WP_003900336.1.63194 WP_003900336.1.6322 WP_003900336.1.63222 WP_003900336.1.63247 WP_003900336.1.63291 WP_003900336.1.63312 WP_003900336.1.63317 WP_003900336.1.63331 WP_003900336.1.63373 WP_003900336.1.63384 WP_003900336.1.63403 WP_003900336.1.63424 WP_003900336.1.63428 WP_003900336.1.6345 WP_003900336.1.63464 WP_003900336.1.63483 WP_003900336.1.63502 WP_003900336.1.63504 WP_003900336.1.63522 WP_003900336.1.63530 WP_003900336.1.63538 WP_003900336.1.63564 WP_003900336.1.63567 WP_003900336.1.63596 WP_003900336.1.63600 WP_003900336.1.63623 WP_003900336.1.63624 WP_003900336.1.63625 WP_003900336.1.63627 WP_003900336.1.63654 WP_003900336.1.63662 WP_003900336.1.63711 WP_003900336.1.63734 WP_003900336.1.63807 WP_003900336.1.63819 WP_003900336.1.63844 WP_003900336.1.63888 WP_003900336.1.63913 WP_003900336.1.63915 WP_003900336.1.63918 WP_003900336.1.63961 WP_003900336.1.63970 WP_003900336.1.64000 WP_003900336.1.64027 WP_003900336.1.64058 WP_003900336.1.64065 WP_003900336.1.6407 WP_003900336.1.64082 WP_003900336.1.64091 WP_003900336.1.64102 WP_003900336.1.64104 WP_003900336.1.64119 WP_003900336.1.64169 WP_003900336.1.64219 WP_003900336.1.6422 WP_003900336.1.64222 WP_003900336.1.64223 WP_003900336.1.64228 WP_003900336.1.64235 WP_003900336.1.64249 WP_003900336.1.6427 WP_003900336.1.64278 WP_003900336.1.64287 WP_003900336.1.64414 WP_003900336.1.64419 WP_003900336.1.6443 WP_003900336.1.64463 WP_003900336.1.64480 WP_003900336.1.64497 WP_003900336.1.64506 WP_003900336.1.64511 WP_003900336.1.64513 WP_003900336.1.64514 WP_003900336.1.64515 WP_003900336.1.64522 WP_003900336.1.64526 WP_003900336.1.64543 WP_003900336.1.6456 WP_003900336.1.64567 WP_003900336.1.64588 WP_003900336.1.64589 WP_003900336.1.64594 WP_003900336.1.64595 WP_003900336.1.64608 WP_003900336.1.64619 WP_003900336.1.64629 WP_003900336.1.6464 WP_003900336.1.64664 WP_003900336.1.64669 WP_003900336.1.64672 WP_003900336.1.64680 WP_003900336.1.64682 WP_003900336.1.64727 WP_003900336.1.64776 WP_003900336.1.64802 WP_003900336.1.64832 WP_003900336.1.6486 WP_003900336.1.64870 WP_003900336.1.64898 WP_003900336.1.64922 WP_003900336.1.64924 WP_003900336.1.6493 WP_003900336.1.64937 WP_003900336.1.64941 WP_003900336.1.64966 WP_003900336.1.64973 WP_003900336.1.65001 WP_003900336.1.65026 WP_003900336.1.65053 WP_003900336.1.65070 WP_003900336.1.65079 WP_003900336.1.65102 WP_003900336.1.65157 WP_003900336.1.65181 WP_003900336.1.65212 WP_003900336.1.65229 WP_003900336.1.6523 WP_003900336.1.65253 WP_003900336.1.65289 WP_003900336.1.65291 WP_003900336.1.65315 WP_003900336.1.65329 WP_003900336.1.65359 WP_003900336.1.6536 WP_003900336.1.65374 WP_003900336.1.65414 WP_003900336.1.65416 WP_003900336.1.65433 WP_003900336.1.65455 WP_003900336.1.65467 WP_003900336.1.65488 WP_003900336.1.65529 WP_003900336.1.65539 WP_003900336.1.65583 WP_003900336.1.65612 WP_003900336.1.65623 WP_003900336.1.65635 WP_003900336.1.65637 WP_003900336.1.65648 WP_003900336.1.65683 WP_003900336.1.65686 WP_003900336.1.65688 WP_003900336.1.65707 WP_003900336.1.65733 WP_003900336.1.65746 WP_003900336.1.65747 WP_003900336.1.65759 WP_003900336.1.65816 WP_003900336.1.65830 WP_003900336.1.65858 WP_003900336.1.65862 WP_003900336.1.65869 WP_003900336.1.65893 WP_003900336.1.65929 WP_003900336.1.65932 WP_003900336.1.65958 WP_003900336.1.65974 WP_003900336.1.66004 WP_003900336.1.66013 WP_003900336.1.6606 WP_003900336.1.66089 WP_003900336.1.66149 WP_003900336.1.66151 WP_003900336.1.66229 WP_003900336.1.66276 WP_003900336.1.66293 WP_003900336.1.66297 WP_003900336.1.66323 WP_003900336.1.66325 WP_003900336.1.6633 WP_003900336.1.66334 WP_003900336.1.66355 WP_003900336.1.66367 WP_003900336.1.66394 WP_003900336.1.66396 WP_003900336.1.66451 WP_003900336.1.66455 WP_003900336.1.66457 WP_003900336.1.66460 WP_003900336.1.66464 WP_003900336.1.66466 WP_003900336.1.66487 WP_003900336.1.66504 WP_003900336.1.66544 WP_003900336.1.66558 WP_003900336.1.66580 WP_003900336.1.66582 WP_003900336.1.66612 WP_003900336.1.66615 WP_003900336.1.66617 WP_003900336.1.66635 WP_003900336.1.66656 WP_003900336.1.66663 WP_003900336.1.66675 WP_003900336.1.66715 WP_003900336.1.66718 WP_003900336.1.66762 WP_003900336.1.66776 WP_003900336.1.66808 WP_003900336.1.66817 WP_003900336.1.66819 WP_003900336.1.66826 WP_003900336.1.66830 WP_003900336.1.66842 WP_003900336.1.66868 WP_003900336.1.66878 WP_003900336.1.66880 WP_003900336.1.66893 WP_003900336.1.66961 WP_003900336.1.67005 WP_003900336.1.6704 WP_003900336.1.67044 WP_003900336.1.67061 WP_003900336.1.67089 WP_003900336.1.67098 WP_003900336.1.67146 WP_003900336.1.67170 WP_003900336.1.67197 WP_003900336.1.67198 WP_003900336.1.6720 WP_003900336.1.67207 WP_003900336.1.67218 WP_003900336.1.67220 WP_003900336.1.67225 WP_003900336.1.67231 WP_003900336.1.6724 WP_003900336.1.67257 WP_003900336.1.67298 WP_003900336.1.67307 WP_003900336.1.67324 WP_003900336.1.67332 WP_003900336.1.67346 WP_003900336.1.67354 WP_003900336.1.67360 WP_003900336.1.67381 WP_003900336.1.67396 WP_003900336.1.67417 WP_003900336.1.67422 WP_003900336.1.67453 WP_003900336.1.67459 WP_003900336.1.6746 WP_003900336.1.67473 WP_003900336.1.67481 WP_003900336.1.67482 WP_003900336.1.67496 WP_003900336.1.67499 WP_003900336.1.67516 WP_003900336.1.67523 WP_003900336.1.67536 WP_003900336.1.67575 WP_003900336.1.67587 WP_003900336.1.67598 WP_003900336.1.67600 WP_003900336.1.67602 WP_003900336.1.67630 WP_003900336.1.67679 WP_003900336.1.67692 WP_003900336.1.67744 WP_003900336.1.6775 WP_003900336.1.67750 WP_003900336.1.6777 WP_003900336.1.67809 WP_003900336.1.67816 WP_003900336.1.67844 WP_003900336.1.67848 WP_003900336.1.67870 WP_003900336.1.67915 WP_003900336.1.67945 WP_003900336.1.67949 WP_003900336.1.67980 WP_003900336.1.67982 WP_003900336.1.68022 WP_003900336.1.68029 WP_003900336.1.68037 WP_003900336.1.68038 WP_003900336.1.68045 WP_003900336.1.68057 WP_003900336.1.68083 WP_003900336.1.68088 WP_003900336.1.68106 WP_003900336.1.68110 WP_003900336.1.68153 WP_003900336.1.68164 WP_003900336.1.68169 WP_003900336.1.68193 WP_003900336.1.68212 WP_003900336.1.68243 WP_003900336.1.6825 WP_003900336.1.68297 WP_003900336.1.68309 WP_003900336.1.68325 WP_003900336.1.68329 WP_003900336.1.68340 WP_003900336.1.68384 WP_003900336.1.68388 WP_003900336.1.68429 WP_003900336.1.6843 WP_003900336.1.68433 WP_003900336.1.68444 WP_003900336.1.68465 WP_003900336.1.68484 WP_003900336.1.68518 WP_003900336.1.68569 WP_003900336.1.68576 WP_003900336.1.68586 WP_003900336.1.68623 WP_003900336.1.68624 WP_003900336.1.68637 WP_003900336.1.68646 WP_003900336.1.68667 WP_003900336.1.68669 WP_003900336.1.68672 WP_003900336.1.68684 WP_003900336.1.68704 WP_003900336.1.68708 WP_003900336.1.6872 WP_003900336.1.68730 WP_003900336.1.68734 WP_003900336.1.68748 WP_003900336.1.68754 WP_003900336.1.6876 WP_003900336.1.68761 WP_003900336.1.68763 WP_003900336.1.68766 WP_003900336.1.68774 WP_003900336.1.68796 WP_003900336.1.68824 WP_003900336.1.68832 WP_003900336.1.68833 WP_003900336.1.68841 WP_003900336.1.68859 WP_003900336.1.68876 WP_003900336.1.68906 WP_003900336.1.68923 WP_003900336.1.68945 WP_003900336.1.6896 WP_003900336.1.68981 WP_003900336.1.68984 WP_003900336.1.68997 WP_003900336.1.69008 WP_003900336.1.69076 WP_003900336.1.69079 WP_003900336.1.6908 WP_003900336.1.69082 WP_003900336.1.69178 WP_003900336.1.69181 WP_003900336.1.69208 WP_003900336.1.69231 WP_003900336.1.69256 WP_003900336.1.69311 WP_003900336.1.69315 WP_003900336.1.69322 WP_003900336.1.69342 WP_003900336.1.6935 WP_003900336.1.6936 WP_003900336.1.69369 WP_003900336.1.69374 WP_003900336.1.69398 WP_003900336.1.69401 WP_003900336.1.69426 WP_003900336.1.69427 WP_003900336.1.69429 WP_003900336.1.6949 WP_003900336.1.6951 WP_003900336.1.69511 WP_003900336.1.69526 WP_003900336.1.69528 WP_003900336.1.69547 WP_003900336.1.69573 WP_003900336.1.69581 WP_003900336.1.6960 WP_003900336.1.69617 WP_003900336.1.69634 WP_003900336.1.69647 WP_003900336.1.69659 WP_003900336.1.69673 WP_003900336.1.69682 WP_003900336.1.69684 WP_003900336.1.69686 WP_003900336.1.69707 WP_003900336.1.69709 WP_003900336.1.69723 WP_003900336.1.69736 WP_003900336.1.69800 WP_003900336.1.69802 WP_003900336.1.69845 WP_003900336.1.69870 WP_003900336.1.69873 WP_003900336.1.69898 WP_003900336.1.69913 WP_003900336.1.69931 WP_003900336.1.69938 WP_003900336.1.69955 WP_003900336.1.69957 WP_003900336.1.69981 WP_003900336.1.69990 WP_003900336.1.70 WP_003900336.1.70000 WP_003900336.1.70017 WP_003900336.1.70032 WP_003900336.1.70055 WP_003900336.1.70062 WP_003900336.1.70072 WP_003900336.1.70131 WP_003900336.1.70132 WP_003900336.1.7022 WP_003900336.1.70227 WP_003900336.1.70255 WP_003900336.1.70271 WP_003900336.1.70274 WP_003900336.1.7029 WP_003900336.1.70325 WP_003900336.1.70328 WP_003900336.1.70356 WP_003900336.1.70364 WP_003900336.1.70368 WP_003900336.1.70369 WP_003900336.1.70418 WP_003900336.1.70422 WP_003900336.1.70435 WP_003900336.1.70444 WP_003900336.1.70463 WP_003900336.1.70471 WP_003900336.1.70480 WP_003900336.1.70494 WP_003900336.1.70498 WP_003900336.1.70505 WP_003900336.1.70525 WP_003900336.1.70573 WP_003900336.1.70577 WP_003900336.1.70610 WP_003900336.1.70615 WP_003900336.1.70618 WP_003900336.1.70622 WP_003900336.1.70626 WP_003900336.1.70668 WP_003900336.1.70699 WP_003900336.1.70704 WP_003900336.1.70729 WP_003900336.1.70757 WP_003900336.1.70782 WP_003900336.1.70796 WP_003900336.1.70830 WP_003900336.1.70834 WP_003900336.1.7084 WP_003900336.1.70840 WP_003900336.1.70864 WP_003900336.1.70871 WP_003900336.1.70915 WP_003900336.1.70955 WP_003900336.1.70958 WP_003900336.1.70964 WP_003900336.1.70976 WP_003900336.1.71015 WP_003900336.1.71026 WP_003900336.1.71063 WP_003900336.1.71076 WP_003900336.1.71083 WP_003900336.1.7111 WP_003900336.1.71118 WP_003900336.1.71128 WP_003900336.1.7113 WP_003900336.1.71187 WP_003900336.1.71191 WP_003900336.1.71255 WP_003900336.1.71258 WP_003900336.1.71259 WP_003900336.1.71326 WP_003900336.1.71329 WP_003900336.1.71331 WP_003900336.1.71344 WP_003900336.1.71390 WP_003900336.1.71399 WP_003900336.1.71414 WP_003900336.1.71440 WP_003900336.1.71457 WP_003900336.1.71464 WP_003900336.1.71490 WP_003900336.1.71492 WP_003900336.1.71509 WP_003900336.1.71516 WP_003900336.1.71517 WP_003900336.1.71527 WP_003900336.1.71532 WP_003900336.1.71545 WP_003900336.1.71546 WP_003900336.1.71569 WP_003900336.1.71604 WP_003900336.1.71621 WP_003900336.1.71630 WP_003900336.1.71654 WP_003900336.1.71664 WP_003900336.1.71665 WP_003900336.1.71683 WP_003900336.1.71701 WP_003900336.1.71718 WP_003900336.1.71731 WP_003900336.1.71778 WP_003900336.1.71781 WP_003900336.1.71803 WP_003900336.1.71820 WP_003900336.1.71847 WP_003900336.1.7185 WP_003900336.1.71851 WP_003900336.1.71871 WP_003900336.1.71909 WP_003900336.1.71957 WP_003900336.1.71970 WP_003900336.1.72047 WP_003900336.1.72061 WP_003900336.1.72062 WP_003900336.1.72072 WP_003900336.1.72111 WP_003900336.1.72122 WP_003900336.1.72128 WP_003900336.1.72143 WP_003900336.1.7216 WP_003900336.1.72168 WP_003900336.1.72179 WP_003900336.1.72209 WP_003900336.1.72218 WP_003900336.1.72219 WP_003900336.1.72227 WP_003900336.1.7224 WP_003900336.1.72268 WP_003900336.1.72332 WP_003900336.1.72380 WP_003900336.1.72401 WP_003900336.1.72405 WP_003900336.1.72420 WP_003900336.1.72441 WP_003900336.1.72451 WP_003900336.1.72452 WP_003900336.1.72457 WP_003900336.1.72459 WP_003900336.1.72460 WP_003900336.1.72466 WP_003900336.1.72487 WP_003900336.1.72488 WP_003900336.1.72492 WP_003900336.1.72506 WP_003900336.1.72543 WP_003900336.1.7256 WP_003900336.1.72576 WP_003900336.1.72578 WP_003900336.1.72585 WP_003900336.1.72591 WP_003900336.1.72592 WP_003900336.1.72640 WP_003900336.1.7266 WP_003900336.1.72661 WP_003900336.1.72684 WP_003900336.1.72739 WP_003900336.1.72744 WP_003900336.1.72755 WP_003900336.1.72759 WP_003900336.1.72784 WP_003900336.1.72792 WP_003900336.1.72826 WP_003900336.1.72831 WP_003900336.1.72852 WP_003900336.1.72853 WP_003900336.1.72879 WP_003900336.1.72938 WP_003900336.1.72954 WP_003900336.1.72957 WP_003900336.1.72959 WP_003900336.1.72973 WP_003900336.1.7298 WP_003900336.1.72982 WP_003900336.1.72988 WP_003900336.1.72993 WP_003900336.1.73006 WP_003900336.1.73013 WP_003900336.1.73025 WP_003900336.1.73028 WP_003900336.1.73045 WP_003900336.1.73092 WP_003900336.1.73118 WP_003900336.1.7312 WP_003900336.1.73134 WP_003900336.1.73150 WP_003900336.1.73154 WP_003900336.1.73163 WP_003900336.1.73182 WP_003900336.1.73205 WP_003900336.1.7321 WP_003900336.1.73310 WP_003900336.1.73315 WP_003900336.1.73365 WP_003900336.1.73391 WP_003900336.1.73404 WP_003900336.1.73424 WP_003900336.1.73436 WP_003900336.1.73445 WP_003900336.1.73453 WP_003900336.1.73465 WP_003900336.1.73466 WP_003900336.1.73470 WP_003900336.1.73471 WP_003900336.1.73478 WP_003900336.1.73482 WP_003900336.1.73507 WP_003900336.1.73532 WP_003900336.1.73550 WP_003900336.1.73564 WP_003900336.1.73623 WP_003900336.1.73629 WP_003900336.1.73644 WP_003900336.1.7366 WP_003900336.1.73661 WP_003900336.1.7368 WP_003900336.1.73688 WP_003900336.1.73723 WP_003900336.1.73744 WP_003900336.1.73750 WP_003900336.1.73760 WP_003900336.1.73774 WP_003900336.1.7379 WP_003900336.1.73813 WP_003900336.1.73840 WP_003900336.1.73876 WP_003900336.1.7389 WP_003900336.1.73986 WP_003900336.1.74016 WP_003900336.1.74039 WP_003900336.1.74083 WP_003900336.1.74101 WP_003900336.1.74107 WP_003900336.1.74120 WP_003900336.1.74129 WP_003900336.1.74144 WP_003900336.1.7417 WP_003900336.1.74190 WP_003900336.1.74210 WP_003900336.1.7423 WP_003900336.1.74262 WP_003900336.1.74269 WP_003900336.1.74282 WP_003900336.1.74291 WP_003900336.1.74296 WP_003900336.1.74304 WP_003900336.1.7432 WP_003900336.1.74347 WP_003900336.1.7436 WP_003900336.1.74378 WP_003900336.1.74382 WP_003900336.1.74395 WP_003900336.1.74400 WP_003900336.1.74401 WP_003900336.1.74432 WP_003900336.1.74442 WP_003900336.1.74477 WP_003900336.1.74487 WP_003900336.1.74499 WP_003900336.1.74504 WP_003900336.1.74511 WP_003900336.1.74523 WP_003900336.1.74525 WP_003900336.1.74551 WP_003900336.1.74555 WP_003900336.1.74628 WP_003900336.1.74641 WP_003900336.1.74653 WP_003900336.1.74660 WP_003900336.1.74683 WP_003900336.1.7469 WP_003900336.1.74725 WP_003900336.1.74760 WP_003900336.1.74786 WP_003900336.1.74809 WP_003900336.1.74820 WP_003900336.1.74870 WP_003900336.1.74881 WP_003900336.1.74888 WP_003900336.1.74952 WP_003900336.1.7496 WP_003900336.1.74988 WP_003900336.1.75043 WP_003900336.1.75045 WP_003900336.1.75055 WP_003900336.1.75078 WP_003900336.1.75081 WP_003900336.1.75120 WP_003900336.1.75163 WP_003900336.1.75188 WP_003900336.1.75200 WP_003900336.1.75202 WP_003900336.1.75234 WP_003900336.1.75239 WP_003900336.1.75250 WP_003900336.1.75263 WP_003900336.1.75281 WP_003900336.1.75342 WP_003900336.1.7535 WP_003900336.1.75376 WP_003900336.1.75391 WP_003900336.1.75395 WP_003900336.1.75441 WP_003900336.1.75510 WP_003900336.1.75581 WP_003900336.1.75598 WP_003900336.1.75635 WP_003900336.1.75645 WP_003900336.1.75665 WP_003900336.1.75671 WP_003900336.1.75741 WP_003900336.1.75749 WP_003900336.1.75772 WP_003900336.1.75774 WP_003900336.1.75811 WP_003900336.1.75833 WP_003900336.1.7585 WP_003900336.1.75864 WP_003900336.1.75868 WP_003900336.1.75878 WP_003900336.1.75927 WP_003900336.1.75946 WP_003900336.1.75968 WP_003900336.1.75974 WP_003900336.1.76007 WP_003900336.1.76016 WP_003900336.1.76032 WP_003900336.1.76037 WP_003900336.1.7604 WP_003900336.1.76045 WP_003900336.1.76052 WP_003900336.1.76058 WP_003900336.1.76064 WP_003900336.1.76110 WP_003900336.1.76126 WP_003900336.1.76133 WP_003900336.1.76138 WP_003900336.1.76157 WP_003900336.1.76172 WP_003900336.1.76177 WP_003900336.1.76183 WP_003900336.1.76209 WP_003900336.1.76277 WP_003900336.1.76280 WP_003900336.1.76281 WP_003900336.1.76291 WP_003900336.1.76297 WP_003900336.1.76360 WP_003900336.1.76379 WP_003900336.1.76403 WP_003900336.1.76413 WP_003900336.1.76414 WP_003900336.1.76427 WP_003900336.1.76436 WP_003900336.1.76442 WP_003900336.1.76443 WP_003900336.1.76456 WP_003900336.1.76521 WP_003900336.1.76533 WP_003900336.1.76616 WP_003900336.1.76625 WP_003900336.1.76629 WP_003900336.1.76635 WP_003900336.1.76638 WP_003900336.1.76639 WP_003900336.1.76640 WP_003900336.1.76644 WP_003900336.1.76677 WP_003900336.1.76678 WP_003900336.1.76734 WP_003900336.1.76744 WP_003900336.1.76750 WP_003900336.1.76754 WP_003900336.1.76757 WP_003900336.1.76781 WP_003900336.1.76818 WP_003900336.1.76824 WP_003900336.1.76835 WP_003900336.1.76873 WP_003900336.1.76881 WP_003900336.1.76888 WP_003900336.1.76900 WP_003900336.1.7691 WP_003900336.1.76947 WP_003900336.1.76955 WP_003900336.1.76963 WP_003900336.1.76976 WP_003900336.1.770 WP_003900336.1.77000 WP_003900336.1.77008 WP_003900336.1.77021 WP_003900336.1.77056 WP_003900336.1.77065 WP_003900336.1.77075 WP_003900336.1.77093 WP_003900336.1.77115 WP_003900336.1.77118 WP_003900336.1.77125 WP_003900336.1.77141 WP_003900336.1.77142 WP_003900336.1.77166 WP_003900336.1.77250 WP_003900336.1.77252 WP_003900336.1.77260 WP_003900336.1.77266 WP_003900336.1.77280 WP_003900336.1.77285 WP_003900336.1.77312 WP_003900336.1.77348 WP_003900336.1.77351 WP_003900336.1.77352 WP_003900336.1.77361 WP_003900336.1.774 WP_003900336.1.7740 WP_003900336.1.77404 WP_003900336.1.77425 WP_003900336.1.77463 WP_003900336.1.77474 WP_003900336.1.7748 WP_003900336.1.77484 WP_003900336.1.77491 WP_003900336.1.77499 WP_003900336.1.77510 WP_003900336.1.77530 WP_003900336.1.77554 WP_003900336.1.77559 WP_003900336.1.77599 WP_003900336.1.77605 WP_003900336.1.7762 WP_003900336.1.77627 WP_003900336.1.77649 WP_003900336.1.77654 WP_003900336.1.7766 WP_003900336.1.77667 WP_003900336.1.77704 WP_003900336.1.77706 WP_003900336.1.77726 WP_003900336.1.77774 WP_003900336.1.7778 WP_003900336.1.77790 WP_003900336.1.77809 WP_003900336.1.77820 WP_003900336.1.77843 WP_003900336.1.77855 WP_003900336.1.77865 WP_003900336.1.77868 WP_003900336.1.77879 WP_003900336.1.77890 WP_003900336.1.77909 WP_003900336.1.77911 WP_003900336.1.77931 WP_003900336.1.77984 WP_003900336.1.78020 WP_003900336.1.78024 WP_003900336.1.78075 WP_003900336.1.78084 WP_003900336.1.78086 WP_003900336.1.7809 WP_003900336.1.78098 WP_003900336.1.78105 WP_003900336.1.78113 WP_003900336.1.78136 WP_003900336.1.78162 WP_003900336.1.7817 WP_003900336.1.78200 WP_003900336.1.78216 WP_003900336.1.78236 WP_003900336.1.78238 WP_003900336.1.78322 WP_003900336.1.78338 WP_003900336.1.7836 WP_003900336.1.78360 WP_003900336.1.78386 WP_003900336.1.78429 WP_003900336.1.78435 WP_003900336.1.7844 WP_003900336.1.78459 WP_003900336.1.78488 WP_003900336.1.7849 WP_003900336.1.78499 WP_003900336.1.785 WP_003900336.1.78516 WP_003900336.1.78524 WP_003900336.1.78526 WP_003900336.1.78538 WP_003900336.1.78544 WP_003900336.1.78545 WP_003900336.1.78547 WP_003900336.1.78574 WP_003900336.1.78580 WP_003900336.1.7860 WP_003900336.1.78620 WP_003900336.1.78646 WP_003900336.1.78648 WP_003900336.1.78649 WP_003900336.1.78655 WP_003900336.1.78657 WP_003900336.1.78659 WP_003900336.1.7869 WP_003900336.1.78692 WP_003900336.1.78760 WP_003900336.1.78766 WP_003900336.1.78776 WP_003900336.1.78778 WP_003900336.1.78784 WP_003900336.1.78788 WP_003900336.1.78790 WP_003900336.1.78793 WP_003900336.1.78848 WP_003900336.1.78860 WP_003900336.1.7887 WP_003900336.1.78884 WP_003900336.1.78932 WP_003900336.1.78969 WP_003900336.1.78977 WP_003900336.1.78980 WP_003900336.1.79005 WP_003900336.1.79016 WP_003900336.1.79033 WP_003900336.1.79064 WP_003900336.1.79066 WP_003900336.1.79068 WP_003900336.1.79077 WP_003900336.1.79095 WP_003900336.1.79112 WP_003900336.1.79122 WP_003900336.1.79145 WP_003900336.1.79152 WP_003900336.1.79163 WP_003900336.1.79182 WP_003900336.1.79198 WP_003900336.1.79213 WP_003900336.1.79218 WP_003900336.1.79268 WP_003900336.1.79273 WP_003900336.1.79278 WP_003900336.1.79290 WP_003900336.1.79319 WP_003900336.1.79325 WP_003900336.1.79326 WP_003900336.1.7933 WP_003900336.1.79330 WP_003900336.1.79339 WP_003900336.1.79394 WP_003900336.1.79399 WP_003900336.1.79413 WP_003900336.1.79422 WP_003900336.1.79445 WP_003900336.1.79447 WP_003900336.1.79455 WP_003900336.1.79471 WP_003900336.1.79482 WP_003900336.1.79488 WP_003900336.1.79500 WP_003900336.1.79502 WP_003900336.1.79508 WP_003900336.1.79514 WP_003900336.1.79561 WP_003900336.1.79565 WP_003900336.1.79578 WP_003900336.1.79588 WP_003900336.1.79598 WP_003900336.1.79615 WP_003900336.1.79684 WP_003900336.1.79698 WP_003900336.1.797 WP_003900336.1.79744 WP_003900336.1.79784 WP_003900336.1.79802 WP_003900336.1.79806 WP_003900336.1.79819 WP_003900336.1.79826 WP_003900336.1.79828 WP_003900336.1.79851 WP_003900336.1.79853 WP_003900336.1.79863 WP_003900336.1.79881 WP_003900336.1.79885 WP_003900336.1.79898 WP_003900336.1.7990 WP_003900336.1.79900 WP_003900336.1.79913 WP_003900336.1.79918 WP_003900336.1.79947 WP_003900336.1.79948 WP_003900336.1.7995 WP_003900336.1.7997 WP_003900336.1.80004 WP_003900336.1.80015 WP_003900336.1.80022 WP_003900336.1.80030 WP_003900336.1.80054 WP_003900336.1.80084 WP_003900336.1.80099 WP_003900336.1.80129 WP_003900336.1.80177 WP_003900336.1.80234 WP_003900336.1.8026 WP_003900336.1.80275 WP_003900336.1.8029 WP_003900336.1.80299 WP_003900336.1.80300 WP_003900336.1.80304 WP_003900336.1.80326 WP_003900336.1.80351 WP_003900336.1.8037 WP_003900336.1.80370 WP_003900336.1.80387 WP_003900336.1.80399 WP_003900336.1.8044 WP_003900336.1.80451 WP_003900336.1.80458 WP_003900336.1.80461 WP_003900336.1.80490 WP_003900336.1.80503 WP_003900336.1.80507 WP_003900336.1.80552 WP_003900336.1.80576 WP_003900336.1.80588 WP_003900336.1.80599 WP_003900336.1.8060 WP_003900336.1.80624 WP_003900336.1.80636 WP_003900336.1.80669 WP_003900336.1.80673 WP_003900336.1.80711 WP_003900336.1.80714 WP_003900336.1.80743 WP_003900336.1.80784 WP_003900336.1.80815 WP_003900336.1.80853 WP_003900336.1.80918 WP_003900336.1.8093 WP_003900336.1.80967 WP_003900336.1.8097 WP_003900336.1.80988 WP_003900336.1.81007 WP_003900336.1.81013 WP_003900336.1.8105 WP_003900336.1.81059 WP_003900336.1.81063 WP_003900336.1.81066 WP_003900336.1.81075 WP_003900336.1.81091 WP_003900336.1.81119 WP_003900336.1.81125 WP_003900336.1.81136 WP_003900336.1.8114 WP_003900336.1.81189 WP_003900336.1.81192 WP_003900336.1.812 WP_003900336.1.81230 WP_003900336.1.81249 WP_003900336.1.81250 WP_003900336.1.81264 WP_003900336.1.8128 WP_003900336.1.81287 WP_003900336.1.81297 WP_003900336.1.8138 WP_003900336.1.81407 WP_003900336.1.8143 WP_003900336.1.81439 WP_003900336.1.81465 WP_003900336.1.81505 WP_003900336.1.81529 WP_003900336.1.81538 WP_003900336.1.81541 WP_003900336.1.81560 WP_003900336.1.81561 WP_003900336.1.81567 WP_003900336.1.81583 WP_003900336.1.81686 WP_003900336.1.81712 WP_003900336.1.81720 WP_003900336.1.81774 WP_003900336.1.81788 WP_003900336.1.81809 WP_003900336.1.81820 WP_003900336.1.81850 WP_003900336.1.81883 WP_003900336.1.81891 WP_003900336.1.81911 WP_003900336.1.81918 WP_003900336.1.82011 WP_003900336.1.82048 WP_003900336.1.82069 WP_003900336.1.82071 WP_003900336.1.82108 WP_003900336.1.82136 WP_003900336.1.82142 WP_003900336.1.8215 WP_003900336.1.82158 WP_003900336.1.8217 WP_003900336.1.82209 WP_003900336.1.82210 WP_003900336.1.82228 WP_003900336.1.82236 WP_003900336.1.82251 WP_003900336.1.82271 WP_003900336.1.82305 WP_003900336.1.82307 WP_003900336.1.82309 WP_003900336.1.82317 WP_003900336.1.8232 WP_003900336.1.82346 WP_003900336.1.82374 WP_003900336.1.82385 WP_003900336.1.82429 WP_003900336.1.82460 WP_003900336.1.82462 WP_003900336.1.82483 WP_003900336.1.82494 WP_003900336.1.82531 WP_003900336.1.82546 WP_003900336.1.82547 WP_003900336.1.82549 WP_003900336.1.82577 WP_003900336.1.82592 WP_003900336.1.82597 WP_003900336.1.82598 WP_003900336.1.82625 WP_003900336.1.82642 WP_003900336.1.82651 WP_003900336.1.82653 WP_003900336.1.82681 WP_003900336.1.82685 WP_003900336.1.8271 WP_003900336.1.82712 WP_003900336.1.8273 WP_003900336.1.82743 WP_003900336.1.82757 WP_003900336.1.82774 WP_003900336.1.82803 WP_003900336.1.82836 WP_003900336.1.82860 WP_003900336.1.82871 WP_003900336.1.82892 WP_003900336.1.82935 WP_003900336.1.82957 WP_003900336.1.82973 WP_003900336.1.82981 WP_003900336.1.82983 WP_003900336.1.83004 WP_003900336.1.83009 WP_003900336.1.83044 WP_003900336.1.83065 WP_003900336.1.83074 WP_003900336.1.83110 WP_003900336.1.83146 WP_003900336.1.83149 WP_003900336.1.83159 WP_003900336.1.8317 WP_003900336.1.83173 WP_003900336.1.83181 WP_003900336.1.83182 WP_003900336.1.83191 WP_003900336.1.83197 WP_003900336.1.83212 WP_003900336.1.8326 WP_003900336.1.83268 WP_003900336.1.83273 WP_003900336.1.83309 WP_003900336.1.83332 WP_003900336.1.83334 WP_003900336.1.83341 WP_003900336.1.83349 WP_003900336.1.8335 WP_003900336.1.83353 WP_003900336.1.83367 WP_003900336.1.83380 WP_003900336.1.83381 WP_003900336.1.83389 WP_003900336.1.83408 WP_003900336.1.83409 WP_003900336.1.83435 WP_003900336.1.83470 WP_003900336.1.83524 WP_003900336.1.83526 WP_003900336.1.8358 WP_003900336.1.83589 WP_003900336.1.83601 WP_003900336.1.83611 WP_003900336.1.83638 WP_003900336.1.83648 WP_003900336.1.83656 WP_003900336.1.83667 WP_003900336.1.83689 WP_003900336.1.83692 WP_003900336.1.83704 WP_003900336.1.83705 WP_003900336.1.83766 WP_003900336.1.83793 WP_003900336.1.83794 WP_003900336.1.83802 WP_003900336.1.83805 WP_003900336.1.83839 WP_003900336.1.83842 WP_003900336.1.83850 WP_003900336.1.83861 WP_003900336.1.83884 WP_003900336.1.83920 WP_003900336.1.83929 WP_003900336.1.83930 WP_003900336.1.83975 WP_003900336.1.8400 WP_003900336.1.84027 WP_003900336.1.8404 WP_003900336.1.84057 WP_003900336.1.84070 WP_003900336.1.8409 WP_003900336.1.84112 WP_003900336.1.84146 WP_003900336.1.8415 WP_003900336.1.84176 WP_003900336.1.84186 WP_003900336.1.84192 WP_003900336.1.84228 WP_003900336.1.8424 WP_003900336.1.84259 WP_003900336.1.8426 WP_003900336.1.84287 WP_003900336.1.8434 WP_003900336.1.84388 WP_003900336.1.84408 WP_003900336.1.84409 WP_003900336.1.84438 WP_003900336.1.84460 WP_003900336.1.84488 WP_003900336.1.84504 WP_003900336.1.84620 WP_003900336.1.84623 WP_003900336.1.84641 WP_003900336.1.84655 WP_003900336.1.84666 WP_003900336.1.84670 WP_003900336.1.84739 WP_003900336.1.84748 WP_003900336.1.84766 WP_003900336.1.84772 WP_003900336.1.84774 WP_003900336.1.848 WP_003900336.1.84812 WP_003900336.1.84836 WP_003900336.1.84839 WP_003900336.1.84846 WP_003900336.1.84873 WP_003900336.1.84911 WP_003900336.1.84938 WP_003900336.1.84968 WP_003900336.1.84973 WP_003900336.1.84981 WP_003900336.1.84985 WP_003900336.1.8503 WP_003900336.1.85038 WP_003900336.1.85041 WP_003900336.1.85043 WP_003900336.1.8505 WP_003900336.1.85074 WP_003900336.1.8509 WP_003900336.1.8512 WP_003900336.1.85148 WP_003900336.1.8518 WP_003900336.1.8522 WP_003900336.1.85242 WP_003900336.1.85276 WP_003900336.1.85281 WP_003900336.1.85284 WP_003900336.1.85314 WP_003900336.1.85319 WP_003900336.1.85330 WP_003900336.1.85341 WP_003900336.1.85346 WP_003900336.1.8535 WP_003900336.1.85363 WP_003900336.1.85371 WP_003900336.1.85377 WP_003900336.1.85387 WP_003900336.1.85399 WP_003900336.1.85458 WP_003900336.1.8546 WP_003900336.1.85464 WP_003900336.1.85478 WP_003900336.1.85480 WP_003900336.1.85488 WP_003900336.1.85495 WP_003900336.1.85551 WP_003900336.1.85557 WP_003900336.1.85577 WP_003900336.1.85597 WP_003900336.1.85599 WP_003900336.1.85610 WP_003900336.1.8563 WP_003900336.1.85648 WP_003900336.1.85679 WP_003900336.1.85704 WP_003900336.1.85727 WP_003900336.1.85737 WP_003900336.1.85763 WP_003900336.1.85808 WP_003900336.1.85819 WP_003900336.1.85820 WP_003900336.1.85823 WP_003900336.1.85832 WP_003900336.1.8586 WP_003900336.1.85872 WP_003900336.1.85894 WP_003900336.1.85913 WP_003900336.1.85953 WP_003900336.1.85986 WP_003900336.1.86000 WP_003900336.1.86024 WP_003900336.1.86025 WP_003900336.1.86032 WP_003900336.1.86048 WP_003900336.1.86052 WP_003900336.1.86067 WP_003900336.1.86103 WP_003900336.1.86122 WP_003900336.1.86124 WP_003900336.1.86160 WP_003900336.1.86164 WP_003900336.1.86168 WP_003900336.1.86190 WP_003900336.1.86204 WP_003900336.1.86208 WP_003900336.1.86235 WP_003900336.1.86249 WP_003900336.1.86260 WP_003900336.1.86290 WP_003900336.1.863 WP_003900336.1.86327 WP_003900336.1.86334 WP_003900336.1.86337 WP_003900336.1.86368 WP_003900336.1.86377 WP_003900336.1.86425 WP_003900336.1.86459 WP_003900336.1.8649 WP_003900336.1.86499 WP_003900336.1.86520 WP_003900336.1.86561 WP_003900336.1.86568 WP_003900336.1.86575 WP_003900336.1.86584 WP_003900336.1.86605 WP_003900336.1.86626 WP_003900336.1.86648 WP_003900336.1.8666 WP_003900336.1.86684 WP_003900336.1.86696 WP_003900336.1.86705 WP_003900336.1.86718 WP_003900336.1.86725 WP_003900336.1.86757 WP_003900336.1.86766 WP_003900336.1.86801 WP_003900336.1.86814 WP_003900336.1.86820 WP_003900336.1.86825 WP_003900336.1.86834 WP_003900336.1.8685 WP_003900336.1.86851 WP_003900336.1.86855 WP_003900336.1.86867 WP_003900336.1.86877 WP_003900336.1.86883 WP_003900336.1.8689 WP_003900336.1.86892 WP_003900336.1.86933 WP_003900336.1.86941 WP_003900336.1.86950 WP_003900336.1.86962 WP_003900336.1.86963 WP_003900336.1.86979 WP_003900336.1.8700 WP_003900336.1.87001 WP_003900336.1.87002 WP_003900336.1.87031 WP_003900336.1.87116 WP_003900336.1.87117 WP_003900336.1.8714 WP_003900336.1.87162 WP_003900336.1.87178 WP_003900336.1.87191 WP_003900336.1.87201 WP_003900336.1.87209 WP_003900336.1.87240 WP_003900336.1.87266 WP_003900336.1.87273 WP_003900336.1.87275 WP_003900336.1.8733 WP_003900336.1.87345 WP_003900336.1.87369 WP_003900336.1.8737 WP_003900336.1.87401 WP_003900336.1.87404 WP_003900336.1.87406 WP_003900336.1.87409 WP_003900336.1.87444 WP_003900336.1.87446 WP_003900336.1.87459 WP_003900336.1.87472 WP_003900336.1.87489 WP_003900336.1.87494 WP_003900336.1.87496 WP_003900336.1.87582 WP_003900336.1.87588 WP_003900336.1.87617 WP_003900336.1.87619 WP_003900336.1.87620 WP_003900336.1.87634 WP_003900336.1.87643 WP_003900336.1.8765 WP_003900336.1.87650 WP_003900336.1.87654 WP_003900336.1.87658 WP_003900336.1.87665 WP_003900336.1.87676 WP_003900336.1.87677 WP_003900336.1.87684 WP_003900336.1.87692 WP_003900336.1.87707 WP_003900336.1.87732 WP_003900336.1.87784 WP_003900336.1.87796 WP_003900336.1.87809 WP_003900336.1.87817 WP_003900336.1.87827 WP_003900336.1.87831 WP_003900336.1.87835 WP_003900336.1.87837 WP_003900336.1.87866 WP_003900336.1.8789 WP_003900336.1.87911 WP_003900336.1.87924 WP_003900336.1.87951 WP_003900336.1.87955 WP_003900336.1.87956 WP_003900336.1.87991 WP_003900336.1.88 WP_003900336.1.88002 WP_003900336.1.88037 WP_003900336.1.88039 WP_003900336.1.88072 WP_003900336.1.88077 WP_003900336.1.88121 WP_003900336.1.88180 WP_003900336.1.88191 WP_003900336.1.88205 WP_003900336.1.88217 WP_003900336.1.88219 WP_003900336.1.88245 WP_003900336.1.88253 WP_003900336.1.88294 WP_003900336.1.88315 WP_003900336.1.88316 WP_003900336.1.88320 WP_003900336.1.88338 WP_003900336.1.8840 WP_003900336.1.88437 WP_003900336.1.88453 WP_003900336.1.88469 WP_003900336.1.88489 WP_003900336.1.88521 WP_003900336.1.88530 WP_003900336.1.88537 WP_003900336.1.88541 WP_003900336.1.88592 WP_003900336.1.88616 WP_003900336.1.88618 WP_003900336.1.8862 WP_003900336.1.88625 WP_003900336.1.88632 WP_003900336.1.88634 WP_003900336.1.88649 WP_003900336.1.8870 WP_003900336.1.88737 WP_003900336.1.888 WP_003900336.1.88824 WP_003900336.1.88886 WP_003900336.1.88965 WP_003900336.1.88985 WP_003900336.1.8902 WP_003900336.1.89025 WP_003900336.1.89041 WP_003900336.1.89046 WP_003900336.1.89082 WP_003900336.1.89162 WP_003900336.1.89168 WP_003900336.1.89193 WP_003900336.1.89205 WP_003900336.1.89207 WP_003900336.1.89225 WP_003900336.1.8925 WP_003900336.1.89277 WP_003900336.1.89286 WP_003900336.1.89293 WP_003900336.1.89320 WP_003900336.1.8935 WP_003900336.1.89371 WP_003900336.1.89378 WP_003900336.1.89392 WP_003900336.1.89406 WP_003900336.1.8943 WP_003900336.1.89451 WP_003900336.1.89453 WP_003900336.1.89473 WP_003900336.1.89475 WP_003900336.1.89483 WP_003900336.1.895 WP_003900336.1.89513 WP_003900336.1.89517 WP_003900336.1.89522 WP_003900336.1.8954 WP_003900336.1.89543 WP_003900336.1.89567 WP_003900336.1.8957 WP_003900336.1.89572 WP_003900336.1.89589 WP_003900336.1.89607 WP_003900336.1.89613 WP_003900336.1.89625 WP_003900336.1.89648 WP_003900336.1.8967 WP_003900336.1.89670 WP_003900336.1.89676 WP_003900336.1.89729 WP_003900336.1.89739 WP_003900336.1.89762 WP_003900336.1.8977 WP_003900336.1.89802 WP_003900336.1.89808 WP_003900336.1.89829 WP_003900336.1.89831 WP_003900336.1.89844 WP_003900336.1.89849 WP_003900336.1.8989 WP_003900336.1.89903 WP_003900336.1.89909 WP_003900336.1.8992 WP_003900336.1.89922 WP_003900336.1.89926 WP_003900336.1.89963 WP_003900336.1.89971 WP_003900336.1.8998 WP_003900336.1.89987 WP_003900336.1.900 WP_003900336.1.90048 WP_003900336.1.9007 WP_003900336.1.90080 WP_003900336.1.90130 WP_003900336.1.90134 WP_003900336.1.90137 WP_003900336.1.90157 WP_003900336.1.90184 WP_003900336.1.90199 WP_003900336.1.90231 WP_003900336.1.90245 WP_003900336.1.90308 WP_003900336.1.90322 WP_003900336.1.90328 WP_003900336.1.90372 WP_003900336.1.90439 WP_003900336.1.90481 WP_003900336.1.90499 WP_003900336.1.9050 WP_003900336.1.90527 WP_003900336.1.90550 WP_003900336.1.90560 WP_003900336.1.90612 WP_003900336.1.90640 WP_003900336.1.90672 WP_003900336.1.90691 WP_003900336.1.90711 WP_003900336.1.90722 WP_003900336.1.9075 WP_003900336.1.90756 WP_003900336.1.90767 WP_003900336.1.90771 WP_003900336.1.90785 WP_003900336.1.90788 WP_003900336.1.90800 WP_003900336.1.90810 WP_003900336.1.90816 WP_003900336.1.90819 WP_003900336.1.9082 WP_003900336.1.90831 WP_003900336.1.90884 WP_003900336.1.90899 WP_003900336.1.90906 WP_003900336.1.90958 WP_003900336.1.90976 WP_003900336.1.90977 WP_003900336.1.90987 WP_003900336.1.9102 WP_003900336.1.91026 WP_003900336.1.91032 WP_003900336.1.91043 WP_003900336.1.91053 WP_003900336.1.91082 WP_003900336.1.91106 WP_003900336.1.91112 WP_003900336.1.91144 WP_003900336.1.91151 WP_003900336.1.91157 WP_003900336.1.91167 WP_003900336.1.91169 WP_003900336.1.91192 WP_003900336.1.91201 WP_003900336.1.91207 WP_003900336.1.91208 WP_003900336.1.91211 WP_003900336.1.91214 WP_003900336.1.91230 WP_003900336.1.91244 WP_003900336.1.91251 WP_003900336.1.91260 WP_003900336.1.91265 WP_003900336.1.9128 WP_003900336.1.91284 WP_003900336.1.91294 WP_003900336.1.91303 WP_003900336.1.91322 WP_003900336.1.91352 WP_003900336.1.91386 WP_003900336.1.9139 WP_003900336.1.91398 WP_003900336.1.91411 WP_003900336.1.91430 WP_003900336.1.91436 WP_003900336.1.91483 WP_003900336.1.91496 WP_003900336.1.91507 WP_003900336.1.91508 WP_003900336.1.91576 WP_003900336.1.91589 WP_003900336.1.91694 WP_003900336.1.91695 WP_003900336.1.91716 WP_003900336.1.91717 WP_003900336.1.91728 WP_003900336.1.91743 WP_003900336.1.91759 WP_003900336.1.91784 WP_003900336.1.91785 WP_003900336.1.91786 WP_003900336.1.91802 WP_003900336.1.91822 WP_003900336.1.91828 WP_003900336.1.9189 WP_003900336.1.91896 WP_003900336.1.9190 WP_003900336.1.91915 WP_003900336.1.91931 WP_003900336.1.91937 WP_003900336.1.91944 WP_003900336.1.91953 WP_003900336.1.91957 WP_003900336.1.91976 WP_003900336.1.91978 WP_003900336.1.92021 WP_003900336.1.92083 WP_003900336.1.92127 WP_003900336.1.92144 WP_003900336.1.92150 WP_003900336.1.92153 WP_003900336.1.92190 WP_003900336.1.92192 WP_003900336.1.92200 WP_003900336.1.92220 WP_003900336.1.92221 WP_003900336.1.92222 WP_003900336.1.92289 WP_003900336.1.9229 WP_003900336.1.92294 WP_003900336.1.92300 WP_003900336.1.92317 WP_003900336.1.92334 WP_003900336.1.92338 WP_003900336.1.92345 WP_003900336.1.92364 WP_003900336.1.92380 WP_003900336.1.92416 WP_003900336.1.92428 WP_003900336.1.92447 WP_003900336.1.92456 WP_003900336.1.92467 WP_003900336.1.92471 WP_003900336.1.92490 WP_003900336.1.92508 WP_003900336.1.9251 WP_003900336.1.92511 WP_003900336.1.92523 WP_003900336.1.92527 WP_003900336.1.92536 WP_003900336.1.92592 WP_003900336.1.92597 WP_003900336.1.92603 WP_003900336.1.92606 WP_003900336.1.92610 WP_003900336.1.92613 WP_003900336.1.9263 WP_003900336.1.9265 WP_003900336.1.92650 WP_003900336.1.92660 WP_003900336.1.92677 WP_003900336.1.92685 WP_003900336.1.92689 WP_003900336.1.92690 WP_003900336.1.92706 WP_003900336.1.92714 WP_003900336.1.92736 WP_003900336.1.9274 WP_003900336.1.92752 WP_003900336.1.92760 WP_003900336.1.92777 WP_003900336.1.92803 WP_003900336.1.92833 WP_003900336.1.92856 WP_003900336.1.92881 WP_003900336.1.92892 WP_003900336.1.92907 WP_003900336.1.92908 WP_003900336.1.9291 WP_003900336.1.92917 WP_003900336.1.92996 WP_003900336.1.93006 WP_003900336.1.93008 WP_003900336.1.93009 WP_003900336.1.93015 WP_003900336.1.93043 WP_003900336.1.9307 WP_003900336.1.93083 WP_003900336.1.93097 WP_003900336.1.93137 WP_003900336.1.93192 WP_003900336.1.93203 WP_003900336.1.93212 WP_003900336.1.93234 WP_003900336.1.93245 WP_003900336.1.93257 WP_003900336.1.93265 WP_003900336.1.93297 WP_003900336.1.93320 WP_003900336.1.93328 WP_003900336.1.93337 WP_003900336.1.93343 WP_003900336.1.93349 WP_003900336.1.93363 WP_003900336.1.93377 WP_003900336.1.9338 WP_003900336.1.93407 WP_003900336.1.93417 WP_003900336.1.93419 WP_003900336.1.93426 WP_003900336.1.9344 WP_003900336.1.93443 WP_003900336.1.93447 WP_003900336.1.93470 WP_003900336.1.93483 WP_003900336.1.93487 WP_003900336.1.93495 WP_003900336.1.93499 WP_003900336.1.93516 WP_003900336.1.93536 WP_003900336.1.93544 WP_003900336.1.93555 WP_003900336.1.93560 WP_003900336.1.93564 WP_003900336.1.9357 WP_003900336.1.93573 WP_003900336.1.93576 WP_003900336.1.93588 WP_003900336.1.9363 WP_003900336.1.93645 WP_003900336.1.93649 WP_003900336.1.93659 WP_003900336.1.93677 WP_003900336.1.9368 WP_003900336.1.93689 WP_003900336.1.93693 WP_003900336.1.93698 WP_003900336.1.93706 WP_003900336.1.9371 WP_003900336.1.93792 WP_003900336.1.93823 WP_003900336.1.93871 WP_003900336.1.9388 WP_003900336.1.93894 WP_003900336.1.93903 WP_003900336.1.93907 WP_003900336.1.93913 WP_003900336.1.93946 WP_003900336.1.93950 WP_003900336.1.93953 WP_003900336.1.93954 WP_003900336.1.93988 WP_003900336.1.9407 WP_003900336.1.94143 WP_003900336.1.94154 WP_003900336.1.94184 WP_003900336.1.94204 WP_003900336.1.94205 WP_003900336.1.94226 WP_003900336.1.94231 WP_003900336.1.94256 WP_003900336.1.94261 WP_003900336.1.94281 WP_003900336.1.94292 WP_003900336.1.94297 WP_003900336.1.9431 WP_003900336.1.94326 WP_003900336.1.94339 WP_003900336.1.94392 WP_003900336.1.94416 WP_003900336.1.94421 WP_003900336.1.94456 WP_003900336.1.94470 WP_003900336.1.94480 WP_003900336.1.94495 WP_003900336.1.94511 WP_003900336.1.94512 WP_003900336.1.94525 WP_003900336.1.94528 WP_003900336.1.94564 WP_003900336.1.946 WP_003900336.1.94602 WP_003900336.1.94623 WP_003900336.1.94629 WP_003900336.1.9465 WP_003900336.1.94673 WP_003900336.1.94714 WP_003900336.1.94730 WP_003900336.1.94736 WP_003900336.1.94776 WP_003900336.1.9478 WP_003900336.1.94834 WP_003900336.1.94852 WP_003900336.1.94872 WP_003900336.1.9488 WP_003900336.1.94902 WP_003900336.1.94916 WP_003900336.1.94979 WP_003900336.1.94994 WP_003900336.1.94996 WP_003900336.1.94998 WP_003900336.1.95007 WP_003900336.1.95015 WP_003900336.1.95034 WP_003900336.1.95068 WP_003900336.1.95081 WP_003900336.1.95082 WP_003900336.1.9509 WP_003900336.1.95096 WP_003900336.1.95112 WP_003900336.1.95138 WP_003900336.1.9514 WP_003900336.1.95179 WP_003900336.1.95188 WP_003900336.1.95190 WP_003900336.1.95234 WP_003900336.1.95241 WP_003900336.1.95245 WP_003900336.1.95257 WP_003900336.1.9531 WP_003900336.1.95335 WP_003900336.1.95344 WP_003900336.1.9535 WP_003900336.1.95370 WP_003900336.1.95392 WP_003900336.1.95416 WP_003900336.1.95417 WP_003900336.1.95454 WP_003900336.1.95455 WP_003900336.1.95491 WP_003900336.1.95497 WP_003900336.1.95508 WP_003900336.1.95509 WP_003900336.1.95529 WP_003900336.1.95556 WP_003900336.1.95557 WP_003900336.1.95565 WP_003900336.1.95578 WP_003900336.1.95580 WP_003900336.1.95585 WP_003900336.1.95679 WP_003900336.1.95685 WP_003900336.1.957 WP_003900336.1.95724 WP_003900336.1.95727 WP_003900336.1.95730 WP_003900336.1.95735 WP_003900336.1.95758 WP_003900336.1.95772 WP_003900336.1.95797 WP_003900336.1.95839 WP_003900336.1.9585 WP_003900336.1.9590 WP_003900336.1.95902 WP_003900336.1.95908 WP_003900336.1.95924 WP_003900336.1.95926 WP_003900336.1.95953 WP_003900336.1.95958 WP_003900336.1.95964 WP_003900336.1.95973 WP_003900336.1.96006 WP_003900336.1.9602 WP_003900336.1.96036 WP_003900336.1.96062 WP_003900336.1.96065 WP_003900336.1.96098 WP_003900336.1.96146 WP_003900336.1.96166 WP_003900336.1.96171 WP_003900336.1.96182 WP_003900336.1.96204 WP_003900336.1.96230 WP_003900336.1.96235 WP_003900336.1.96242 WP_003900336.1.96245 WP_003900336.1.96254 WP_003900336.1.96259 WP_003900336.1.96286 WP_003900336.1.96313 WP_003900336.1.96318 WP_003900336.1.96345 WP_003900336.1.96360 WP_003900336.1.96373 WP_003900336.1.96456 WP_003900336.1.96486 WP_003900336.1.96569 WP_003900336.1.96573 WP_003900336.1.96575 WP_003900336.1.96576 WP_003900336.1.96611 WP_003900336.1.96621 WP_003900336.1.9667 WP_003900336.1.96681 WP_003900336.1.96726 WP_003900336.1.96733 WP_003900336.1.96742 WP_003900336.1.96754 WP_003900336.1.9678 WP_003900336.1.96832 WP_003900336.1.9685 WP_003900336.1.97008 WP_003900336.1.97009 WP_003900336.1.97056 WP_003900336.1.97084 WP_003900336.1.97087 WP_003900336.1.97094 WP_003900336.1.97096 WP_003900336.1.97099 WP_003900336.1.97108 WP_003900336.1.97113 WP_003900336.1.97122 WP_003900336.1.97127 WP_003900336.1.97129 WP_003900336.1.97136 WP_003900336.1.9716 WP_003900336.1.97176 WP_003900336.1.97222 WP_003900336.1.97223 WP_003900336.1.97237 WP_003900336.1.97242 WP_003900336.1.97270 WP_003900336.1.97283 WP_003900336.1.97296 WP_003900336.1.97321 WP_003900336.1.97325 WP_003900336.1.97330 WP_003900336.1.97366 WP_003900336.1.97376 WP_003900336.1.97380 WP_003900336.1.9739 WP_003900336.1.97462 WP_003900336.1.97517 WP_003900336.1.97519 WP_003900336.1.97535 WP_003900336.1.97540 WP_003900336.1.97545 WP_003900336.1.97546 WP_003900336.1.97550 WP_003900336.1.97568 WP_003900336.1.97577 WP_003900336.1.97584 WP_003900336.1.9759 WP_003900336.1.97591 WP_003900336.1.97596 WP_003900336.1.97609 WP_003900336.1.97618 WP_003900336.1.9763 WP_003900336.1.97669 WP_003900336.1.97673 WP_003900336.1.97700 WP_003900336.1.97701 WP_003900336.1.9773 WP_003900336.1.97740 WP_003900336.1.97751 WP_003900336.1.97754 WP_003900336.1.97797 WP_003900336.1.9782 WP_003900336.1.9784 WP_003900336.1.97888 WP_003900336.1.9790 WP_003900336.1.9795 WP_003900336.1.97951 WP_003900336.1.97958 WP_003900336.1.97966 WP_003900336.1.97977 WP_003900336.1.97979 WP_003900336.1.97995 WP_003900336.1.98018 WP_003900336.1.98034 WP_003900336.1.98071 WP_003900336.1.98072 WP_003900336.1.98113 WP_003900336.1.98114 WP_003900336.1.98128 WP_003900336.1.98181 WP_003900336.1.98188 WP_003900336.1.98189 WP_003900336.1.98213 WP_003900336.1.98225 WP_003900336.1.98291 WP_003900336.1.98335 WP_003900336.1.98350 WP_003900336.1.98395 WP_003900336.1.98412 WP_003900336.1.98441 WP_003900336.1.98443 WP_003900336.1.98462 WP_003900336.1.9848 WP_003900336.1.98482 WP_003900336.1.98486 WP_003900336.1.98488 WP_003900336.1.98503 WP_003900336.1.98516 WP_003900336.1.98524 WP_003900336.1.98536 WP_003900336.1.98541 WP_003900336.1.98566 WP_003900336.1.98576 WP_003900336.1.98590 WP_003900336.1.98594 WP_003900336.1.98599 WP_003900336.1.98645 WP_003900336.1.98646 WP_003900336.1.98649 WP_003900336.1.98656 WP_003900336.1.9867 WP_003900336.1.98674 WP_003900336.1.98697 WP_003900336.1.98701 WP_003900336.1.98739 WP_003900336.1.98749 WP_003900336.1.98765 WP_003900336.1.98770 WP_003900336.1.98777 WP_003900336.1.98778 WP_003900336.1.98802 WP_003900336.1.98838 WP_003900336.1.98850 WP_003900336.1.98906 WP_003900336.1.98935 WP_003900336.1.98948 WP_003900336.1.98953 WP_003900336.1.98984 WP_003900336.1.99000 WP_003900336.1.99023 WP_003900336.1.99030 WP_003900336.1.99037 WP_003900336.1.99055 WP_003900336.1.99062 WP_003900336.1.99086 WP_003900336.1.99115 WP_003900336.1.99117 WP_003900336.1.99161 WP_003900336.1.99176 WP_003900336.1.99205 WP_003900336.1.99211 WP_003900336.1.99216 WP_003900336.1.99222 WP_003900336.1.99251 WP_003900336.1.99269 WP_003900336.1.99294 WP_003900336.1.99312 WP_003900336.1.99315 WP_003900336.1.99316 WP_003900336.1.99322 WP_003900336.1.99328 WP_003900336.1.99365 WP_003900336.1.99368 WP_003900336.1.99379 WP_003900336.1.99396 WP_003900336.1.99402 WP_003900336.1.99404 WP_003900336.1.99419 WP_003900336.1.99438 WP_003900336.1.99460 WP_003900336.1.99468 WP_003900336.1.99473 WP_003900336.1.99513 WP_003900336.1.99529 WP_003900336.1.99548 WP_003900336.1.99572 WP_003900336.1.99575 WP_003900336.1.99578 WP_003900336.1.99605 WP_003900336.1.99609 WP_003900336.1.99617 WP_003900336.1.99635 WP_003900336.1.99650 WP_003900336.1.99672 WP_003900336.1.99701 WP_003900336.1.99711 WP_003900336.1.99716 WP_003900336.1.99740 WP_003900336.1.99745 WP_003900336.1.99749 WP_003900336.1.9976 WP_003900336.1.99798 WP_003900336.1.99817 WP_003900336.1.99832 WP_003900336.1.99847 WP_003900336.1.99852 WP_003900336.1.99886 WP_003900336.1.99897 WP_003900336.1.99899 WP_003900336.1.99915 WP_003900336.1.9993 WP_003900336.1.99982 WP_003900336.1.99991 gi|479055369|ref|YP_007351175.1| gi|378771170|ref|YP_005170903.1| gi|197740106|ref|YP_002161420.1| gi|339631473|ref|YP_004723115.1| gi|385998190|ref|YP_005916488.1| gi|31792600|ref|NP_855093.1| gi|433630517|ref|YP_007264145.1| 233413.Mb1441 336982.TBFG_11435 410289.BCG_1467 419947.MRA_1415 478434.TBMG_02574 561275.JTY_1442 83331.MT1450 83332.Rv1406 gi|121637336|ref|YP_977559.1| gi|386004392|ref|YP_005922671.1| gi|15840864|ref|NP_335901.1| gi|506925883|ref|YP_008006333.1| gi|525674133|ref|YP_008225514.1| gi|471337326|ref|YP_007610039.1| gi|383307275|ref|YP_005360086.1| gi|375296787|ref|YP_005101054.1| gi|392386094|ref|YP_005307723.1| gi|340626420|ref|YP_004744872.1| gi|224989811|ref|YP_002644498.1| gi|253799544|ref|YP_003032545.1| gi|479314315|ref|YP_007854367.1| gi|392432997|ref|YP_006474041.1| gi|449063484|ref|YP_007430567.1| gi|433634468|ref|YP_007268095.1| gi|148661197|ref|YP_001282720.1| gi|433641557|ref|YP_007287316.1| gi|385990828|ref|YP_005909126.1| gi|15608544|ref|NP_215922.1| gi|148822626|ref|YP_001287380.1| gi|506925883|ref|YP_008006333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]