SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339631963|ref|YP_004723605.1| from Mycobacterium africanum GM041182

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339631963|ref|YP_004723605.1|
Domain Number 1 Region: 55-195
Classification Level Classification E-value
Superfamily PEBP-like 1.57e-30
Family Prokaryotic PEBP-like proteins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339631963|ref|YP_004723605.1|
Sequence length 197
Comment hypothetical protein MAF_19330 [Mycobacterium africanum GM041182]
Sequence
MAHAFHRFALAILGLALPVALVAYGGNGDSRKAAPLAPKAAALGRSMPETPTGDVLTISS
PAFADGAPIPEQYTCKGANIAPPLTWSAPFGGALVVDDPDAPREPYVHWIVIGIAPGAGS
TADGETPGGGISLPNSSGQPAYTGPCPPAGTGTHHYRFTLYHLPAVPPLAGLAGTQAARV
IAQAATMQARLIGTYEG
Download sequence
Identical sequences A0A0H3M5X3 A0A1A9E7M0 A0A2C5SNF4 A5U3S9 F8MA53 M8CEV3 R4MEG6
gi|31793103|ref|NP_855596.1| gi|385998686|ref|YP_005916984.1| gi|148661718|ref|YP_001283241.1| gi|224990300|ref|YP_002644987.1| gi|386004860|ref|YP_005923139.1| gi|494700326|ref|YP_007965808.1| NP_216426.1.84033 WP_003409566.1.100000 WP_003409566.1.100021 WP_003409566.1.100069 WP_003409566.1.100087 WP_003409566.1.10015 WP_003409566.1.100208 WP_003409566.1.100216 WP_003409566.1.10022 WP_003409566.1.100255 WP_003409566.1.100260 WP_003409566.1.100270 WP_003409566.1.100279 WP_003409566.1.100286 WP_003409566.1.100308 WP_003409566.1.100309 WP_003409566.1.100318 WP_003409566.1.100337 WP_003409566.1.100338 WP_003409566.1.10037 WP_003409566.1.100383 WP_003409566.1.100395 WP_003409566.1.100396 WP_003409566.1.1004 WP_003409566.1.100401 WP_003409566.1.100459 WP_003409566.1.100460 WP_003409566.1.100552 WP_003409566.1.100581 WP_003409566.1.100600 WP_003409566.1.100625 WP_003409566.1.10064 WP_003409566.1.100666 WP_003409566.1.100671 WP_003409566.1.100677 WP_003409566.1.100682 WP_003409566.1.100697 WP_003409566.1.100716 WP_003409566.1.100754 WP_003409566.1.100757 WP_003409566.1.100772 WP_003409566.1.1008 WP_003409566.1.100812 WP_003409566.1.100845 WP_003409566.1.100866 WP_003409566.1.10088 WP_003409566.1.100889 WP_003409566.1.10090 WP_003409566.1.100910 WP_003409566.1.100915 WP_003409566.1.100918 WP_003409566.1.100935 WP_003409566.1.100984 WP_003409566.1.100992 WP_003409566.1.100998 WP_003409566.1.101 WP_003409566.1.101025 WP_003409566.1.101028 WP_003409566.1.10104 WP_003409566.1.101048 WP_003409566.1.101054 WP_003409566.1.101075 WP_003409566.1.101143 WP_003409566.1.101146 WP_003409566.1.10116 WP_003409566.1.10117 WP_003409566.1.101209 WP_003409566.1.10125 WP_003409566.1.101290 WP_003409566.1.101323 WP_003409566.1.101324 WP_003409566.1.101350 WP_003409566.1.101367 WP_003409566.1.101398 WP_003409566.1.101403 WP_003409566.1.101421 WP_003409566.1.10144 WP_003409566.1.101442 WP_003409566.1.10145 WP_003409566.1.101456 WP_003409566.1.101481 WP_003409566.1.101493 WP_003409566.1.101496 WP_003409566.1.101525 WP_003409566.1.101533 WP_003409566.1.101535 WP_003409566.1.101553 WP_003409566.1.101558 WP_003409566.1.10156 WP_003409566.1.101576 WP_003409566.1.10159 WP_003409566.1.101592 WP_003409566.1.101604 WP_003409566.1.101607 WP_003409566.1.101622 WP_003409566.1.101644 WP_003409566.1.101659 WP_003409566.1.101671 WP_003409566.1.101687 WP_003409566.1.101698 WP_003409566.1.10170 WP_003409566.1.101713 WP_003409566.1.101743 WP_003409566.1.101764 WP_003409566.1.101773 WP_003409566.1.101795 WP_003409566.1.101797 WP_003409566.1.101798 WP_003409566.1.101802 WP_003409566.1.101826 WP_003409566.1.101836 WP_003409566.1.101858 WP_003409566.1.101859 WP_003409566.1.101862 WP_003409566.1.101888 WP_003409566.1.101894 WP_003409566.1.101899 WP_003409566.1.1019 WP_003409566.1.101923 WP_003409566.1.101925 WP_003409566.1.10193 WP_003409566.1.101996 WP_003409566.1.102 WP_003409566.1.102008 WP_003409566.1.102017 WP_003409566.1.102053 WP_003409566.1.102055 WP_003409566.1.102063 WP_003409566.1.102099 WP_003409566.1.1021 WP_003409566.1.10211 WP_003409566.1.102119 WP_003409566.1.102121 WP_003409566.1.102143 WP_003409566.1.10216 WP_003409566.1.10224 WP_003409566.1.10253 WP_003409566.1.10262 WP_003409566.1.10272 WP_003409566.1.10277 WP_003409566.1.1033 WP_003409566.1.10350 WP_003409566.1.10362 WP_003409566.1.10366 WP_003409566.1.10376 WP_003409566.1.10396 WP_003409566.1.10410 WP_003409566.1.10414 WP_003409566.1.10421 WP_003409566.1.10430 WP_003409566.1.1044 WP_003409566.1.10440 WP_003409566.1.10471 WP_003409566.1.10472 WP_003409566.1.10489 WP_003409566.1.105 WP_003409566.1.10518 WP_003409566.1.10523 WP_003409566.1.10545 WP_003409566.1.1057 WP_003409566.1.10594 WP_003409566.1.10603 WP_003409566.1.10606 WP_003409566.1.10615 WP_003409566.1.10623 WP_003409566.1.10635 WP_003409566.1.10643 WP_003409566.1.10648 WP_003409566.1.10662 WP_003409566.1.10709 WP_003409566.1.10735 WP_003409566.1.10740 WP_003409566.1.10756 WP_003409566.1.1078 WP_003409566.1.10791 WP_003409566.1.10799 WP_003409566.1.10825 WP_003409566.1.10848 WP_003409566.1.10863 WP_003409566.1.10879 WP_003409566.1.10912 WP_003409566.1.10916 WP_003409566.1.10923 WP_003409566.1.10927 WP_003409566.1.1095 WP_003409566.1.10956 WP_003409566.1.10958 WP_003409566.1.10962 WP_003409566.1.10980 WP_003409566.1.10981 WP_003409566.1.10993 WP_003409566.1.1100 WP_003409566.1.11040 WP_003409566.1.11061 WP_003409566.1.11070 WP_003409566.1.11141 WP_003409566.1.11171 WP_003409566.1.11175 WP_003409566.1.11176 WP_003409566.1.11222 WP_003409566.1.11236 WP_003409566.1.11329 WP_003409566.1.1133 WP_003409566.1.11342 WP_003409566.1.11373 WP_003409566.1.11390 WP_003409566.1.11402 WP_003409566.1.11481 WP_003409566.1.11487 WP_003409566.1.11489 WP_003409566.1.11491 WP_003409566.1.11514 WP_003409566.1.11587 WP_003409566.1.11589 WP_003409566.1.11596 WP_003409566.1.11604 WP_003409566.1.11610 WP_003409566.1.11697 WP_003409566.1.11707 WP_003409566.1.11752 WP_003409566.1.11758 WP_003409566.1.11761 WP_003409566.1.11775 WP_003409566.1.11822 WP_003409566.1.11826 WP_003409566.1.11856 WP_003409566.1.11898 WP_003409566.1.11906 WP_003409566.1.11939 WP_003409566.1.11960 WP_003409566.1.11961 WP_003409566.1.11972 WP_003409566.1.11984 WP_003409566.1.120 WP_003409566.1.12001 WP_003409566.1.12049 WP_003409566.1.12052 WP_003409566.1.12100 WP_003409566.1.12116 WP_003409566.1.12130 WP_003409566.1.12133 WP_003409566.1.12161 WP_003409566.1.12165 WP_003409566.1.12184 WP_003409566.1.12187 WP_003409566.1.12190 WP_003409566.1.12216 WP_003409566.1.12265 WP_003409566.1.12275 WP_003409566.1.12293 WP_003409566.1.12294 WP_003409566.1.123 WP_003409566.1.1231 WP_003409566.1.12314 WP_003409566.1.12327 WP_003409566.1.12338 WP_003409566.1.1236 WP_003409566.1.12371 WP_003409566.1.12372 WP_003409566.1.12389 WP_003409566.1.12406 WP_003409566.1.1241 WP_003409566.1.12421 WP_003409566.1.12424 WP_003409566.1.12446 WP_003409566.1.12464 WP_003409566.1.12479 WP_003409566.1.12519 WP_003409566.1.12523 WP_003409566.1.12526 WP_003409566.1.1255 WP_003409566.1.12550 WP_003409566.1.12551 WP_003409566.1.12563 WP_003409566.1.12611 WP_003409566.1.12669 WP_003409566.1.1267 WP_003409566.1.12672 WP_003409566.1.12692 WP_003409566.1.1271 WP_003409566.1.12710 WP_003409566.1.12768 WP_003409566.1.1279 WP_003409566.1.12794 WP_003409566.1.12801 WP_003409566.1.12804 WP_003409566.1.12841 WP_003409566.1.12854 WP_003409566.1.12871 WP_003409566.1.12901 WP_003409566.1.12941 WP_003409566.1.12947 WP_003409566.1.12957 WP_003409566.1.12972 WP_003409566.1.13028 WP_003409566.1.13043 WP_003409566.1.13086 WP_003409566.1.13087 WP_003409566.1.13090 WP_003409566.1.13096 WP_003409566.1.13163 WP_003409566.1.13175 WP_003409566.1.13183 WP_003409566.1.132 WP_003409566.1.13249 WP_003409566.1.13282 WP_003409566.1.13284 WP_003409566.1.13296 WP_003409566.1.13298 WP_003409566.1.13302 WP_003409566.1.13306 WP_003409566.1.13312 WP_003409566.1.13313 WP_003409566.1.13321 WP_003409566.1.13345 WP_003409566.1.13370 WP_003409566.1.13375 WP_003409566.1.1338 WP_003409566.1.13420 WP_003409566.1.13433 WP_003409566.1.13435 WP_003409566.1.13438 WP_003409566.1.13466 WP_003409566.1.13489 WP_003409566.1.13526 WP_003409566.1.13551 WP_003409566.1.13561 WP_003409566.1.13564 WP_003409566.1.13579 WP_003409566.1.13647 WP_003409566.1.13697 WP_003409566.1.13719 WP_003409566.1.13763 WP_003409566.1.1377 WP_003409566.1.13774 WP_003409566.1.13786 WP_003409566.1.13793 WP_003409566.1.13794 WP_003409566.1.13817 WP_003409566.1.13834 WP_003409566.1.13866 WP_003409566.1.13880 WP_003409566.1.13899 WP_003409566.1.13909 WP_003409566.1.13910 WP_003409566.1.13919 WP_003409566.1.13920 WP_003409566.1.13952 WP_003409566.1.13953 WP_003409566.1.13962 WP_003409566.1.1398 WP_003409566.1.13988 WP_003409566.1.14027 WP_003409566.1.14046 WP_003409566.1.14115 WP_003409566.1.1415 WP_003409566.1.14152 WP_003409566.1.14158 WP_003409566.1.14162 WP_003409566.1.14175 WP_003409566.1.14178 WP_003409566.1.14194 WP_003409566.1.14195 WP_003409566.1.14208 WP_003409566.1.14238 WP_003409566.1.14266 WP_003409566.1.14273 WP_003409566.1.14303 WP_003409566.1.14306 WP_003409566.1.14307 WP_003409566.1.14310 WP_003409566.1.14341 WP_003409566.1.14382 WP_003409566.1.14416 WP_003409566.1.14428 WP_003409566.1.14441 WP_003409566.1.14469 WP_003409566.1.14477 WP_003409566.1.14504 WP_003409566.1.14514 WP_003409566.1.1452 WP_003409566.1.14527 WP_003409566.1.1454 WP_003409566.1.14544 WP_003409566.1.14548 WP_003409566.1.14551 WP_003409566.1.14561 WP_003409566.1.14573 WP_003409566.1.1462 WP_003409566.1.14658 WP_003409566.1.14667 WP_003409566.1.14668 WP_003409566.1.14675 WP_003409566.1.14694 WP_003409566.1.14695 WP_003409566.1.14709 WP_003409566.1.14766 WP_003409566.1.14783 WP_003409566.1.14865 WP_003409566.1.14872 WP_003409566.1.14905 WP_003409566.1.14926 WP_003409566.1.14951 WP_003409566.1.14955 WP_003409566.1.15003 WP_003409566.1.15009 WP_003409566.1.15028 WP_003409566.1.15040 WP_003409566.1.15052 WP_003409566.1.15065 WP_003409566.1.15072 WP_003409566.1.15089 WP_003409566.1.1509 WP_003409566.1.15126 WP_003409566.1.15131 WP_003409566.1.15168 WP_003409566.1.15172 WP_003409566.1.15187 WP_003409566.1.15196 WP_003409566.1.15210 WP_003409566.1.15216 WP_003409566.1.15217 WP_003409566.1.1523 WP_003409566.1.15232 WP_003409566.1.15238 WP_003409566.1.15240 WP_003409566.1.15253 WP_003409566.1.15267 WP_003409566.1.1527 WP_003409566.1.15292 WP_003409566.1.15299 WP_003409566.1.15302 WP_003409566.1.15322 WP_003409566.1.1534 WP_003409566.1.15345 WP_003409566.1.15365 WP_003409566.1.15372 WP_003409566.1.15386 WP_003409566.1.15387 WP_003409566.1.15442 WP_003409566.1.15447 WP_003409566.1.15449 WP_003409566.1.15477 WP_003409566.1.15492 WP_003409566.1.15511 WP_003409566.1.15512 WP_003409566.1.15558 WP_003409566.1.15559 WP_003409566.1.15566 WP_003409566.1.15599 WP_003409566.1.1560 WP_003409566.1.15611 WP_003409566.1.1563 WP_003409566.1.15633 WP_003409566.1.15643 WP_003409566.1.15688 WP_003409566.1.15755 WP_003409566.1.15763 WP_003409566.1.15774 WP_003409566.1.1578 WP_003409566.1.15780 WP_003409566.1.15827 WP_003409566.1.15834 WP_003409566.1.15842 WP_003409566.1.15848 WP_003409566.1.15853 WP_003409566.1.15870 WP_003409566.1.15877 WP_003409566.1.15893 WP_003409566.1.15896 WP_003409566.1.15926 WP_003409566.1.15933 WP_003409566.1.15946 WP_003409566.1.15958 WP_003409566.1.15973 WP_003409566.1.15987 WP_003409566.1.15993 WP_003409566.1.16009 WP_003409566.1.16025 WP_003409566.1.16043 WP_003409566.1.16055 WP_003409566.1.16066 WP_003409566.1.16069 WP_003409566.1.16077 WP_003409566.1.16106 WP_003409566.1.16108 WP_003409566.1.16110 WP_003409566.1.16130 WP_003409566.1.16136 WP_003409566.1.16139 WP_003409566.1.16141 WP_003409566.1.16143 WP_003409566.1.1630 WP_003409566.1.16318 WP_003409566.1.1632 WP_003409566.1.16327 WP_003409566.1.16334 WP_003409566.1.16341 WP_003409566.1.16345 WP_003409566.1.16374 WP_003409566.1.16384 WP_003409566.1.16386 WP_003409566.1.164 WP_003409566.1.1642 WP_003409566.1.16421 WP_003409566.1.16426 WP_003409566.1.16431 WP_003409566.1.1644 WP_003409566.1.16442 WP_003409566.1.16448 WP_003409566.1.16451 WP_003409566.1.16476 WP_003409566.1.16480 WP_003409566.1.16494 WP_003409566.1.1652 WP_003409566.1.16549 WP_003409566.1.16560 WP_003409566.1.16598 WP_003409566.1.16609 WP_003409566.1.16619 WP_003409566.1.16620 WP_003409566.1.16622 WP_003409566.1.16637 WP_003409566.1.1669 WP_003409566.1.16707 WP_003409566.1.16724 WP_003409566.1.16731 WP_003409566.1.16743 WP_003409566.1.1683 WP_003409566.1.16837 WP_003409566.1.16852 WP_003409566.1.16937 WP_003409566.1.16940 WP_003409566.1.16950 WP_003409566.1.16959 WP_003409566.1.16968 WP_003409566.1.1697 WP_003409566.1.16973 WP_003409566.1.16977 WP_003409566.1.16987 WP_003409566.1.17005 WP_003409566.1.17006 WP_003409566.1.17010 WP_003409566.1.17015 WP_003409566.1.17019 WP_003409566.1.17039 WP_003409566.1.17041 WP_003409566.1.17052 WP_003409566.1.17057 WP_003409566.1.17062 WP_003409566.1.1707 WP_003409566.1.17094 WP_003409566.1.17130 WP_003409566.1.17138 WP_003409566.1.17147 WP_003409566.1.17167 WP_003409566.1.17224 WP_003409566.1.17251 WP_003409566.1.17288 WP_003409566.1.17304 WP_003409566.1.17314 WP_003409566.1.17345 WP_003409566.1.17381 WP_003409566.1.17391 WP_003409566.1.17412 WP_003409566.1.1743 WP_003409566.1.17440 WP_003409566.1.17466 WP_003409566.1.17477 WP_003409566.1.17483 WP_003409566.1.17505 WP_003409566.1.17527 WP_003409566.1.17535 WP_003409566.1.17540 WP_003409566.1.17553 WP_003409566.1.17558 WP_003409566.1.17599 WP_003409566.1.17635 WP_003409566.1.17655 WP_003409566.1.17679 WP_003409566.1.1768 WP_003409566.1.17687 WP_003409566.1.17700 WP_003409566.1.17710 WP_003409566.1.17713 WP_003409566.1.17722 WP_003409566.1.17746 WP_003409566.1.17788 WP_003409566.1.17798 WP_003409566.1.17803 WP_003409566.1.17816 WP_003409566.1.17821 WP_003409566.1.17830 WP_003409566.1.17868 WP_003409566.1.17878 WP_003409566.1.1792 WP_003409566.1.17923 WP_003409566.1.1795 WP_003409566.1.17955 WP_003409566.1.17973 WP_003409566.1.18009 WP_003409566.1.18013 WP_003409566.1.18033 WP_003409566.1.18057 WP_003409566.1.18065 WP_003409566.1.18070 WP_003409566.1.18116 WP_003409566.1.18120 WP_003409566.1.18126 WP_003409566.1.1817 WP_003409566.1.18170 WP_003409566.1.18206 WP_003409566.1.18216 WP_003409566.1.18240 WP_003409566.1.18257 WP_003409566.1.18297 WP_003409566.1.18306 WP_003409566.1.18364 WP_003409566.1.18399 WP_003409566.1.18411 WP_003409566.1.18444 WP_003409566.1.18448 WP_003409566.1.18467 WP_003409566.1.18476 WP_003409566.1.18522 WP_003409566.1.18580 WP_003409566.1.18582 WP_003409566.1.18587 WP_003409566.1.186 WP_003409566.1.18601 WP_003409566.1.18639 WP_003409566.1.18646 WP_003409566.1.18647 WP_003409566.1.1868 WP_003409566.1.18694 WP_003409566.1.18710 WP_003409566.1.18751 WP_003409566.1.18781 WP_003409566.1.18793 WP_003409566.1.18804 WP_003409566.1.18816 WP_003409566.1.18823 WP_003409566.1.18827 WP_003409566.1.18838 WP_003409566.1.18849 WP_003409566.1.18856 WP_003409566.1.18945 WP_003409566.1.1898 WP_003409566.1.19005 WP_003409566.1.19056 WP_003409566.1.19066 WP_003409566.1.19071 WP_003409566.1.19085 WP_003409566.1.19094 WP_003409566.1.19144 WP_003409566.1.19159 WP_003409566.1.19193 WP_003409566.1.19231 WP_003409566.1.19243 WP_003409566.1.19264 WP_003409566.1.19295 WP_003409566.1.19307 WP_003409566.1.19326 WP_003409566.1.1933 WP_003409566.1.19382 WP_003409566.1.19400 WP_003409566.1.19426 WP_003409566.1.19429 WP_003409566.1.19480 WP_003409566.1.19512 WP_003409566.1.19562 WP_003409566.1.19564 WP_003409566.1.19568 WP_003409566.1.19572 WP_003409566.1.19595 WP_003409566.1.19600 WP_003409566.1.19630 WP_003409566.1.19694 WP_003409566.1.1970 WP_003409566.1.19707 WP_003409566.1.19742 WP_003409566.1.19785 WP_003409566.1.19820 WP_003409566.1.19868 WP_003409566.1.19874 WP_003409566.1.19890 WP_003409566.1.19900 WP_003409566.1.19922 WP_003409566.1.19936 WP_003409566.1.19946 WP_003409566.1.19949 WP_003409566.1.19960 WP_003409566.1.19964 WP_003409566.1.20007 WP_003409566.1.20016 WP_003409566.1.20028 WP_003409566.1.2003 WP_003409566.1.20037 WP_003409566.1.20039 WP_003409566.1.20082 WP_003409566.1.20085 WP_003409566.1.20097 WP_003409566.1.20116 WP_003409566.1.20130 WP_003409566.1.20140 WP_003409566.1.20141 WP_003409566.1.20142 WP_003409566.1.20158 WP_003409566.1.20239 WP_003409566.1.20243 WP_003409566.1.20259 WP_003409566.1.20262 WP_003409566.1.20268 WP_003409566.1.20273 WP_003409566.1.20280 WP_003409566.1.20294 WP_003409566.1.20300 WP_003409566.1.20309 WP_003409566.1.20322 WP_003409566.1.2037 WP_003409566.1.20372 WP_003409566.1.20381 WP_003409566.1.204 WP_003409566.1.20427 WP_003409566.1.20432 WP_003409566.1.20457 WP_003409566.1.20459 WP_003409566.1.20460 WP_003409566.1.20542 WP_003409566.1.20578 WP_003409566.1.20608 WP_003409566.1.20624 WP_003409566.1.20628 WP_003409566.1.2066 WP_003409566.1.20707 WP_003409566.1.20722 WP_003409566.1.20742 WP_003409566.1.20751 WP_003409566.1.20776 WP_003409566.1.20843 WP_003409566.1.20850 WP_003409566.1.20868 WP_003409566.1.20897 WP_003409566.1.2090 WP_003409566.1.20911 WP_003409566.1.20916 WP_003409566.1.20921 WP_003409566.1.20926 WP_003409566.1.20927 WP_003409566.1.20951 WP_003409566.1.20970 WP_003409566.1.2104 WP_003409566.1.21070 WP_003409566.1.21135 WP_003409566.1.21173 WP_003409566.1.21187 WP_003409566.1.212 WP_003409566.1.2120 WP_003409566.1.21218 WP_003409566.1.2123 WP_003409566.1.21231 WP_003409566.1.21234 WP_003409566.1.2126 WP_003409566.1.21292 WP_003409566.1.21307 WP_003409566.1.2131 WP_003409566.1.21311 WP_003409566.1.21321 WP_003409566.1.21365 WP_003409566.1.2137 WP_003409566.1.21392 WP_003409566.1.21397 WP_003409566.1.21415 WP_003409566.1.21418 WP_003409566.1.21430 WP_003409566.1.21434 WP_003409566.1.21444 WP_003409566.1.21468 WP_003409566.1.21498 WP_003409566.1.21509 WP_003409566.1.21513 WP_003409566.1.21565 WP_003409566.1.21586 WP_003409566.1.21591 WP_003409566.1.21594 WP_003409566.1.21602 WP_003409566.1.21615 WP_003409566.1.21638 WP_003409566.1.21639 WP_003409566.1.21655 WP_003409566.1.21658 WP_003409566.1.2168 WP_003409566.1.2174 WP_003409566.1.21741 WP_003409566.1.21742 WP_003409566.1.21777 WP_003409566.1.21786 WP_003409566.1.21795 WP_003409566.1.218 WP_003409566.1.21826 WP_003409566.1.21829 WP_003409566.1.21840 WP_003409566.1.21843 WP_003409566.1.21872 WP_003409566.1.21873 WP_003409566.1.2188 WP_003409566.1.21882 WP_003409566.1.21906 WP_003409566.1.21912 WP_003409566.1.2194 WP_003409566.1.21941 WP_003409566.1.21956 WP_003409566.1.21958 WP_003409566.1.21960 WP_003409566.1.21971 WP_003409566.1.21973 WP_003409566.1.21983 WP_003409566.1.22003 WP_003409566.1.22013 WP_003409566.1.22025 WP_003409566.1.22036 WP_003409566.1.22075 WP_003409566.1.22092 WP_003409566.1.2212 WP_003409566.1.22127 WP_003409566.1.22140 WP_003409566.1.22233 WP_003409566.1.22255 WP_003409566.1.22277 WP_003409566.1.22305 WP_003409566.1.22348 WP_003409566.1.22356 WP_003409566.1.22366 WP_003409566.1.2238 WP_003409566.1.22380 WP_003409566.1.22437 WP_003409566.1.22438 WP_003409566.1.22445 WP_003409566.1.22490 WP_003409566.1.22511 WP_003409566.1.22524 WP_003409566.1.2253 WP_003409566.1.22585 WP_003409566.1.22589 WP_003409566.1.22606 WP_003409566.1.22608 WP_003409566.1.22609 WP_003409566.1.22618 WP_003409566.1.2262 WP_003409566.1.22624 WP_003409566.1.22629 WP_003409566.1.22647 WP_003409566.1.22664 WP_003409566.1.22665 WP_003409566.1.22670 WP_003409566.1.22674 WP_003409566.1.22725 WP_003409566.1.22728 WP_003409566.1.22733 WP_003409566.1.22737 WP_003409566.1.22754 WP_003409566.1.22797 WP_003409566.1.22800 WP_003409566.1.22804 WP_003409566.1.22829 WP_003409566.1.22840 WP_003409566.1.22844 WP_003409566.1.22963 WP_003409566.1.22970 WP_003409566.1.22996 WP_003409566.1.22997 WP_003409566.1.22999 WP_003409566.1.23015 WP_003409566.1.23032 WP_003409566.1.231 WP_003409566.1.23101 WP_003409566.1.2312 WP_003409566.1.23140 WP_003409566.1.23153 WP_003409566.1.23171 WP_003409566.1.23199 WP_003409566.1.2320 WP_003409566.1.23204 WP_003409566.1.23216 WP_003409566.1.23229 WP_003409566.1.23233 WP_003409566.1.2326 WP_003409566.1.23261 WP_003409566.1.23272 WP_003409566.1.23289 WP_003409566.1.2329 WP_003409566.1.23308 WP_003409566.1.23316 WP_003409566.1.23321 WP_003409566.1.23325 WP_003409566.1.2339 WP_003409566.1.23406 WP_003409566.1.23438 WP_003409566.1.23445 WP_003409566.1.23447 WP_003409566.1.23452 WP_003409566.1.23461 WP_003409566.1.2349 WP_003409566.1.23496 WP_003409566.1.23497 WP_003409566.1.23506 WP_003409566.1.23530 WP_003409566.1.23539 WP_003409566.1.23546 WP_003409566.1.23551 WP_003409566.1.23573 WP_003409566.1.23583 WP_003409566.1.23588 WP_003409566.1.23628 WP_003409566.1.23677 WP_003409566.1.23683 WP_003409566.1.23692 WP_003409566.1.23694 WP_003409566.1.23699 WP_003409566.1.2371 WP_003409566.1.23803 WP_003409566.1.23807 WP_003409566.1.23825 WP_003409566.1.23832 WP_003409566.1.2384 WP_003409566.1.23843 WP_003409566.1.23863 WP_003409566.1.2387 WP_003409566.1.23894 WP_003409566.1.23993 WP_003409566.1.2400 WP_003409566.1.24007 WP_003409566.1.24008 WP_003409566.1.24046 WP_003409566.1.24057 WP_003409566.1.24062 WP_003409566.1.24113 WP_003409566.1.24119 WP_003409566.1.24128 WP_003409566.1.24140 WP_003409566.1.24176 WP_003409566.1.24190 WP_003409566.1.24202 WP_003409566.1.24244 WP_003409566.1.24261 WP_003409566.1.24294 WP_003409566.1.24357 WP_003409566.1.24396 WP_003409566.1.24414 WP_003409566.1.24423 WP_003409566.1.2443 WP_003409566.1.24446 WP_003409566.1.24461 WP_003409566.1.24500 WP_003409566.1.24507 WP_003409566.1.24509 WP_003409566.1.24529 WP_003409566.1.24553 WP_003409566.1.24599 WP_003409566.1.24629 WP_003409566.1.24638 WP_003409566.1.2466 WP_003409566.1.24767 WP_003409566.1.24824 WP_003409566.1.24831 WP_003409566.1.24840 WP_003409566.1.24848 WP_003409566.1.24857 WP_003409566.1.2487 WP_003409566.1.24893 WP_003409566.1.24907 WP_003409566.1.24933 WP_003409566.1.24956 WP_003409566.1.24958 WP_003409566.1.24985 WP_003409566.1.2499 WP_003409566.1.25004 WP_003409566.1.2505 WP_003409566.1.25051 WP_003409566.1.2507 WP_003409566.1.25096 WP_003409566.1.25103 WP_003409566.1.25129 WP_003409566.1.25171 WP_003409566.1.25184 WP_003409566.1.25247 WP_003409566.1.25278 WP_003409566.1.25283 WP_003409566.1.25309 WP_003409566.1.25313 WP_003409566.1.25338 WP_003409566.1.25342 WP_003409566.1.25343 WP_003409566.1.25367 WP_003409566.1.25393 WP_003409566.1.25406 WP_003409566.1.25435 WP_003409566.1.25437 WP_003409566.1.25445 WP_003409566.1.25455 WP_003409566.1.25473 WP_003409566.1.25504 WP_003409566.1.25513 WP_003409566.1.25542 WP_003409566.1.25579 WP_003409566.1.25594 WP_003409566.1.25606 WP_003409566.1.25645 WP_003409566.1.2566 WP_003409566.1.25673 WP_003409566.1.25674 WP_003409566.1.25693 WP_003409566.1.25699 WP_003409566.1.25727 WP_003409566.1.25736 WP_003409566.1.25738 WP_003409566.1.25756 WP_003409566.1.25759 WP_003409566.1.2580 WP_003409566.1.25813 WP_003409566.1.25854 WP_003409566.1.25874 WP_003409566.1.25885 WP_003409566.1.25892 WP_003409566.1.25906 WP_003409566.1.25914 WP_003409566.1.25916 WP_003409566.1.2594 WP_003409566.1.25954 WP_003409566.1.25965 WP_003409566.1.25972 WP_003409566.1.26017 WP_003409566.1.26032 WP_003409566.1.26038 WP_003409566.1.26072 WP_003409566.1.26089 WP_003409566.1.26097 WP_003409566.1.26098 WP_003409566.1.26108 WP_003409566.1.26118 WP_003409566.1.26126 WP_003409566.1.2614 WP_003409566.1.26168 WP_003409566.1.26182 WP_003409566.1.26190 WP_003409566.1.2620 WP_003409566.1.26234 WP_003409566.1.26243 WP_003409566.1.26265 WP_003409566.1.26267 WP_003409566.1.26292 WP_003409566.1.26310 WP_003409566.1.26328 WP_003409566.1.26349 WP_003409566.1.26366 WP_003409566.1.26374 WP_003409566.1.26407 WP_003409566.1.26412 WP_003409566.1.26454 WP_003409566.1.26464 WP_003409566.1.2653 WP_003409566.1.26560 WP_003409566.1.26571 WP_003409566.1.2659 WP_003409566.1.26597 WP_003409566.1.26603 WP_003409566.1.26629 WP_003409566.1.26651 WP_003409566.1.26702 WP_003409566.1.26707 WP_003409566.1.26710 WP_003409566.1.26719 WP_003409566.1.26737 WP_003409566.1.26738 WP_003409566.1.26745 WP_003409566.1.26756 WP_003409566.1.2676 WP_003409566.1.2677 WP_003409566.1.26779 WP_003409566.1.26780 WP_003409566.1.26798 WP_003409566.1.26854 WP_003409566.1.26868 WP_003409566.1.26876 WP_003409566.1.26888 WP_003409566.1.26914 WP_003409566.1.26945 WP_003409566.1.26959 WP_003409566.1.26969 WP_003409566.1.26984 WP_003409566.1.26992 WP_003409566.1.27004 WP_003409566.1.27017 WP_003409566.1.27045 WP_003409566.1.27074 WP_003409566.1.27075 WP_003409566.1.27128 WP_003409566.1.27130 WP_003409566.1.27139 WP_003409566.1.27152 WP_003409566.1.27162 WP_003409566.1.27164 WP_003409566.1.27193 WP_003409566.1.27235 WP_003409566.1.27254 WP_003409566.1.27278 WP_003409566.1.27343 WP_003409566.1.27352 WP_003409566.1.27369 WP_003409566.1.27391 WP_003409566.1.27398 WP_003409566.1.27402 WP_003409566.1.27410 WP_003409566.1.27411 WP_003409566.1.27449 WP_003409566.1.27460 WP_003409566.1.27463 WP_003409566.1.27492 WP_003409566.1.27528 WP_003409566.1.27541 WP_003409566.1.27576 WP_003409566.1.27582 WP_003409566.1.27596 WP_003409566.1.27607 WP_003409566.1.2766 WP_003409566.1.277 WP_003409566.1.27724 WP_003409566.1.27730 WP_003409566.1.27736 WP_003409566.1.27743 WP_003409566.1.27750 WP_003409566.1.27771 WP_003409566.1.27779 WP_003409566.1.27795 WP_003409566.1.27803 WP_003409566.1.27819 WP_003409566.1.27835 WP_003409566.1.27915 WP_003409566.1.27935 WP_003409566.1.27962 WP_003409566.1.28053 WP_003409566.1.28092 WP_003409566.1.28106 WP_003409566.1.28131 WP_003409566.1.28142 WP_003409566.1.28159 WP_003409566.1.2816 WP_003409566.1.28161 WP_003409566.1.28192 WP_003409566.1.28202 WP_003409566.1.28241 WP_003409566.1.28242 WP_003409566.1.28251 WP_003409566.1.28255 WP_003409566.1.28269 WP_003409566.1.28276 WP_003409566.1.28293 WP_003409566.1.28331 WP_003409566.1.28367 WP_003409566.1.28378 WP_003409566.1.2842 WP_003409566.1.28448 WP_003409566.1.2847 WP_003409566.1.28471 WP_003409566.1.28473 WP_003409566.1.28493 WP_003409566.1.28497 WP_003409566.1.28530 WP_003409566.1.28545 WP_003409566.1.28561 WP_003409566.1.28567 WP_003409566.1.28585 WP_003409566.1.286 WP_003409566.1.28610 WP_003409566.1.28617 WP_003409566.1.28634 WP_003409566.1.28642 WP_003409566.1.28671 WP_003409566.1.28682 WP_003409566.1.28698 WP_003409566.1.28703 WP_003409566.1.28758 WP_003409566.1.28781 WP_003409566.1.28787 WP_003409566.1.28827 WP_003409566.1.28847 WP_003409566.1.28850 WP_003409566.1.28851 WP_003409566.1.28865 WP_003409566.1.28897 WP_003409566.1.28914 WP_003409566.1.28935 WP_003409566.1.28936 WP_003409566.1.28939 WP_003409566.1.28943 WP_003409566.1.28952 WP_003409566.1.28975 WP_003409566.1.2899 WP_003409566.1.28993 WP_003409566.1.29000 WP_003409566.1.2901 WP_003409566.1.29028 WP_003409566.1.29033 WP_003409566.1.29058 WP_003409566.1.29078 WP_003409566.1.29102 WP_003409566.1.29115 WP_003409566.1.2916 WP_003409566.1.29217 WP_003409566.1.29223 WP_003409566.1.29234 WP_003409566.1.29264 WP_003409566.1.29275 WP_003409566.1.29306 WP_003409566.1.29339 WP_003409566.1.29348 WP_003409566.1.29364 WP_003409566.1.29367 WP_003409566.1.2938 WP_003409566.1.29399 WP_003409566.1.29426 WP_003409566.1.29449 WP_003409566.1.29450 WP_003409566.1.29452 WP_003409566.1.2949 WP_003409566.1.29510 WP_003409566.1.29515 WP_003409566.1.29525 WP_003409566.1.2953 WP_003409566.1.29559 WP_003409566.1.29587 WP_003409566.1.2959 WP_003409566.1.29592 WP_003409566.1.29599 WP_003409566.1.29611 WP_003409566.1.29632 WP_003409566.1.29649 WP_003409566.1.2965 WP_003409566.1.29659 WP_003409566.1.2969 WP_003409566.1.29696 WP_003409566.1.29698 WP_003409566.1.29718 WP_003409566.1.29742 WP_003409566.1.29745 WP_003409566.1.29747 WP_003409566.1.29769 WP_003409566.1.29825 WP_003409566.1.29830 WP_003409566.1.29847 WP_003409566.1.29861 WP_003409566.1.29869 WP_003409566.1.29883 WP_003409566.1.29890 WP_003409566.1.29931 WP_003409566.1.29960 WP_003409566.1.30014 WP_003409566.1.3004 WP_003409566.1.30040 WP_003409566.1.30043 WP_003409566.1.30074 WP_003409566.1.30097 WP_003409566.1.30101 WP_003409566.1.30106 WP_003409566.1.30114 WP_003409566.1.30126 WP_003409566.1.30131 WP_003409566.1.30139 WP_003409566.1.30145 WP_003409566.1.30211 WP_003409566.1.30224 WP_003409566.1.30235 WP_003409566.1.30237 WP_003409566.1.3027 WP_003409566.1.30279 WP_003409566.1.30282 WP_003409566.1.30283 WP_003409566.1.30288 WP_003409566.1.30291 WP_003409566.1.30363 WP_003409566.1.30374 WP_003409566.1.30404 WP_003409566.1.3043 WP_003409566.1.30433 WP_003409566.1.30438 WP_003409566.1.30462 WP_003409566.1.30464 WP_003409566.1.30468 WP_003409566.1.30500 WP_003409566.1.3057 WP_003409566.1.30574 WP_003409566.1.30628 WP_003409566.1.30641 WP_003409566.1.30642 WP_003409566.1.30661 WP_003409566.1.30669 WP_003409566.1.30683 WP_003409566.1.30699 WP_003409566.1.30709 WP_003409566.1.30713 WP_003409566.1.30716 WP_003409566.1.30719 WP_003409566.1.30730 WP_003409566.1.30732 WP_003409566.1.30736 WP_003409566.1.30760 WP_003409566.1.30791 WP_003409566.1.308 WP_003409566.1.30807 WP_003409566.1.30818 WP_003409566.1.30824 WP_003409566.1.30848 WP_003409566.1.30877 WP_003409566.1.30888 WP_003409566.1.30901 WP_003409566.1.30903 WP_003409566.1.30912 WP_003409566.1.30913 WP_003409566.1.30914 WP_003409566.1.30919 WP_003409566.1.30977 WP_003409566.1.3100 WP_003409566.1.31002 WP_003409566.1.3101 WP_003409566.1.31034 WP_003409566.1.31047 WP_003409566.1.31070 WP_003409566.1.31074 WP_003409566.1.31102 WP_003409566.1.31127 WP_003409566.1.31184 WP_003409566.1.31199 WP_003409566.1.31226 WP_003409566.1.31230 WP_003409566.1.31233 WP_003409566.1.31263 WP_003409566.1.31264 WP_003409566.1.31270 WP_003409566.1.31287 WP_003409566.1.31290 WP_003409566.1.31304 WP_003409566.1.31346 WP_003409566.1.31348 WP_003409566.1.31354 WP_003409566.1.31390 WP_003409566.1.31414 WP_003409566.1.31417 WP_003409566.1.3143 WP_003409566.1.31458 WP_003409566.1.31483 WP_003409566.1.3149 WP_003409566.1.31498 WP_003409566.1.31507 WP_003409566.1.31537 WP_003409566.1.31548 WP_003409566.1.31569 WP_003409566.1.31573 WP_003409566.1.316 WP_003409566.1.31629 WP_003409566.1.31666 WP_003409566.1.31693 WP_003409566.1.31703 WP_003409566.1.31744 WP_003409566.1.31745 WP_003409566.1.31770 WP_003409566.1.31776 WP_003409566.1.31783 WP_003409566.1.318 WP_003409566.1.3184 WP_003409566.1.31840 WP_003409566.1.31880 WP_003409566.1.31911 WP_003409566.1.31930 WP_003409566.1.31932 WP_003409566.1.31955 WP_003409566.1.31985 WP_003409566.1.31991 WP_003409566.1.31995 WP_003409566.1.32004 WP_003409566.1.32039 WP_003409566.1.3204 WP_003409566.1.32045 WP_003409566.1.32071 WP_003409566.1.32098 WP_003409566.1.32132 WP_003409566.1.32157 WP_003409566.1.32164 WP_003409566.1.32179 WP_003409566.1.32198 WP_003409566.1.32297 WP_003409566.1.32317 WP_003409566.1.32383 WP_003409566.1.32400 WP_003409566.1.32403 WP_003409566.1.32416 WP_003409566.1.32433 WP_003409566.1.32461 WP_003409566.1.32482 WP_003409566.1.32503 WP_003409566.1.32556 WP_003409566.1.32562 WP_003409566.1.32569 WP_003409566.1.32592 WP_003409566.1.32620 WP_003409566.1.32647 WP_003409566.1.32653 WP_003409566.1.32654 WP_003409566.1.3268 WP_003409566.1.32695 WP_003409566.1.32706 WP_003409566.1.32716 WP_003409566.1.32738 WP_003409566.1.32752 WP_003409566.1.32780 WP_003409566.1.32781 WP_003409566.1.32793 WP_003409566.1.32799 WP_003409566.1.32822 WP_003409566.1.32833 WP_003409566.1.32862 WP_003409566.1.32880 WP_003409566.1.32909 WP_003409566.1.32935 WP_003409566.1.32974 WP_003409566.1.33007 WP_003409566.1.3302 WP_003409566.1.33028 WP_003409566.1.33044 WP_003409566.1.33054 WP_003409566.1.33082 WP_003409566.1.33141 WP_003409566.1.33148 WP_003409566.1.33155 WP_003409566.1.33168 WP_003409566.1.3321 WP_003409566.1.33215 WP_003409566.1.3325 WP_003409566.1.3327 WP_003409566.1.33278 WP_003409566.1.33288 WP_003409566.1.33305 WP_003409566.1.3331 WP_003409566.1.33319 WP_003409566.1.3333 WP_003409566.1.33393 WP_003409566.1.33403 WP_003409566.1.33452 WP_003409566.1.33467 WP_003409566.1.33477 WP_003409566.1.3349 WP_003409566.1.33519 WP_003409566.1.33542 WP_003409566.1.33601 WP_003409566.1.33602 WP_003409566.1.33633 WP_003409566.1.33646 WP_003409566.1.33673 WP_003409566.1.3369 WP_003409566.1.33705 WP_003409566.1.33762 WP_003409566.1.33783 WP_003409566.1.33789 WP_003409566.1.3383 WP_003409566.1.33832 WP_003409566.1.33848 WP_003409566.1.3387 WP_003409566.1.33886 WP_003409566.1.33895 WP_003409566.1.33906 WP_003409566.1.33912 WP_003409566.1.33954 WP_003409566.1.3399 WP_003409566.1.34042 WP_003409566.1.3405 WP_003409566.1.34055 WP_003409566.1.34056 WP_003409566.1.34065 WP_003409566.1.34090 WP_003409566.1.34109 WP_003409566.1.34111 WP_003409566.1.34131 WP_003409566.1.34152 WP_003409566.1.34153 WP_003409566.1.34163 WP_003409566.1.34181 WP_003409566.1.34197 WP_003409566.1.34198 WP_003409566.1.34215 WP_003409566.1.34219 WP_003409566.1.34255 WP_003409566.1.34260 WP_003409566.1.34275 WP_003409566.1.343 WP_003409566.1.34347 WP_003409566.1.34358 WP_003409566.1.34392 WP_003409566.1.344 WP_003409566.1.34428 WP_003409566.1.3443 WP_003409566.1.34435 WP_003409566.1.34446 WP_003409566.1.34499 WP_003409566.1.34505 WP_003409566.1.34516 WP_003409566.1.34529 WP_003409566.1.34551 WP_003409566.1.34563 WP_003409566.1.34576 WP_003409566.1.34581 WP_003409566.1.34588 WP_003409566.1.34596 WP_003409566.1.34599 WP_003409566.1.34639 WP_003409566.1.34673 WP_003409566.1.34724 WP_003409566.1.34740 WP_003409566.1.34755 WP_003409566.1.34777 WP_003409566.1.34783 WP_003409566.1.34841 WP_003409566.1.34908 WP_003409566.1.34919 WP_003409566.1.3492 WP_003409566.1.34933 WP_003409566.1.34945 WP_003409566.1.34946 WP_003409566.1.34954 WP_003409566.1.34960 WP_003409566.1.34961 WP_003409566.1.34963 WP_003409566.1.34965 WP_003409566.1.34968 WP_003409566.1.35023 WP_003409566.1.35069 WP_003409566.1.35072 WP_003409566.1.35078 WP_003409566.1.35100 WP_003409566.1.35146 WP_003409566.1.35156 WP_003409566.1.35160 WP_003409566.1.35162 WP_003409566.1.35173 WP_003409566.1.35176 WP_003409566.1.3520 WP_003409566.1.35213 WP_003409566.1.35221 WP_003409566.1.35246 WP_003409566.1.35278 WP_003409566.1.35301 WP_003409566.1.35311 WP_003409566.1.35312 WP_003409566.1.35317 WP_003409566.1.35319 WP_003409566.1.35347 WP_003409566.1.35363 WP_003409566.1.35382 WP_003409566.1.35396 WP_003409566.1.35397 WP_003409566.1.35426 WP_003409566.1.35439 WP_003409566.1.35455 WP_003409566.1.3548 WP_003409566.1.35484 WP_003409566.1.35492 WP_003409566.1.3553 WP_003409566.1.35553 WP_003409566.1.35555 WP_003409566.1.35561 WP_003409566.1.35602 WP_003409566.1.35610 WP_003409566.1.35657 WP_003409566.1.35680 WP_003409566.1.35687 WP_003409566.1.35689 WP_003409566.1.35707 WP_003409566.1.35732 WP_003409566.1.35754 WP_003409566.1.35767 WP_003409566.1.35770 WP_003409566.1.35771 WP_003409566.1.35780 WP_003409566.1.35805 WP_003409566.1.35811 WP_003409566.1.35821 WP_003409566.1.3584 WP_003409566.1.35848 WP_003409566.1.35864 WP_003409566.1.35874 WP_003409566.1.35876 WP_003409566.1.35897 WP_003409566.1.35899 WP_003409566.1.35923 WP_003409566.1.3593 WP_003409566.1.35954 WP_003409566.1.36005 WP_003409566.1.36014 WP_003409566.1.36023 WP_003409566.1.36051 WP_003409566.1.36053 WP_003409566.1.36075 WP_003409566.1.36089 WP_003409566.1.36097 WP_003409566.1.36098 WP_003409566.1.36116 WP_003409566.1.36145 WP_003409566.1.36156 WP_003409566.1.36205 WP_003409566.1.36228 WP_003409566.1.36246 WP_003409566.1.36252 WP_003409566.1.36260 WP_003409566.1.36270 WP_003409566.1.36271 WP_003409566.1.36303 WP_003409566.1.36309 WP_003409566.1.36315 WP_003409566.1.36319 WP_003409566.1.36321 WP_003409566.1.36326 WP_003409566.1.3634 WP_003409566.1.36356 WP_003409566.1.36357 WP_003409566.1.3636 WP_003409566.1.36385 WP_003409566.1.36399 WP_003409566.1.36436 WP_003409566.1.36465 WP_003409566.1.36469 WP_003409566.1.36473 WP_003409566.1.36485 WP_003409566.1.36508 WP_003409566.1.36561 WP_003409566.1.36571 WP_003409566.1.36573 WP_003409566.1.36578 WP_003409566.1.36585 WP_003409566.1.36597 WP_003409566.1.36614 WP_003409566.1.36657 WP_003409566.1.36674 WP_003409566.1.36720 WP_003409566.1.36727 WP_003409566.1.36733 WP_003409566.1.36810 WP_003409566.1.36844 WP_003409566.1.36851 WP_003409566.1.36862 WP_003409566.1.36893 WP_003409566.1.36901 WP_003409566.1.36921 WP_003409566.1.36935 WP_003409566.1.36941 WP_003409566.1.3695 WP_003409566.1.36951 WP_003409566.1.36968 WP_003409566.1.3700 WP_003409566.1.37004 WP_003409566.1.37012 WP_003409566.1.37071 WP_003409566.1.37088 WP_003409566.1.37131 WP_003409566.1.37157 WP_003409566.1.37175 WP_003409566.1.37188 WP_003409566.1.37213 WP_003409566.1.37229 WP_003409566.1.3724 WP_003409566.1.37277 WP_003409566.1.37305 WP_003409566.1.37330 WP_003409566.1.37389 WP_003409566.1.37400 WP_003409566.1.37440 WP_003409566.1.37459 WP_003409566.1.37468 WP_003409566.1.37475 WP_003409566.1.37484 WP_003409566.1.37601 WP_003409566.1.37612 WP_003409566.1.37632 WP_003409566.1.37643 WP_003409566.1.37655 WP_003409566.1.37660 WP_003409566.1.37674 WP_003409566.1.37700 WP_003409566.1.37701 WP_003409566.1.37709 WP_003409566.1.37711 WP_003409566.1.37721 WP_003409566.1.37722 WP_003409566.1.37747 WP_003409566.1.37765 WP_003409566.1.37772 WP_003409566.1.37804 WP_003409566.1.37809 WP_003409566.1.37859 WP_003409566.1.37877 WP_003409566.1.37912 WP_003409566.1.37913 WP_003409566.1.37943 WP_003409566.1.37950 WP_003409566.1.37973 WP_003409566.1.37975 WP_003409566.1.37983 WP_003409566.1.38 WP_003409566.1.38002 WP_003409566.1.3802 WP_003409566.1.38039 WP_003409566.1.38040 WP_003409566.1.38067 WP_003409566.1.38068 WP_003409566.1.38135 WP_003409566.1.38138 WP_003409566.1.38144 WP_003409566.1.38158 WP_003409566.1.38159 WP_003409566.1.38210 WP_003409566.1.38233 WP_003409566.1.38240 WP_003409566.1.38332 WP_003409566.1.38347 WP_003409566.1.38354 WP_003409566.1.38380 WP_003409566.1.38384 WP_003409566.1.38389 WP_003409566.1.38398 WP_003409566.1.38402 WP_003409566.1.38418 WP_003409566.1.38421 WP_003409566.1.38466 WP_003409566.1.38483 WP_003409566.1.3849 WP_003409566.1.385 WP_003409566.1.38530 WP_003409566.1.38535 WP_003409566.1.38539 WP_003409566.1.38594 WP_003409566.1.38601 WP_003409566.1.38611 WP_003409566.1.38638 WP_003409566.1.38639 WP_003409566.1.38646 WP_003409566.1.38648 WP_003409566.1.38654 WP_003409566.1.38659 WP_003409566.1.38660 WP_003409566.1.38666 WP_003409566.1.38671 WP_003409566.1.38672 WP_003409566.1.38677 WP_003409566.1.38750 WP_003409566.1.38772 WP_003409566.1.38812 WP_003409566.1.38821 WP_003409566.1.38844 WP_003409566.1.38863 WP_003409566.1.38873 WP_003409566.1.3889 WP_003409566.1.38894 WP_003409566.1.38909 WP_003409566.1.38939 WP_003409566.1.38974 WP_003409566.1.38975 WP_003409566.1.38991 WP_003409566.1.39025 WP_003409566.1.39070 WP_003409566.1.39072 WP_003409566.1.39095 WP_003409566.1.39106 WP_003409566.1.39165 WP_003409566.1.39174 WP_003409566.1.39176 WP_003409566.1.39178 WP_003409566.1.39190 WP_003409566.1.39201 WP_003409566.1.39207 WP_003409566.1.39211 WP_003409566.1.39236 WP_003409566.1.39239 WP_003409566.1.39252 WP_003409566.1.39288 WP_003409566.1.39295 WP_003409566.1.39306 WP_003409566.1.39359 WP_003409566.1.39364 WP_003409566.1.39400 WP_003409566.1.39447 WP_003409566.1.3945 WP_003409566.1.39450 WP_003409566.1.39455 WP_003409566.1.3949 WP_003409566.1.39521 WP_003409566.1.39560 WP_003409566.1.39592 WP_003409566.1.39593 WP_003409566.1.3960 WP_003409566.1.39616 WP_003409566.1.39654 WP_003409566.1.39657 WP_003409566.1.39661 WP_003409566.1.39674 WP_003409566.1.39678 WP_003409566.1.3968 WP_003409566.1.39694 WP_003409566.1.3971 WP_003409566.1.39718 WP_003409566.1.39728 WP_003409566.1.39739 WP_003409566.1.39748 WP_003409566.1.39751 WP_003409566.1.39759 WP_003409566.1.39801 WP_003409566.1.39804 WP_003409566.1.39848 WP_003409566.1.39877 WP_003409566.1.39925 WP_003409566.1.3994 WP_003409566.1.39959 WP_003409566.1.3996 WP_003409566.1.39960 WP_003409566.1.3997 WP_003409566.1.39980 WP_003409566.1.40000 WP_003409566.1.40028 WP_003409566.1.40029 WP_003409566.1.4003 WP_003409566.1.40094 WP_003409566.1.40096 WP_003409566.1.40150 WP_003409566.1.40156 WP_003409566.1.40174 WP_003409566.1.40186 WP_003409566.1.40276 WP_003409566.1.40277 WP_003409566.1.40323 WP_003409566.1.40336 WP_003409566.1.40353 WP_003409566.1.4036 WP_003409566.1.40372 WP_003409566.1.40402 WP_003409566.1.40413 WP_003409566.1.40440 WP_003409566.1.40446 WP_003409566.1.40451 WP_003409566.1.40455 WP_003409566.1.40523 WP_003409566.1.40543 WP_003409566.1.40641 WP_003409566.1.40646 WP_003409566.1.40651 WP_003409566.1.40653 WP_003409566.1.4067 WP_003409566.1.40705 WP_003409566.1.40723 WP_003409566.1.40731 WP_003409566.1.40735 WP_003409566.1.40795 WP_003409566.1.40799 WP_003409566.1.40852 WP_003409566.1.40876 WP_003409566.1.40881 WP_003409566.1.40922 WP_003409566.1.40948 WP_003409566.1.4095 WP_003409566.1.40956 WP_003409566.1.40957 WP_003409566.1.40964 WP_003409566.1.4097 WP_003409566.1.410 WP_003409566.1.41000 WP_003409566.1.41055 WP_003409566.1.41108 WP_003409566.1.41123 WP_003409566.1.41177 WP_003409566.1.41202 WP_003409566.1.41219 WP_003409566.1.41231 WP_003409566.1.41249 WP_003409566.1.4127 WP_003409566.1.41296 WP_003409566.1.41355 WP_003409566.1.41376 WP_003409566.1.41430 WP_003409566.1.41447 WP_003409566.1.41469 WP_003409566.1.41564 WP_003409566.1.41583 WP_003409566.1.41616 WP_003409566.1.41632 WP_003409566.1.41635 WP_003409566.1.41636 WP_003409566.1.41648 WP_003409566.1.41660 WP_003409566.1.41685 WP_003409566.1.41695 WP_003409566.1.41704 WP_003409566.1.4171 WP_003409566.1.41719 WP_003409566.1.41733 WP_003409566.1.41744 WP_003409566.1.41774 WP_003409566.1.41791 WP_003409566.1.41803 WP_003409566.1.41820 WP_003409566.1.41828 WP_003409566.1.41829 WP_003409566.1.41860 WP_003409566.1.41912 WP_003409566.1.41921 WP_003409566.1.41933 WP_003409566.1.41944 WP_003409566.1.42043 WP_003409566.1.42075 WP_003409566.1.42078 WP_003409566.1.42094 WP_003409566.1.42112 WP_003409566.1.4212 WP_003409566.1.42122 WP_003409566.1.42134 WP_003409566.1.42183 WP_003409566.1.42188 WP_003409566.1.42201 WP_003409566.1.42202 WP_003409566.1.42208 WP_003409566.1.42247 WP_003409566.1.42255 WP_003409566.1.42273 WP_003409566.1.42278 WP_003409566.1.42304 WP_003409566.1.42309 WP_003409566.1.42370 WP_003409566.1.42385 WP_003409566.1.42400 WP_003409566.1.42409 WP_003409566.1.42414 WP_003409566.1.42417 WP_003409566.1.42430 WP_003409566.1.42465 WP_003409566.1.42467 WP_003409566.1.42473 WP_003409566.1.42474 WP_003409566.1.4248 WP_003409566.1.42494 WP_003409566.1.42519 WP_003409566.1.42524 WP_003409566.1.42534 WP_003409566.1.4255 WP_003409566.1.42562 WP_003409566.1.42568 WP_003409566.1.42570 WP_003409566.1.42618 WP_003409566.1.42660 WP_003409566.1.42695 WP_003409566.1.42704 WP_003409566.1.42705 WP_003409566.1.42722 WP_003409566.1.42777 WP_003409566.1.42782 WP_003409566.1.42835 WP_003409566.1.42839 WP_003409566.1.42842 WP_003409566.1.42905 WP_003409566.1.42916 WP_003409566.1.42930 WP_003409566.1.42971 WP_003409566.1.43005 WP_003409566.1.43009 WP_003409566.1.43053 WP_003409566.1.43082 WP_003409566.1.43087 WP_003409566.1.43098 WP_003409566.1.43208 WP_003409566.1.43236 WP_003409566.1.43246 WP_003409566.1.43255 WP_003409566.1.43266 WP_003409566.1.43269 WP_003409566.1.43273 WP_003409566.1.43296 WP_003409566.1.43306 WP_003409566.1.4335 WP_003409566.1.43368 WP_003409566.1.43395 WP_003409566.1.43457 WP_003409566.1.43462 WP_003409566.1.43475 WP_003409566.1.43478 WP_003409566.1.43484 WP_003409566.1.43557 WP_003409566.1.43578 WP_003409566.1.43588 WP_003409566.1.43643 WP_003409566.1.43664 WP_003409566.1.43684 WP_003409566.1.43686 WP_003409566.1.43706 WP_003409566.1.43716 WP_003409566.1.4377 WP_003409566.1.43781 WP_003409566.1.43794 WP_003409566.1.43815 WP_003409566.1.43846 WP_003409566.1.43861 WP_003409566.1.43863 WP_003409566.1.43866 WP_003409566.1.43872 WP_003409566.1.43885 WP_003409566.1.4390 WP_003409566.1.43902 WP_003409566.1.43921 WP_003409566.1.43936 WP_003409566.1.43937 WP_003409566.1.43960 WP_003409566.1.43965 WP_003409566.1.4399 WP_003409566.1.43993 WP_003409566.1.43996 WP_003409566.1.44 WP_003409566.1.44001 WP_003409566.1.44008 WP_003409566.1.44016 WP_003409566.1.44033 WP_003409566.1.44037 WP_003409566.1.44041 WP_003409566.1.44070 WP_003409566.1.44071 WP_003409566.1.44076 WP_003409566.1.44104 WP_003409566.1.44111 WP_003409566.1.44124 WP_003409566.1.44219 WP_003409566.1.44237 WP_003409566.1.44277 WP_003409566.1.44279 WP_003409566.1.44336 WP_003409566.1.44355 WP_003409566.1.44358 WP_003409566.1.4438 WP_003409566.1.44390 WP_003409566.1.44392 WP_003409566.1.4441 WP_003409566.1.44415 WP_003409566.1.44464 WP_003409566.1.44466 WP_003409566.1.44489 WP_003409566.1.44492 WP_003409566.1.44494 WP_003409566.1.44500 WP_003409566.1.44519 WP_003409566.1.44526 WP_003409566.1.44532 WP_003409566.1.44534 WP_003409566.1.44562 WP_003409566.1.44589 WP_003409566.1.44597 WP_003409566.1.44600 WP_003409566.1.44602 WP_003409566.1.44615 WP_003409566.1.4464 WP_003409566.1.44651 WP_003409566.1.44659 WP_003409566.1.44665 WP_003409566.1.44700 WP_003409566.1.44713 WP_003409566.1.44735 WP_003409566.1.44740 WP_003409566.1.44757 WP_003409566.1.4476 WP_003409566.1.44761 WP_003409566.1.44767 WP_003409566.1.44776 WP_003409566.1.44779 WP_003409566.1.44786 WP_003409566.1.44808 WP_003409566.1.44864 WP_003409566.1.44901 WP_003409566.1.44908 WP_003409566.1.44913 WP_003409566.1.4492 WP_003409566.1.44939 WP_003409566.1.44979 WP_003409566.1.44981 WP_003409566.1.45002 WP_003409566.1.4504 WP_003409566.1.45066 WP_003409566.1.45081 WP_003409566.1.45113 WP_003409566.1.45129 WP_003409566.1.45135 WP_003409566.1.45147 WP_003409566.1.45168 WP_003409566.1.45181 WP_003409566.1.45185 WP_003409566.1.45192 WP_003409566.1.45200 WP_003409566.1.45205 WP_003409566.1.45211 WP_003409566.1.45249 WP_003409566.1.4526 WP_003409566.1.45286 WP_003409566.1.45326 WP_003409566.1.45347 WP_003409566.1.45374 WP_003409566.1.45390 WP_003409566.1.454 WP_003409566.1.45407 WP_003409566.1.45451 WP_003409566.1.45453 WP_003409566.1.45460 WP_003409566.1.45463 WP_003409566.1.45470 WP_003409566.1.45474 WP_003409566.1.45491 WP_003409566.1.45510 WP_003409566.1.45563 WP_003409566.1.45584 WP_003409566.1.45590 WP_003409566.1.45619 WP_003409566.1.45626 WP_003409566.1.45631 WP_003409566.1.45666 WP_003409566.1.45697 WP_003409566.1.4571 WP_003409566.1.45731 WP_003409566.1.45743 WP_003409566.1.45765 WP_003409566.1.45776 WP_003409566.1.45783 WP_003409566.1.45805 WP_003409566.1.45815 WP_003409566.1.45849 WP_003409566.1.45867 WP_003409566.1.45884 WP_003409566.1.4590 WP_003409566.1.45923 WP_003409566.1.45926 WP_003409566.1.45963 WP_003409566.1.45989 WP_003409566.1.45992 WP_003409566.1.46025 WP_003409566.1.46083 WP_003409566.1.46090 WP_003409566.1.46092 WP_003409566.1.46100 WP_003409566.1.46101 WP_003409566.1.46103 WP_003409566.1.46107 WP_003409566.1.46127 WP_003409566.1.46128 WP_003409566.1.46129 WP_003409566.1.46141 WP_003409566.1.46150 WP_003409566.1.46201 WP_003409566.1.46226 WP_003409566.1.4624 WP_003409566.1.46253 WP_003409566.1.46268 WP_003409566.1.46285 WP_003409566.1.46300 WP_003409566.1.46313 WP_003409566.1.46336 WP_003409566.1.46365 WP_003409566.1.46370 WP_003409566.1.46381 WP_003409566.1.46402 WP_003409566.1.46411 WP_003409566.1.4644 WP_003409566.1.46442 WP_003409566.1.46453 WP_003409566.1.46463 WP_003409566.1.46478 WP_003409566.1.46492 WP_003409566.1.46521 WP_003409566.1.4653 WP_003409566.1.46532 WP_003409566.1.46539 WP_003409566.1.46568 WP_003409566.1.46585 WP_003409566.1.46609 WP_003409566.1.46613 WP_003409566.1.46625 WP_003409566.1.46642 WP_003409566.1.46647 WP_003409566.1.46674 WP_003409566.1.46724 WP_003409566.1.46758 WP_003409566.1.46777 WP_003409566.1.46786 WP_003409566.1.46792 WP_003409566.1.46847 WP_003409566.1.46851 WP_003409566.1.4687 WP_003409566.1.46897 WP_003409566.1.46936 WP_003409566.1.46980 WP_003409566.1.47011 WP_003409566.1.47012 WP_003409566.1.47066 WP_003409566.1.47077 WP_003409566.1.47083 WP_003409566.1.47106 WP_003409566.1.47142 WP_003409566.1.47147 WP_003409566.1.47178 WP_003409566.1.47179 WP_003409566.1.47194 WP_003409566.1.47207 WP_003409566.1.47210 WP_003409566.1.47261 WP_003409566.1.47262 WP_003409566.1.47402 WP_003409566.1.47423 WP_003409566.1.47467 WP_003409566.1.47502 WP_003409566.1.4751 WP_003409566.1.47511 WP_003409566.1.47537 WP_003409566.1.47540 WP_003409566.1.47568 WP_003409566.1.47572 WP_003409566.1.47588 WP_003409566.1.47636 WP_003409566.1.4764 WP_003409566.1.47653 WP_003409566.1.47679 WP_003409566.1.47681 WP_003409566.1.47690 WP_003409566.1.4771 WP_003409566.1.47717 WP_003409566.1.47743 WP_003409566.1.47754 WP_003409566.1.47773 WP_003409566.1.47776 WP_003409566.1.47780 WP_003409566.1.47805 WP_003409566.1.47832 WP_003409566.1.47847 WP_003409566.1.47858 WP_003409566.1.47861 WP_003409566.1.47868 WP_003409566.1.47893 WP_003409566.1.47899 WP_003409566.1.479 WP_003409566.1.47912 WP_003409566.1.47913 WP_003409566.1.47926 WP_003409566.1.4794 WP_003409566.1.47943 WP_003409566.1.47944 WP_003409566.1.47959 WP_003409566.1.47974 WP_003409566.1.47993 WP_003409566.1.48004 WP_003409566.1.48039 WP_003409566.1.48050 WP_003409566.1.48084 WP_003409566.1.48097 WP_003409566.1.48101 WP_003409566.1.48109 WP_003409566.1.4813 WP_003409566.1.48130 WP_003409566.1.48135 WP_003409566.1.48143 WP_003409566.1.48152 WP_003409566.1.48155 WP_003409566.1.48170 WP_003409566.1.48173 WP_003409566.1.48185 WP_003409566.1.48219 WP_003409566.1.4823 WP_003409566.1.48240 WP_003409566.1.48256 WP_003409566.1.48264 WP_003409566.1.48287 WP_003409566.1.48330 WP_003409566.1.48333 WP_003409566.1.48348 WP_003409566.1.48354 WP_003409566.1.48372 WP_003409566.1.48383 WP_003409566.1.48419 WP_003409566.1.48423 WP_003409566.1.48443 WP_003409566.1.48450 WP_003409566.1.48462 WP_003409566.1.48543 WP_003409566.1.48550 WP_003409566.1.48605 WP_003409566.1.48618 WP_003409566.1.4863 WP_003409566.1.48648 WP_003409566.1.48658 WP_003409566.1.48666 WP_003409566.1.48687 WP_003409566.1.48779 WP_003409566.1.4878 WP_003409566.1.48798 WP_003409566.1.48802 WP_003409566.1.48826 WP_003409566.1.48831 WP_003409566.1.48843 WP_003409566.1.48857 WP_003409566.1.4890 WP_003409566.1.48946 WP_003409566.1.48979 WP_003409566.1.49017 WP_003409566.1.49048 WP_003409566.1.49059 WP_003409566.1.4906 WP_003409566.1.4907 WP_003409566.1.49103 WP_003409566.1.49110 WP_003409566.1.49112 WP_003409566.1.4919 WP_003409566.1.49251 WP_003409566.1.49254 WP_003409566.1.49263 WP_003409566.1.49291 WP_003409566.1.49296 WP_003409566.1.49335 WP_003409566.1.49337 WP_003409566.1.49419 WP_003409566.1.49426 WP_003409566.1.49437 WP_003409566.1.49439 WP_003409566.1.49474 WP_003409566.1.49506 WP_003409566.1.49516 WP_003409566.1.49523 WP_003409566.1.49526 WP_003409566.1.49532 WP_003409566.1.49588 WP_003409566.1.4959 WP_003409566.1.49678 WP_003409566.1.49687 WP_003409566.1.49699 WP_003409566.1.49709 WP_003409566.1.4971 WP_003409566.1.4972 WP_003409566.1.49736 WP_003409566.1.49746 WP_003409566.1.49764 WP_003409566.1.49773 WP_003409566.1.49796 WP_003409566.1.49814 WP_003409566.1.49815 WP_003409566.1.49816 WP_003409566.1.49839 WP_003409566.1.49857 WP_003409566.1.49878 WP_003409566.1.49880 WP_003409566.1.49944 WP_003409566.1.4999 WP_003409566.1.49990 WP_003409566.1.50068 WP_003409566.1.50077 WP_003409566.1.5008 WP_003409566.1.50081 WP_003409566.1.50122 WP_003409566.1.50126 WP_003409566.1.50149 WP_003409566.1.50162 WP_003409566.1.5018 WP_003409566.1.50194 WP_003409566.1.50218 WP_003409566.1.50235 WP_003409566.1.50249 WP_003409566.1.50265 WP_003409566.1.50271 WP_003409566.1.50324 WP_003409566.1.50347 WP_003409566.1.50372 WP_003409566.1.50398 WP_003409566.1.50407 WP_003409566.1.50444 WP_003409566.1.50466 WP_003409566.1.50472 WP_003409566.1.5048 WP_003409566.1.50498 WP_003409566.1.5050 WP_003409566.1.50540 WP_003409566.1.50554 WP_003409566.1.50557 WP_003409566.1.50601 WP_003409566.1.50610 WP_003409566.1.50633 WP_003409566.1.50642 WP_003409566.1.50659 WP_003409566.1.50683 WP_003409566.1.50689 WP_003409566.1.50692 WP_003409566.1.50714 WP_003409566.1.50729 WP_003409566.1.50756 WP_003409566.1.50784 WP_003409566.1.50794 WP_003409566.1.50841 WP_003409566.1.50860 WP_003409566.1.50868 WP_003409566.1.50877 WP_003409566.1.5096 WP_003409566.1.50981 WP_003409566.1.50987 WP_003409566.1.51003 WP_003409566.1.51009 WP_003409566.1.51074 WP_003409566.1.51082 WP_003409566.1.51101 WP_003409566.1.51116 WP_003409566.1.51149 WP_003409566.1.51156 WP_003409566.1.51157 WP_003409566.1.51213 WP_003409566.1.51232 WP_003409566.1.51239 WP_003409566.1.51247 WP_003409566.1.51266 WP_003409566.1.51279 WP_003409566.1.51291 WP_003409566.1.51294 WP_003409566.1.51301 WP_003409566.1.51329 WP_003409566.1.51391 WP_003409566.1.51422 WP_003409566.1.51445 WP_003409566.1.51455 WP_003409566.1.51466 WP_003409566.1.51468 WP_003409566.1.51478 WP_003409566.1.51497 WP_003409566.1.51520 WP_003409566.1.51593 WP_003409566.1.51628 WP_003409566.1.5164 WP_003409566.1.51647 WP_003409566.1.51660 WP_003409566.1.51696 WP_003409566.1.51721 WP_003409566.1.51788 WP_003409566.1.51795 WP_003409566.1.51801 WP_003409566.1.51817 WP_003409566.1.51819 WP_003409566.1.51854 WP_003409566.1.51923 WP_003409566.1.51942 WP_003409566.1.51948 WP_003409566.1.51963 WP_003409566.1.51969 WP_003409566.1.52000 WP_003409566.1.52001 WP_003409566.1.52003 WP_003409566.1.52006 WP_003409566.1.52036 WP_003409566.1.52038 WP_003409566.1.52046 WP_003409566.1.52059 WP_003409566.1.52069 WP_003409566.1.52082 WP_003409566.1.52102 WP_003409566.1.52106 WP_003409566.1.52168 WP_003409566.1.52173 WP_003409566.1.52178 WP_003409566.1.52206 WP_003409566.1.52216 WP_003409566.1.52238 WP_003409566.1.52241 WP_003409566.1.52280 WP_003409566.1.52314 WP_003409566.1.52385 WP_003409566.1.52390 WP_003409566.1.524 WP_003409566.1.52460 WP_003409566.1.52485 WP_003409566.1.52486 WP_003409566.1.52495 WP_003409566.1.52504 WP_003409566.1.52522 WP_003409566.1.52531 WP_003409566.1.52533 WP_003409566.1.52545 WP_003409566.1.52553 WP_003409566.1.52563 WP_003409566.1.52564 WP_003409566.1.52574 WP_003409566.1.52641 WP_003409566.1.52673 WP_003409566.1.52674 WP_003409566.1.52708 WP_003409566.1.52713 WP_003409566.1.52761 WP_003409566.1.52791 WP_003409566.1.52797 WP_003409566.1.52818 WP_003409566.1.52872 WP_003409566.1.52873 WP_003409566.1.52891 WP_003409566.1.52892 WP_003409566.1.52909 WP_003409566.1.52970 WP_003409566.1.52998 WP_003409566.1.53053 WP_003409566.1.53056 WP_003409566.1.5306 WP_003409566.1.53088 WP_003409566.1.5309 WP_003409566.1.531 WP_003409566.1.53117 WP_003409566.1.53118 WP_003409566.1.53142 WP_003409566.1.53143 WP_003409566.1.53157 WP_003409566.1.53167 WP_003409566.1.53200 WP_003409566.1.53204 WP_003409566.1.53213 WP_003409566.1.53217 WP_003409566.1.53226 WP_003409566.1.53229 WP_003409566.1.53230 WP_003409566.1.53237 WP_003409566.1.53254 WP_003409566.1.53257 WP_003409566.1.5327 WP_003409566.1.53276 WP_003409566.1.53278 WP_003409566.1.533 WP_003409566.1.53302 WP_003409566.1.53306 WP_003409566.1.5334 WP_003409566.1.5335 WP_003409566.1.53353 WP_003409566.1.53381 WP_003409566.1.53413 WP_003409566.1.53458 WP_003409566.1.53460 WP_003409566.1.53480 WP_003409566.1.53517 WP_003409566.1.53522 WP_003409566.1.53525 WP_003409566.1.53526 WP_003409566.1.53553 WP_003409566.1.53606 WP_003409566.1.53609 WP_003409566.1.53628 WP_003409566.1.53643 WP_003409566.1.53667 WP_003409566.1.53715 WP_003409566.1.53742 WP_003409566.1.53743 WP_003409566.1.53754 WP_003409566.1.53775 WP_003409566.1.53787 WP_003409566.1.53803 WP_003409566.1.53818 WP_003409566.1.53822 WP_003409566.1.53853 WP_003409566.1.53865 WP_003409566.1.53888 WP_003409566.1.53912 WP_003409566.1.53914 WP_003409566.1.53952 WP_003409566.1.53973 WP_003409566.1.5398 WP_003409566.1.54089 WP_003409566.1.54093 WP_003409566.1.54099 WP_003409566.1.54112 WP_003409566.1.54125 WP_003409566.1.54141 WP_003409566.1.54162 WP_003409566.1.54179 WP_003409566.1.54218 WP_003409566.1.54225 WP_003409566.1.54227 WP_003409566.1.54232 WP_003409566.1.54241 WP_003409566.1.54245 WP_003409566.1.54247 WP_003409566.1.54260 WP_003409566.1.54275 WP_003409566.1.54280 WP_003409566.1.5429 WP_003409566.1.54294 WP_003409566.1.54314 WP_003409566.1.54347 WP_003409566.1.54351 WP_003409566.1.54370 WP_003409566.1.54428 WP_003409566.1.54449 WP_003409566.1.54494 WP_003409566.1.54502 WP_003409566.1.54514 WP_003409566.1.54519 WP_003409566.1.5452 WP_003409566.1.54537 WP_003409566.1.54553 WP_003409566.1.54555 WP_003409566.1.54575 WP_003409566.1.54633 WP_003409566.1.54686 WP_003409566.1.54687 WP_003409566.1.54705 WP_003409566.1.54730 WP_003409566.1.54732 WP_003409566.1.5475 WP_003409566.1.54797 WP_003409566.1.54807 WP_003409566.1.54836 WP_003409566.1.54838 WP_003409566.1.54860 WP_003409566.1.54888 WP_003409566.1.54905 WP_003409566.1.54909 WP_003409566.1.54937 WP_003409566.1.54939 WP_003409566.1.54944 WP_003409566.1.54945 WP_003409566.1.54953 WP_003409566.1.54964 WP_003409566.1.55015 WP_003409566.1.55022 WP_003409566.1.55023 WP_003409566.1.55051 WP_003409566.1.55072 WP_003409566.1.55088 WP_003409566.1.55106 WP_003409566.1.55126 WP_003409566.1.55128 WP_003409566.1.55140 WP_003409566.1.55210 WP_003409566.1.55227 WP_003409566.1.55248 WP_003409566.1.55257 WP_003409566.1.55258 WP_003409566.1.55267 WP_003409566.1.55279 WP_003409566.1.55307 WP_003409566.1.55326 WP_003409566.1.55328 WP_003409566.1.5533 WP_003409566.1.55345 WP_003409566.1.55396 WP_003409566.1.55398 WP_003409566.1.55441 WP_003409566.1.55459 WP_003409566.1.55501 WP_003409566.1.55504 WP_003409566.1.55578 WP_003409566.1.55626 WP_003409566.1.55641 WP_003409566.1.5569 WP_003409566.1.55723 WP_003409566.1.55735 WP_003409566.1.5574 WP_003409566.1.55772 WP_003409566.1.55802 WP_003409566.1.55807 WP_003409566.1.55819 WP_003409566.1.55821 WP_003409566.1.5583 WP_003409566.1.55849 WP_003409566.1.55856 WP_003409566.1.55860 WP_003409566.1.55882 WP_003409566.1.55883 WP_003409566.1.55894 WP_003409566.1.55902 WP_003409566.1.55908 WP_003409566.1.55909 WP_003409566.1.5591 WP_003409566.1.55961 WP_003409566.1.55977 WP_003409566.1.55983 WP_003409566.1.56028 WP_003409566.1.56057 WP_003409566.1.56060 WP_003409566.1.56107 WP_003409566.1.56132 WP_003409566.1.56163 WP_003409566.1.56167 WP_003409566.1.56178 WP_003409566.1.56287 WP_003409566.1.56292 WP_003409566.1.56327 WP_003409566.1.56341 WP_003409566.1.56359 WP_003409566.1.56394 WP_003409566.1.56443 WP_003409566.1.56473 WP_003409566.1.56478 WP_003409566.1.56500 WP_003409566.1.56517 WP_003409566.1.56534 WP_003409566.1.5656 WP_003409566.1.56577 WP_003409566.1.56593 WP_003409566.1.56625 WP_003409566.1.56637 WP_003409566.1.56670 WP_003409566.1.56697 WP_003409566.1.567 WP_003409566.1.56701 WP_003409566.1.56709 WP_003409566.1.56729 WP_003409566.1.56743 WP_003409566.1.56755 WP_003409566.1.56764 WP_003409566.1.56769 WP_003409566.1.56795 WP_003409566.1.5681 WP_003409566.1.56827 WP_003409566.1.56839 WP_003409566.1.56863 WP_003409566.1.56868 WP_003409566.1.56869 WP_003409566.1.56915 WP_003409566.1.56926 WP_003409566.1.56961 WP_003409566.1.56971 WP_003409566.1.56972 WP_003409566.1.57023 WP_003409566.1.57035 WP_003409566.1.57077 WP_003409566.1.57087 WP_003409566.1.57134 WP_003409566.1.57151 WP_003409566.1.57169 WP_003409566.1.57208 WP_003409566.1.57212 WP_003409566.1.57230 WP_003409566.1.5724 WP_003409566.1.5725 WP_003409566.1.5727 WP_003409566.1.57273 WP_003409566.1.573 WP_003409566.1.57314 WP_003409566.1.57326 WP_003409566.1.57328 WP_003409566.1.57331 WP_003409566.1.57340 WP_003409566.1.57351 WP_003409566.1.57352 WP_003409566.1.57380 WP_003409566.1.57430 WP_003409566.1.5744 WP_003409566.1.57440 WP_003409566.1.5745 WP_003409566.1.57461 WP_003409566.1.57469 WP_003409566.1.57489 WP_003409566.1.57509 WP_003409566.1.57519 WP_003409566.1.57525 WP_003409566.1.57551 WP_003409566.1.5758 WP_003409566.1.57596 WP_003409566.1.57604 WP_003409566.1.57616 WP_003409566.1.57617 WP_003409566.1.57619 WP_003409566.1.57627 WP_003409566.1.57642 WP_003409566.1.57658 WP_003409566.1.57667 WP_003409566.1.57675 WP_003409566.1.57689 WP_003409566.1.57708 WP_003409566.1.57794 WP_003409566.1.57821 WP_003409566.1.57825 WP_003409566.1.57843 WP_003409566.1.57906 WP_003409566.1.57924 WP_003409566.1.57926 WP_003409566.1.57930 WP_003409566.1.57957 WP_003409566.1.57960 WP_003409566.1.57964 WP_003409566.1.57991 WP_003409566.1.58000 WP_003409566.1.58086 WP_003409566.1.58101 WP_003409566.1.58103 WP_003409566.1.58108 WP_003409566.1.5811 WP_003409566.1.58121 WP_003409566.1.58145 WP_003409566.1.58164 WP_003409566.1.58174 WP_003409566.1.582 WP_003409566.1.58202 WP_003409566.1.58209 WP_003409566.1.58215 WP_003409566.1.5824 WP_003409566.1.58250 WP_003409566.1.58259 WP_003409566.1.58283 WP_003409566.1.58288 WP_003409566.1.5830 WP_003409566.1.58303 WP_003409566.1.58311 WP_003409566.1.58330 WP_003409566.1.58359 WP_003409566.1.58386 WP_003409566.1.58393 WP_003409566.1.58431 WP_003409566.1.5844 WP_003409566.1.58457 WP_003409566.1.58488 WP_003409566.1.58518 WP_003409566.1.58534 WP_003409566.1.58559 WP_003409566.1.58567 WP_003409566.1.58573 WP_003409566.1.58602 WP_003409566.1.58612 WP_003409566.1.58619 WP_003409566.1.58630 WP_003409566.1.5865 WP_003409566.1.58671 WP_003409566.1.58690 WP_003409566.1.58743 WP_003409566.1.58754 WP_003409566.1.5879 WP_003409566.1.5881 WP_003409566.1.58848 WP_003409566.1.58857 WP_003409566.1.58891 WP_003409566.1.58892 WP_003409566.1.5890 WP_003409566.1.58904 WP_003409566.1.58921 WP_003409566.1.58930 WP_003409566.1.58939 WP_003409566.1.58941 WP_003409566.1.58953 WP_003409566.1.58961 WP_003409566.1.5898 WP_003409566.1.59025 WP_003409566.1.59029 WP_003409566.1.59037 WP_003409566.1.59044 WP_003409566.1.59088 WP_003409566.1.59130 WP_003409566.1.5914 WP_003409566.1.59147 WP_003409566.1.59166 WP_003409566.1.59205 WP_003409566.1.59209 WP_003409566.1.59237 WP_003409566.1.59240 WP_003409566.1.59253 WP_003409566.1.59254 WP_003409566.1.59262 WP_003409566.1.59270 WP_003409566.1.5928 WP_003409566.1.59304 WP_003409566.1.59305 WP_003409566.1.59309 WP_003409566.1.59316 WP_003409566.1.59326 WP_003409566.1.59328 WP_003409566.1.59333 WP_003409566.1.59338 WP_003409566.1.59388 WP_003409566.1.59428 WP_003409566.1.59487 WP_003409566.1.59537 WP_003409566.1.59561 WP_003409566.1.59677 WP_003409566.1.59722 WP_003409566.1.59727 WP_003409566.1.59732 WP_003409566.1.59738 WP_003409566.1.59750 WP_003409566.1.59757 WP_003409566.1.59808 WP_003409566.1.59850 WP_003409566.1.59856 WP_003409566.1.59860 WP_003409566.1.59861 WP_003409566.1.5987 WP_003409566.1.59878 WP_003409566.1.59888 WP_003409566.1.5996 WP_003409566.1.59961 WP_003409566.1.59974 WP_003409566.1.6000 WP_003409566.1.60007 WP_003409566.1.60016 WP_003409566.1.6003 WP_003409566.1.60047 WP_003409566.1.6007 WP_003409566.1.60121 WP_003409566.1.60125 WP_003409566.1.60135 WP_003409566.1.60139 WP_003409566.1.60152 WP_003409566.1.60171 WP_003409566.1.60197 WP_003409566.1.6020 WP_003409566.1.60205 WP_003409566.1.60207 WP_003409566.1.60215 WP_003409566.1.60217 WP_003409566.1.60267 WP_003409566.1.60288 WP_003409566.1.60291 WP_003409566.1.60301 WP_003409566.1.60305 WP_003409566.1.60312 WP_003409566.1.60313 WP_003409566.1.60314 WP_003409566.1.60367 WP_003409566.1.60376 WP_003409566.1.60403 WP_003409566.1.60413 WP_003409566.1.60421 WP_003409566.1.60451 WP_003409566.1.60460 WP_003409566.1.60479 WP_003409566.1.60487 WP_003409566.1.60512 WP_003409566.1.60573 WP_003409566.1.60632 WP_003409566.1.60657 WP_003409566.1.60689 WP_003409566.1.60727 WP_003409566.1.60738 WP_003409566.1.60763 WP_003409566.1.6077 WP_003409566.1.60791 WP_003409566.1.60834 WP_003409566.1.60870 WP_003409566.1.60878 WP_003409566.1.60879 WP_003409566.1.60913 WP_003409566.1.60978 WP_003409566.1.61000 WP_003409566.1.61001 WP_003409566.1.61012 WP_003409566.1.61014 WP_003409566.1.61015 WP_003409566.1.61037 WP_003409566.1.61052 WP_003409566.1.61065 WP_003409566.1.61100 WP_003409566.1.61138 WP_003409566.1.61142 WP_003409566.1.61198 WP_003409566.1.612 WP_003409566.1.61234 WP_003409566.1.61256 WP_003409566.1.61281 WP_003409566.1.61314 WP_003409566.1.61321 WP_003409566.1.61326 WP_003409566.1.61328 WP_003409566.1.61368 WP_003409566.1.61391 WP_003409566.1.61406 WP_003409566.1.61420 WP_003409566.1.61422 WP_003409566.1.61425 WP_003409566.1.61428 WP_003409566.1.61469 WP_003409566.1.61494 WP_003409566.1.61522 WP_003409566.1.61552 WP_003409566.1.61557 WP_003409566.1.61567 WP_003409566.1.61571 WP_003409566.1.61573 WP_003409566.1.61584 WP_003409566.1.61586 WP_003409566.1.6159 WP_003409566.1.61592 WP_003409566.1.6160 WP_003409566.1.61614 WP_003409566.1.6163 WP_003409566.1.61655 WP_003409566.1.61665 WP_003409566.1.61669 WP_003409566.1.61682 WP_003409566.1.61692 WP_003409566.1.61719 WP_003409566.1.61728 WP_003409566.1.61750 WP_003409566.1.61754 WP_003409566.1.61755 WP_003409566.1.61757 WP_003409566.1.61778 WP_003409566.1.6179 WP_003409566.1.61793 WP_003409566.1.61816 WP_003409566.1.61842 WP_003409566.1.61850 WP_003409566.1.61862 WP_003409566.1.61868 WP_003409566.1.61911 WP_003409566.1.61925 WP_003409566.1.61941 WP_003409566.1.61953 WP_003409566.1.61979 WP_003409566.1.61986 WP_003409566.1.61998 WP_003409566.1.62021 WP_003409566.1.62087 WP_003409566.1.62089 WP_003409566.1.62101 WP_003409566.1.62104 WP_003409566.1.6211 WP_003409566.1.62132 WP_003409566.1.62162 WP_003409566.1.62225 WP_003409566.1.62238 WP_003409566.1.62249 WP_003409566.1.62270 WP_003409566.1.62281 WP_003409566.1.62307 WP_003409566.1.6231 WP_003409566.1.62359 WP_003409566.1.62360 WP_003409566.1.62371 WP_003409566.1.62379 WP_003409566.1.62395 WP_003409566.1.62408 WP_003409566.1.62449 WP_003409566.1.62468 WP_003409566.1.6248 WP_003409566.1.62508 WP_003409566.1.62565 WP_003409566.1.62594 WP_003409566.1.62606 WP_003409566.1.62616 WP_003409566.1.62666 WP_003409566.1.62687 WP_003409566.1.62715 WP_003409566.1.62730 WP_003409566.1.62738 WP_003409566.1.62761 WP_003409566.1.62786 WP_003409566.1.62813 WP_003409566.1.62839 WP_003409566.1.62841 WP_003409566.1.62909 WP_003409566.1.62936 WP_003409566.1.6294 WP_003409566.1.6295 WP_003409566.1.62962 WP_003409566.1.63007 WP_003409566.1.63019 WP_003409566.1.63032 WP_003409566.1.63037 WP_003409566.1.63064 WP_003409566.1.63072 WP_003409566.1.6308 WP_003409566.1.63081 WP_003409566.1.63096 WP_003409566.1.63106 WP_003409566.1.63144 WP_003409566.1.63154 WP_003409566.1.63160 WP_003409566.1.63161 WP_003409566.1.63166 WP_003409566.1.63175 WP_003409566.1.63194 WP_003409566.1.6322 WP_003409566.1.63222 WP_003409566.1.63247 WP_003409566.1.6328 WP_003409566.1.63291 WP_003409566.1.63312 WP_003409566.1.63317 WP_003409566.1.63331 WP_003409566.1.63373 WP_003409566.1.63384 WP_003409566.1.63403 WP_003409566.1.63424 WP_003409566.1.63428 WP_003409566.1.6345 WP_003409566.1.63464 WP_003409566.1.63483 WP_003409566.1.63502 WP_003409566.1.63504 WP_003409566.1.63522 WP_003409566.1.63530 WP_003409566.1.63538 WP_003409566.1.63564 WP_003409566.1.63567 WP_003409566.1.63596 WP_003409566.1.63600 WP_003409566.1.63623 WP_003409566.1.63624 WP_003409566.1.63625 WP_003409566.1.63627 WP_003409566.1.63654 WP_003409566.1.63662 WP_003409566.1.63711 WP_003409566.1.63734 WP_003409566.1.63807 WP_003409566.1.63819 WP_003409566.1.63844 WP_003409566.1.63888 WP_003409566.1.63913 WP_003409566.1.63915 WP_003409566.1.63918 WP_003409566.1.63961 WP_003409566.1.63970 WP_003409566.1.64000 WP_003409566.1.64027 WP_003409566.1.64058 WP_003409566.1.64065 WP_003409566.1.6407 WP_003409566.1.64082 WP_003409566.1.64091 WP_003409566.1.64102 WP_003409566.1.64104 WP_003409566.1.64119 WP_003409566.1.64169 WP_003409566.1.64219 WP_003409566.1.6422 WP_003409566.1.64222 WP_003409566.1.64223 WP_003409566.1.64228 WP_003409566.1.64235 WP_003409566.1.64249 WP_003409566.1.6427 WP_003409566.1.64278 WP_003409566.1.64414 WP_003409566.1.64419 WP_003409566.1.6443 WP_003409566.1.64463 WP_003409566.1.64480 WP_003409566.1.64497 WP_003409566.1.64506 WP_003409566.1.64511 WP_003409566.1.64513 WP_003409566.1.64514 WP_003409566.1.64515 WP_003409566.1.64522 WP_003409566.1.64543 WP_003409566.1.6456 WP_003409566.1.64567 WP_003409566.1.64588 WP_003409566.1.64589 WP_003409566.1.64594 WP_003409566.1.64595 WP_003409566.1.64608 WP_003409566.1.64619 WP_003409566.1.64629 WP_003409566.1.6464 WP_003409566.1.64664 WP_003409566.1.64669 WP_003409566.1.64672 WP_003409566.1.64680 WP_003409566.1.64682 WP_003409566.1.64727 WP_003409566.1.64774 WP_003409566.1.64776 WP_003409566.1.64802 WP_003409566.1.64832 WP_003409566.1.6486 WP_003409566.1.64870 WP_003409566.1.64898 WP_003409566.1.64922 WP_003409566.1.64924 WP_003409566.1.6493 WP_003409566.1.64937 WP_003409566.1.64941 WP_003409566.1.64966 WP_003409566.1.64973 WP_003409566.1.65001 WP_003409566.1.65026 WP_003409566.1.65053 WP_003409566.1.65070 WP_003409566.1.65079 WP_003409566.1.65102 WP_003409566.1.65157 WP_003409566.1.65181 WP_003409566.1.65212 WP_003409566.1.65229 WP_003409566.1.6523 WP_003409566.1.65253 WP_003409566.1.65289 WP_003409566.1.65291 WP_003409566.1.65315 WP_003409566.1.65329 WP_003409566.1.65359 WP_003409566.1.6536 WP_003409566.1.65374 WP_003409566.1.65386 WP_003409566.1.65414 WP_003409566.1.65416 WP_003409566.1.65433 WP_003409566.1.65455 WP_003409566.1.65467 WP_003409566.1.65488 WP_003409566.1.65529 WP_003409566.1.65583 WP_003409566.1.65612 WP_003409566.1.65623 WP_003409566.1.65635 WP_003409566.1.65637 WP_003409566.1.65648 WP_003409566.1.65683 WP_003409566.1.65686 WP_003409566.1.65688 WP_003409566.1.65707 WP_003409566.1.65733 WP_003409566.1.65746 WP_003409566.1.65747 WP_003409566.1.65759 WP_003409566.1.65816 WP_003409566.1.65830 WP_003409566.1.65858 WP_003409566.1.65862 WP_003409566.1.65869 WP_003409566.1.65893 WP_003409566.1.65929 WP_003409566.1.65932 WP_003409566.1.65958 WP_003409566.1.65974 WP_003409566.1.66004 WP_003409566.1.66013 WP_003409566.1.66089 WP_003409566.1.66149 WP_003409566.1.66151 WP_003409566.1.66229 WP_003409566.1.66276 WP_003409566.1.66293 WP_003409566.1.66297 WP_003409566.1.66323 WP_003409566.1.66325 WP_003409566.1.6633 WP_003409566.1.66334 WP_003409566.1.66355 WP_003409566.1.66367 WP_003409566.1.66394 WP_003409566.1.66396 WP_003409566.1.66451 WP_003409566.1.66455 WP_003409566.1.66457 WP_003409566.1.66460 WP_003409566.1.66464 WP_003409566.1.66466 WP_003409566.1.66487 WP_003409566.1.66504 WP_003409566.1.66544 WP_003409566.1.66558 WP_003409566.1.66580 WP_003409566.1.66582 WP_003409566.1.66612 WP_003409566.1.66615 WP_003409566.1.66617 WP_003409566.1.66635 WP_003409566.1.66656 WP_003409566.1.66663 WP_003409566.1.66675 WP_003409566.1.66715 WP_003409566.1.66718 WP_003409566.1.66762 WP_003409566.1.66776 WP_003409566.1.66808 WP_003409566.1.66817 WP_003409566.1.66819 WP_003409566.1.66826 WP_003409566.1.66830 WP_003409566.1.66842 WP_003409566.1.66878 WP_003409566.1.66880 WP_003409566.1.66893 WP_003409566.1.66961 WP_003409566.1.67005 WP_003409566.1.6704 WP_003409566.1.67044 WP_003409566.1.67061 WP_003409566.1.67089 WP_003409566.1.67098 WP_003409566.1.67146 WP_003409566.1.67170 WP_003409566.1.67197 WP_003409566.1.67198 WP_003409566.1.6720 WP_003409566.1.67207 WP_003409566.1.67218 WP_003409566.1.67220 WP_003409566.1.67225 WP_003409566.1.67231 WP_003409566.1.6724 WP_003409566.1.67257 WP_003409566.1.67298 WP_003409566.1.67307 WP_003409566.1.67324 WP_003409566.1.67332 WP_003409566.1.67346 WP_003409566.1.67354 WP_003409566.1.67360 WP_003409566.1.67381 WP_003409566.1.67396 WP_003409566.1.67417 WP_003409566.1.67422 WP_003409566.1.67453 WP_003409566.1.67459 WP_003409566.1.6746 WP_003409566.1.67473 WP_003409566.1.67481 WP_003409566.1.67482 WP_003409566.1.67496 WP_003409566.1.67499 WP_003409566.1.67516 WP_003409566.1.67523 WP_003409566.1.67536 WP_003409566.1.67575 WP_003409566.1.67587 WP_003409566.1.67598 WP_003409566.1.67600 WP_003409566.1.67602 WP_003409566.1.67630 WP_003409566.1.67679 WP_003409566.1.67692 WP_003409566.1.67744 WP_003409566.1.6775 WP_003409566.1.67750 WP_003409566.1.6777 WP_003409566.1.67809 WP_003409566.1.67816 WP_003409566.1.67844 WP_003409566.1.67848 WP_003409566.1.67870 WP_003409566.1.67888 WP_003409566.1.67915 WP_003409566.1.67945 WP_003409566.1.67949 WP_003409566.1.67980 WP_003409566.1.67982 WP_003409566.1.68022 WP_003409566.1.68029 WP_003409566.1.68037 WP_003409566.1.68038 WP_003409566.1.68045 WP_003409566.1.68057 WP_003409566.1.68083 WP_003409566.1.68088 WP_003409566.1.68106 WP_003409566.1.68110 WP_003409566.1.68153 WP_003409566.1.68164 WP_003409566.1.68169 WP_003409566.1.68193 WP_003409566.1.68212 WP_003409566.1.68227 WP_003409566.1.68243 WP_003409566.1.6825 WP_003409566.1.68297 WP_003409566.1.68309 WP_003409566.1.68325 WP_003409566.1.68329 WP_003409566.1.68340 WP_003409566.1.68384 WP_003409566.1.68388 WP_003409566.1.68429 WP_003409566.1.6843 WP_003409566.1.68433 WP_003409566.1.68444 WP_003409566.1.68465 WP_003409566.1.68484 WP_003409566.1.68518 WP_003409566.1.68569 WP_003409566.1.68576 WP_003409566.1.68580 WP_003409566.1.68586 WP_003409566.1.68623 WP_003409566.1.68637 WP_003409566.1.68646 WP_003409566.1.68667 WP_003409566.1.68669 WP_003409566.1.68672 WP_003409566.1.68684 WP_003409566.1.68704 WP_003409566.1.68708 WP_003409566.1.6872 WP_003409566.1.68730 WP_003409566.1.68734 WP_003409566.1.68748 WP_003409566.1.68754 WP_003409566.1.6876 WP_003409566.1.68761 WP_003409566.1.68763 WP_003409566.1.68766 WP_003409566.1.68774 WP_003409566.1.68796 WP_003409566.1.68824 WP_003409566.1.68832 WP_003409566.1.68833 WP_003409566.1.68841 WP_003409566.1.68859 WP_003409566.1.68876 WP_003409566.1.68906 WP_003409566.1.68945 WP_003409566.1.6896 WP_003409566.1.68981 WP_003409566.1.68984 WP_003409566.1.68997 WP_003409566.1.69008 WP_003409566.1.69076 WP_003409566.1.69079 WP_003409566.1.6908 WP_003409566.1.69082 WP_003409566.1.69178 WP_003409566.1.69181 WP_003409566.1.69208 WP_003409566.1.69231 WP_003409566.1.69256 WP_003409566.1.69311 WP_003409566.1.69315 WP_003409566.1.69322 WP_003409566.1.69342 WP_003409566.1.6935 WP_003409566.1.6936 WP_003409566.1.69369 WP_003409566.1.69374 WP_003409566.1.69398 WP_003409566.1.69401 WP_003409566.1.69426 WP_003409566.1.69427 WP_003409566.1.69429 WP_003409566.1.6949 WP_003409566.1.6951 WP_003409566.1.69511 WP_003409566.1.69526 WP_003409566.1.69547 WP_003409566.1.69573 WP_003409566.1.69581 WP_003409566.1.6960 WP_003409566.1.69617 WP_003409566.1.69634 WP_003409566.1.69659 WP_003409566.1.69673 WP_003409566.1.69682 WP_003409566.1.69684 WP_003409566.1.69686 WP_003409566.1.69707 WP_003409566.1.69709 WP_003409566.1.69723 WP_003409566.1.69736 WP_003409566.1.69778 WP_003409566.1.69800 WP_003409566.1.69802 WP_003409566.1.69845 WP_003409566.1.69870 WP_003409566.1.69873 WP_003409566.1.69898 WP_003409566.1.69913 WP_003409566.1.69925 WP_003409566.1.69931 WP_003409566.1.69938 WP_003409566.1.69955 WP_003409566.1.69957 WP_003409566.1.69981 WP_003409566.1.69990 WP_003409566.1.70 WP_003409566.1.70000 WP_003409566.1.70017 WP_003409566.1.70032 WP_003409566.1.70055 WP_003409566.1.70062 WP_003409566.1.70072 WP_003409566.1.70131 WP_003409566.1.70132 WP_003409566.1.7022 WP_003409566.1.70227 WP_003409566.1.70255 WP_003409566.1.70271 WP_003409566.1.70274 WP_003409566.1.7029 WP_003409566.1.70325 WP_003409566.1.70328 WP_003409566.1.70356 WP_003409566.1.70364 WP_003409566.1.70368 WP_003409566.1.70369 WP_003409566.1.70418 WP_003409566.1.70422 WP_003409566.1.70435 WP_003409566.1.70444 WP_003409566.1.70463 WP_003409566.1.70471 WP_003409566.1.70480 WP_003409566.1.70494 WP_003409566.1.70498 WP_003409566.1.70505 WP_003409566.1.70525 WP_003409566.1.70573 WP_003409566.1.70577 WP_003409566.1.70610 WP_003409566.1.70615 WP_003409566.1.70618 WP_003409566.1.70622 WP_003409566.1.70626 WP_003409566.1.70668 WP_003409566.1.70699 WP_003409566.1.70704 WP_003409566.1.70729 WP_003409566.1.70757 WP_003409566.1.70782 WP_003409566.1.70796 WP_003409566.1.70830 WP_003409566.1.70834 WP_003409566.1.7084 WP_003409566.1.70840 WP_003409566.1.70864 WP_003409566.1.70871 WP_003409566.1.70915 WP_003409566.1.70955 WP_003409566.1.70958 WP_003409566.1.70964 WP_003409566.1.70976 WP_003409566.1.71015 WP_003409566.1.71026 WP_003409566.1.71063 WP_003409566.1.71076 WP_003409566.1.71083 WP_003409566.1.7111 WP_003409566.1.71118 WP_003409566.1.71128 WP_003409566.1.7113 WP_003409566.1.71187 WP_003409566.1.71191 WP_003409566.1.71255 WP_003409566.1.71258 WP_003409566.1.71259 WP_003409566.1.71289 WP_003409566.1.71326 WP_003409566.1.71329 WP_003409566.1.71331 WP_003409566.1.71344 WP_003409566.1.71390 WP_003409566.1.71414 WP_003409566.1.71440 WP_003409566.1.71457 WP_003409566.1.7146 WP_003409566.1.71464 WP_003409566.1.71490 WP_003409566.1.71492 WP_003409566.1.71509 WP_003409566.1.71516 WP_003409566.1.71517 WP_003409566.1.71527 WP_003409566.1.71532 WP_003409566.1.71545 WP_003409566.1.71546 WP_003409566.1.71569 WP_003409566.1.71604 WP_003409566.1.71621 WP_003409566.1.71630 WP_003409566.1.71638 WP_003409566.1.71654 WP_003409566.1.71664 WP_003409566.1.71665 WP_003409566.1.71683 WP_003409566.1.71718 WP_003409566.1.71731 WP_003409566.1.71778 WP_003409566.1.71781 WP_003409566.1.71803 WP_003409566.1.71820 WP_003409566.1.71847 WP_003409566.1.7185 WP_003409566.1.71851 WP_003409566.1.71871 WP_003409566.1.71909 WP_003409566.1.71957 WP_003409566.1.71970 WP_003409566.1.72047 WP_003409566.1.72061 WP_003409566.1.72062 WP_003409566.1.72072 WP_003409566.1.72111 WP_003409566.1.72122 WP_003409566.1.72128 WP_003409566.1.7216 WP_003409566.1.72168 WP_003409566.1.72179 WP_003409566.1.72209 WP_003409566.1.72218 WP_003409566.1.72219 WP_003409566.1.72227 WP_003409566.1.7224 WP_003409566.1.72268 WP_003409566.1.72332 WP_003409566.1.72380 WP_003409566.1.72401 WP_003409566.1.72405 WP_003409566.1.72420 WP_003409566.1.72441 WP_003409566.1.72451 WP_003409566.1.72452 WP_003409566.1.72457 WP_003409566.1.72459 WP_003409566.1.72460 WP_003409566.1.72466 WP_003409566.1.72487 WP_003409566.1.72488 WP_003409566.1.72492 WP_003409566.1.72506 WP_003409566.1.72543 WP_003409566.1.7256 WP_003409566.1.72576 WP_003409566.1.72578 WP_003409566.1.72585 WP_003409566.1.72591 WP_003409566.1.72592 WP_003409566.1.72640 WP_003409566.1.7266 WP_003409566.1.72661 WP_003409566.1.72684 WP_003409566.1.72739 WP_003409566.1.72744 WP_003409566.1.72755 WP_003409566.1.72759 WP_003409566.1.72784 WP_003409566.1.72792 WP_003409566.1.72826 WP_003409566.1.72831 WP_003409566.1.72852 WP_003409566.1.72853 WP_003409566.1.72879 WP_003409566.1.72880 WP_003409566.1.72938 WP_003409566.1.72954 WP_003409566.1.72957 WP_003409566.1.72959 WP_003409566.1.72973 WP_003409566.1.7298 WP_003409566.1.72988 WP_003409566.1.72993 WP_003409566.1.73006 WP_003409566.1.73013 WP_003409566.1.73025 WP_003409566.1.73028 WP_003409566.1.73042 WP_003409566.1.73045 WP_003409566.1.73092 WP_003409566.1.73118 WP_003409566.1.7312 WP_003409566.1.73127 WP_003409566.1.73134 WP_003409566.1.73150 WP_003409566.1.73154 WP_003409566.1.73163 WP_003409566.1.73182 WP_003409566.1.73205 WP_003409566.1.7321 WP_003409566.1.73310 WP_003409566.1.73365 WP_003409566.1.73391 WP_003409566.1.73404 WP_003409566.1.73424 WP_003409566.1.73436 WP_003409566.1.73445 WP_003409566.1.73453 WP_003409566.1.73465 WP_003409566.1.73466 WP_003409566.1.73470 WP_003409566.1.73471 WP_003409566.1.73478 WP_003409566.1.73482 WP_003409566.1.73507 WP_003409566.1.73532 WP_003409566.1.73550 WP_003409566.1.73564 WP_003409566.1.73623 WP_003409566.1.73629 WP_003409566.1.73644 WP_003409566.1.7366 WP_003409566.1.73661 WP_003409566.1.7368 WP_003409566.1.73688 WP_003409566.1.73723 WP_003409566.1.73744 WP_003409566.1.73750 WP_003409566.1.73760 WP_003409566.1.73774 WP_003409566.1.7379 WP_003409566.1.73813 WP_003409566.1.73840 WP_003409566.1.73876 WP_003409566.1.7389 WP_003409566.1.73986 WP_003409566.1.74016 WP_003409566.1.74039 WP_003409566.1.74083 WP_003409566.1.74101 WP_003409566.1.74107 WP_003409566.1.74120 WP_003409566.1.74129 WP_003409566.1.74144 WP_003409566.1.7417 WP_003409566.1.74190 WP_003409566.1.74210 WP_003409566.1.7423 WP_003409566.1.74259 WP_003409566.1.74262 WP_003409566.1.74269 WP_003409566.1.74282 WP_003409566.1.74291 WP_003409566.1.74296 WP_003409566.1.74304 WP_003409566.1.7432 WP_003409566.1.74347 WP_003409566.1.7436 WP_003409566.1.74378 WP_003409566.1.74382 WP_003409566.1.74395 WP_003409566.1.74400 WP_003409566.1.74401 WP_003409566.1.74432 WP_003409566.1.74442 WP_003409566.1.74477 WP_003409566.1.74487 WP_003409566.1.74499 WP_003409566.1.74504 WP_003409566.1.74511 WP_003409566.1.74523 WP_003409566.1.74525 WP_003409566.1.74551 WP_003409566.1.74555 WP_003409566.1.74628 WP_003409566.1.74641 WP_003409566.1.74653 WP_003409566.1.74660 WP_003409566.1.74683 WP_003409566.1.7469 WP_003409566.1.74725 WP_003409566.1.74760 WP_003409566.1.74786 WP_003409566.1.74809 WP_003409566.1.74820 WP_003409566.1.74870 WP_003409566.1.74881 WP_003409566.1.74888 WP_003409566.1.74952 WP_003409566.1.7496 WP_003409566.1.74988 WP_003409566.1.75043 WP_003409566.1.75045 WP_003409566.1.75055 WP_003409566.1.75078 WP_003409566.1.75081 WP_003409566.1.75120 WP_003409566.1.75163 WP_003409566.1.75200 WP_003409566.1.75202 WP_003409566.1.75234 WP_003409566.1.75239 WP_003409566.1.75250 WP_003409566.1.75263 WP_003409566.1.75281 WP_003409566.1.75342 WP_003409566.1.7535 WP_003409566.1.75376 WP_003409566.1.75391 WP_003409566.1.75395 WP_003409566.1.75441 WP_003409566.1.75510 WP_003409566.1.75581 WP_003409566.1.75598 WP_003409566.1.75635 WP_003409566.1.75645 WP_003409566.1.75665 WP_003409566.1.75671 WP_003409566.1.75741 WP_003409566.1.75749 WP_003409566.1.75772 WP_003409566.1.75774 WP_003409566.1.75811 WP_003409566.1.75833 WP_003409566.1.7585 WP_003409566.1.75868 WP_003409566.1.75878 WP_003409566.1.75927 WP_003409566.1.75946 WP_003409566.1.75968 WP_003409566.1.75974 WP_003409566.1.76007 WP_003409566.1.76016 WP_003409566.1.76032 WP_003409566.1.76037 WP_003409566.1.7604 WP_003409566.1.76045 WP_003409566.1.76052 WP_003409566.1.76058 WP_003409566.1.76064 WP_003409566.1.76110 WP_003409566.1.76126 WP_003409566.1.76133 WP_003409566.1.76138 WP_003409566.1.76157 WP_003409566.1.76172 WP_003409566.1.76177 WP_003409566.1.76183 WP_003409566.1.76209 WP_003409566.1.76239 WP_003409566.1.76277 WP_003409566.1.76280 WP_003409566.1.76281 WP_003409566.1.76291 WP_003409566.1.76297 WP_003409566.1.76360 WP_003409566.1.76379 WP_003409566.1.76403 WP_003409566.1.76413 WP_003409566.1.76414 WP_003409566.1.76427 WP_003409566.1.76436 WP_003409566.1.76442 WP_003409566.1.76443 WP_003409566.1.76456 WP_003409566.1.76521 WP_003409566.1.76533 WP_003409566.1.76616 WP_003409566.1.76625 WP_003409566.1.76629 WP_003409566.1.76635 WP_003409566.1.76638 WP_003409566.1.76639 WP_003409566.1.76640 WP_003409566.1.76644 WP_003409566.1.76677 WP_003409566.1.76678 WP_003409566.1.76679 WP_003409566.1.76734 WP_003409566.1.76744 WP_003409566.1.76750 WP_003409566.1.76754 WP_003409566.1.76757 WP_003409566.1.76781 WP_003409566.1.76818 WP_003409566.1.76835 WP_003409566.1.76873 WP_003409566.1.76881 WP_003409566.1.76888 WP_003409566.1.76900 WP_003409566.1.7691 WP_003409566.1.76947 WP_003409566.1.76954 WP_003409566.1.76955 WP_003409566.1.76963 WP_003409566.1.76976 WP_003409566.1.770 WP_003409566.1.77000 WP_003409566.1.77008 WP_003409566.1.77021 WP_003409566.1.77056 WP_003409566.1.77065 WP_003409566.1.77075 WP_003409566.1.77093 WP_003409566.1.77107 WP_003409566.1.77115 WP_003409566.1.77118 WP_003409566.1.77125 WP_003409566.1.77141 WP_003409566.1.77142 WP_003409566.1.77166 WP_003409566.1.77250 WP_003409566.1.77252 WP_003409566.1.77260 WP_003409566.1.77266 WP_003409566.1.77285 WP_003409566.1.77312 WP_003409566.1.77348 WP_003409566.1.77351 WP_003409566.1.77352 WP_003409566.1.77361 WP_003409566.1.774 WP_003409566.1.7740 WP_003409566.1.77404 WP_003409566.1.77425 WP_003409566.1.77463 WP_003409566.1.77474 WP_003409566.1.7748 WP_003409566.1.77491 WP_003409566.1.77499 WP_003409566.1.77510 WP_003409566.1.77530 WP_003409566.1.77554 WP_003409566.1.77559 WP_003409566.1.77599 WP_003409566.1.77605 WP_003409566.1.7762 WP_003409566.1.77627 WP_003409566.1.77649 WP_003409566.1.77654 WP_003409566.1.7766 WP_003409566.1.77667 WP_003409566.1.77704 WP_003409566.1.77706 WP_003409566.1.77726 WP_003409566.1.77774 WP_003409566.1.7778 WP_003409566.1.77790 WP_003409566.1.77809 WP_003409566.1.77820 WP_003409566.1.77843 WP_003409566.1.77855 WP_003409566.1.77865 WP_003409566.1.77868 WP_003409566.1.77879 WP_003409566.1.77890 WP_003409566.1.77909 WP_003409566.1.77911 WP_003409566.1.77931 WP_003409566.1.77984 WP_003409566.1.78020 WP_003409566.1.78024 WP_003409566.1.78084 WP_003409566.1.78086 WP_003409566.1.7809 WP_003409566.1.78098 WP_003409566.1.78105 WP_003409566.1.78113 WP_003409566.1.78136 WP_003409566.1.78162 WP_003409566.1.7817 WP_003409566.1.78200 WP_003409566.1.78216 WP_003409566.1.78236 WP_003409566.1.78238 WP_003409566.1.78322 WP_003409566.1.78338 WP_003409566.1.7836 WP_003409566.1.78360 WP_003409566.1.78386 WP_003409566.1.78429 WP_003409566.1.78435 WP_003409566.1.7844 WP_003409566.1.78459 WP_003409566.1.78488 WP_003409566.1.7849 WP_003409566.1.78499 WP_003409566.1.785 WP_003409566.1.78516 WP_003409566.1.78524 WP_003409566.1.78538 WP_003409566.1.78544 WP_003409566.1.78545 WP_003409566.1.78547 WP_003409566.1.78574 WP_003409566.1.78580 WP_003409566.1.7860 WP_003409566.1.78620 WP_003409566.1.78646 WP_003409566.1.78648 WP_003409566.1.78655 WP_003409566.1.78657 WP_003409566.1.78659 WP_003409566.1.7869 WP_003409566.1.78692 WP_003409566.1.78760 WP_003409566.1.78776 WP_003409566.1.78778 WP_003409566.1.78784 WP_003409566.1.78788 WP_003409566.1.78790 WP_003409566.1.78793 WP_003409566.1.78848 WP_003409566.1.78860 WP_003409566.1.7887 WP_003409566.1.78884 WP_003409566.1.78932 WP_003409566.1.78969 WP_003409566.1.78977 WP_003409566.1.78980 WP_003409566.1.79005 WP_003409566.1.79016 WP_003409566.1.79033 WP_003409566.1.79064 WP_003409566.1.79066 WP_003409566.1.79068 WP_003409566.1.79077 WP_003409566.1.79095 WP_003409566.1.79112 WP_003409566.1.79122 WP_003409566.1.79145 WP_003409566.1.79152 WP_003409566.1.79163 WP_003409566.1.79182 WP_003409566.1.79198 WP_003409566.1.79213 WP_003409566.1.79218 WP_003409566.1.79268 WP_003409566.1.79273 WP_003409566.1.79278 WP_003409566.1.79290 WP_003409566.1.79319 WP_003409566.1.79325 WP_003409566.1.79326 WP_003409566.1.7933 WP_003409566.1.79330 WP_003409566.1.79339 WP_003409566.1.79394 WP_003409566.1.79399 WP_003409566.1.79413 WP_003409566.1.79422 WP_003409566.1.79445 WP_003409566.1.79447 WP_003409566.1.79455 WP_003409566.1.79471 WP_003409566.1.79480 WP_003409566.1.79482 WP_003409566.1.79488 WP_003409566.1.79502 WP_003409566.1.79508 WP_003409566.1.79514 WP_003409566.1.79561 WP_003409566.1.79565 WP_003409566.1.79578 WP_003409566.1.79588 WP_003409566.1.79598 WP_003409566.1.79615 WP_003409566.1.79684 WP_003409566.1.79698 WP_003409566.1.797 WP_003409566.1.79744 WP_003409566.1.79784 WP_003409566.1.79802 WP_003409566.1.79806 WP_003409566.1.79819 WP_003409566.1.79826 WP_003409566.1.79828 WP_003409566.1.79851 WP_003409566.1.79853 WP_003409566.1.79863 WP_003409566.1.79881 WP_003409566.1.79885 WP_003409566.1.79898 WP_003409566.1.7990 WP_003409566.1.79900 WP_003409566.1.79913 WP_003409566.1.79918 WP_003409566.1.79947 WP_003409566.1.79948 WP_003409566.1.7995 WP_003409566.1.7997 WP_003409566.1.80004 WP_003409566.1.80015 WP_003409566.1.80022 WP_003409566.1.80030 WP_003409566.1.80054 WP_003409566.1.80084 WP_003409566.1.80099 WP_003409566.1.80129 WP_003409566.1.80177 WP_003409566.1.80234 WP_003409566.1.8026 WP_003409566.1.80275 WP_003409566.1.8029 WP_003409566.1.80299 WP_003409566.1.80300 WP_003409566.1.80304 WP_003409566.1.80326 WP_003409566.1.80351 WP_003409566.1.8037 WP_003409566.1.80370 WP_003409566.1.80387 WP_003409566.1.80399 WP_003409566.1.8044 WP_003409566.1.80451 WP_003409566.1.80458 WP_003409566.1.80461 WP_003409566.1.80490 WP_003409566.1.80503 WP_003409566.1.80507 WP_003409566.1.80552 WP_003409566.1.80576 WP_003409566.1.80588 WP_003409566.1.80599 WP_003409566.1.8060 WP_003409566.1.80624 WP_003409566.1.80636 WP_003409566.1.80673 WP_003409566.1.80711 WP_003409566.1.80714 WP_003409566.1.80743 WP_003409566.1.80784 WP_003409566.1.80815 WP_003409566.1.80853 WP_003409566.1.80918 WP_003409566.1.8093 WP_003409566.1.80967 WP_003409566.1.8097 WP_003409566.1.80988 WP_003409566.1.81007 WP_003409566.1.81013 WP_003409566.1.8105 WP_003409566.1.81059 WP_003409566.1.81063 WP_003409566.1.81066 WP_003409566.1.81075 WP_003409566.1.81091 WP_003409566.1.81119 WP_003409566.1.81125 WP_003409566.1.81136 WP_003409566.1.8114 WP_003409566.1.81189 WP_003409566.1.81192 WP_003409566.1.812 WP_003409566.1.81230 WP_003409566.1.81249 WP_003409566.1.81250 WP_003409566.1.81264 WP_003409566.1.8128 WP_003409566.1.81287 WP_003409566.1.81297 WP_003409566.1.8138 WP_003409566.1.81407 WP_003409566.1.8143 WP_003409566.1.81439 WP_003409566.1.81465 WP_003409566.1.81505 WP_003409566.1.81529 WP_003409566.1.81538 WP_003409566.1.81541 WP_003409566.1.81560 WP_003409566.1.81561 WP_003409566.1.81567 WP_003409566.1.81583 WP_003409566.1.81686 WP_003409566.1.81712 WP_003409566.1.81720 WP_003409566.1.81731 WP_003409566.1.81774 WP_003409566.1.81788 WP_003409566.1.81820 WP_003409566.1.81850 WP_003409566.1.81883 WP_003409566.1.81891 WP_003409566.1.81911 WP_003409566.1.81918 WP_003409566.1.82011 WP_003409566.1.82048 WP_003409566.1.82069 WP_003409566.1.82071 WP_003409566.1.82108 WP_003409566.1.82136 WP_003409566.1.82142 WP_003409566.1.8215 WP_003409566.1.82158 WP_003409566.1.8217 WP_003409566.1.82209 WP_003409566.1.82210 WP_003409566.1.82228 WP_003409566.1.82236 WP_003409566.1.82251 WP_003409566.1.82271 WP_003409566.1.82305 WP_003409566.1.82307 WP_003409566.1.82309 WP_003409566.1.82317 WP_003409566.1.8232 WP_003409566.1.82346 WP_003409566.1.82374 WP_003409566.1.82385 WP_003409566.1.82429 WP_003409566.1.82460 WP_003409566.1.82462 WP_003409566.1.82483 WP_003409566.1.82494 WP_003409566.1.82531 WP_003409566.1.82546 WP_003409566.1.82549 WP_003409566.1.82577 WP_003409566.1.82592 WP_003409566.1.82597 WP_003409566.1.82598 WP_003409566.1.82625 WP_003409566.1.82642 WP_003409566.1.82651 WP_003409566.1.82653 WP_003409566.1.82681 WP_003409566.1.82685 WP_003409566.1.8271 WP_003409566.1.82712 WP_003409566.1.8273 WP_003409566.1.82743 WP_003409566.1.82757 WP_003409566.1.82774 WP_003409566.1.82803 WP_003409566.1.82836 WP_003409566.1.82860 WP_003409566.1.82871 WP_003409566.1.82892 WP_003409566.1.82935 WP_003409566.1.82957 WP_003409566.1.82973 WP_003409566.1.82981 WP_003409566.1.82983 WP_003409566.1.83004 WP_003409566.1.83009 WP_003409566.1.83044 WP_003409566.1.83065 WP_003409566.1.83074 WP_003409566.1.83110 WP_003409566.1.83146 WP_003409566.1.83149 WP_003409566.1.83159 WP_003409566.1.8317 WP_003409566.1.83181 WP_003409566.1.83182 WP_003409566.1.83191 WP_003409566.1.83197 WP_003409566.1.83212 WP_003409566.1.8326 WP_003409566.1.83262 WP_003409566.1.83268 WP_003409566.1.83273 WP_003409566.1.83309 WP_003409566.1.83332 WP_003409566.1.83334 WP_003409566.1.83341 WP_003409566.1.83349 WP_003409566.1.8335 WP_003409566.1.83353 WP_003409566.1.83367 WP_003409566.1.83380 WP_003409566.1.83381 WP_003409566.1.83389 WP_003409566.1.83408 WP_003409566.1.83409 WP_003409566.1.83435 WP_003409566.1.83470 WP_003409566.1.83524 WP_003409566.1.83526 WP_003409566.1.8358 WP_003409566.1.83589 WP_003409566.1.83601 WP_003409566.1.83611 WP_003409566.1.83638 WP_003409566.1.83648 WP_003409566.1.83656 WP_003409566.1.83667 WP_003409566.1.83689 WP_003409566.1.83692 WP_003409566.1.83704 WP_003409566.1.83766 WP_003409566.1.83793 WP_003409566.1.83794 WP_003409566.1.83802 WP_003409566.1.83805 WP_003409566.1.83839 WP_003409566.1.83842 WP_003409566.1.83850 WP_003409566.1.83861 WP_003409566.1.83884 WP_003409566.1.83920 WP_003409566.1.83929 WP_003409566.1.83930 WP_003409566.1.83975 WP_003409566.1.83991 WP_003409566.1.8400 WP_003409566.1.84027 WP_003409566.1.8404 WP_003409566.1.84057 WP_003409566.1.84070 WP_003409566.1.8409 WP_003409566.1.84112 WP_003409566.1.84146 WP_003409566.1.8415 WP_003409566.1.84176 WP_003409566.1.84186 WP_003409566.1.84192 WP_003409566.1.84228 WP_003409566.1.8424 WP_003409566.1.84244 WP_003409566.1.84259 WP_003409566.1.8426 WP_003409566.1.84277 WP_003409566.1.84287 WP_003409566.1.8434 WP_003409566.1.84388 WP_003409566.1.84408 WP_003409566.1.84409 WP_003409566.1.84438 WP_003409566.1.84460 WP_003409566.1.84488 WP_003409566.1.84504 WP_003409566.1.84525 WP_003409566.1.84620 WP_003409566.1.84623 WP_003409566.1.84641 WP_003409566.1.84655 WP_003409566.1.84666 WP_003409566.1.84670 WP_003409566.1.84739 WP_003409566.1.84748 WP_003409566.1.84766 WP_003409566.1.84774 WP_003409566.1.848 WP_003409566.1.84812 WP_003409566.1.84836 WP_003409566.1.84839 WP_003409566.1.84846 WP_003409566.1.84873 WP_003409566.1.84911 WP_003409566.1.84938 WP_003409566.1.84968 WP_003409566.1.84973 WP_003409566.1.84981 WP_003409566.1.84985 WP_003409566.1.8503 WP_003409566.1.85038 WP_003409566.1.85041 WP_003409566.1.85043 WP_003409566.1.8505 WP_003409566.1.85074 WP_003409566.1.8509 WP_003409566.1.8512 WP_003409566.1.85148 WP_003409566.1.8518 WP_003409566.1.8522 WP_003409566.1.85242 WP_003409566.1.85276 WP_003409566.1.85281 WP_003409566.1.85284 WP_003409566.1.85314 WP_003409566.1.85319 WP_003409566.1.85330 WP_003409566.1.85341 WP_003409566.1.85346 WP_003409566.1.8535 WP_003409566.1.85363 WP_003409566.1.85371 WP_003409566.1.85377 WP_003409566.1.85387 WP_003409566.1.85399 WP_003409566.1.85458 WP_003409566.1.8546 WP_003409566.1.85464 WP_003409566.1.85478 WP_003409566.1.85480 WP_003409566.1.85488 WP_003409566.1.85495 WP_003409566.1.85551 WP_003409566.1.85557 WP_003409566.1.85577 WP_003409566.1.85597 WP_003409566.1.85599 WP_003409566.1.85610 WP_003409566.1.8563 WP_003409566.1.85648 WP_003409566.1.85679 WP_003409566.1.85704 WP_003409566.1.85727 WP_003409566.1.85737 WP_003409566.1.85763 WP_003409566.1.85808 WP_003409566.1.85819 WP_003409566.1.85820 WP_003409566.1.85823 WP_003409566.1.85832 WP_003409566.1.8586 WP_003409566.1.85872 WP_003409566.1.85894 WP_003409566.1.85913 WP_003409566.1.85953 WP_003409566.1.85986 WP_003409566.1.86000 WP_003409566.1.86024 WP_003409566.1.86025 WP_003409566.1.86032 WP_003409566.1.86048 WP_003409566.1.86052 WP_003409566.1.86067 WP_003409566.1.86103 WP_003409566.1.86122 WP_003409566.1.86124 WP_003409566.1.86160 WP_003409566.1.86164 WP_003409566.1.86168 WP_003409566.1.86190 WP_003409566.1.86204 WP_003409566.1.86208 WP_003409566.1.86235 WP_003409566.1.86249 WP_003409566.1.86260 WP_003409566.1.86290 WP_003409566.1.863 WP_003409566.1.86327 WP_003409566.1.86334 WP_003409566.1.86337 WP_003409566.1.86368 WP_003409566.1.86377 WP_003409566.1.86425 WP_003409566.1.86459 WP_003409566.1.8649 WP_003409566.1.86499 WP_003409566.1.86520 WP_003409566.1.86568 WP_003409566.1.86575 WP_003409566.1.86584 WP_003409566.1.86605 WP_003409566.1.86626 WP_003409566.1.86648 WP_003409566.1.8666 WP_003409566.1.86684 WP_003409566.1.86696 WP_003409566.1.86718 WP_003409566.1.86725 WP_003409566.1.86757 WP_003409566.1.86766 WP_003409566.1.86801 WP_003409566.1.86814 WP_003409566.1.86820 WP_003409566.1.86825 WP_003409566.1.86834 WP_003409566.1.8685 WP_003409566.1.86851 WP_003409566.1.86855 WP_003409566.1.86867 WP_003409566.1.86877 WP_003409566.1.86883 WP_003409566.1.8689 WP_003409566.1.86892 WP_003409566.1.86933 WP_003409566.1.86941 WP_003409566.1.86950 WP_003409566.1.86962 WP_003409566.1.86979 WP_003409566.1.8700 WP_003409566.1.87001 WP_003409566.1.87002 WP_003409566.1.87031 WP_003409566.1.87116 WP_003409566.1.87117 WP_003409566.1.8714 WP_003409566.1.87162 WP_003409566.1.87178 WP_003409566.1.87191 WP_003409566.1.87201 WP_003409566.1.87209 WP_003409566.1.87240 WP_003409566.1.87266 WP_003409566.1.87273 WP_003409566.1.87275 WP_003409566.1.8733 WP_003409566.1.87345 WP_003409566.1.87369 WP_003409566.1.8737 WP_003409566.1.87401 WP_003409566.1.87404 WP_003409566.1.87406 WP_003409566.1.87409 WP_003409566.1.87444 WP_003409566.1.87446 WP_003409566.1.87459 WP_003409566.1.87472 WP_003409566.1.87489 WP_003409566.1.87494 WP_003409566.1.87496 WP_003409566.1.87582 WP_003409566.1.87588 WP_003409566.1.87617 WP_003409566.1.87619 WP_003409566.1.87620 WP_003409566.1.87643 WP_003409566.1.87650 WP_003409566.1.87654 WP_003409566.1.87658 WP_003409566.1.87665 WP_003409566.1.87676 WP_003409566.1.87677 WP_003409566.1.87684 WP_003409566.1.87692 WP_003409566.1.87707 WP_003409566.1.87732 WP_003409566.1.87784 WP_003409566.1.87796 WP_003409566.1.87809 WP_003409566.1.87817 WP_003409566.1.87827 WP_003409566.1.87831 WP_003409566.1.87835 WP_003409566.1.87837 WP_003409566.1.87866 WP_003409566.1.8789 WP_003409566.1.87911 WP_003409566.1.87924 WP_003409566.1.87951 WP_003409566.1.87956 WP_003409566.1.87991 WP_003409566.1.88 WP_003409566.1.88002 WP_003409566.1.88037 WP_003409566.1.88039 WP_003409566.1.88072 WP_003409566.1.88077 WP_003409566.1.88121 WP_003409566.1.88180 WP_003409566.1.88191 WP_003409566.1.88205 WP_003409566.1.88217 WP_003409566.1.88219 WP_003409566.1.88245 WP_003409566.1.88253 WP_003409566.1.88294 WP_003409566.1.88315 WP_003409566.1.88316 WP_003409566.1.88320 WP_003409566.1.88338 WP_003409566.1.8840 WP_003409566.1.88437 WP_003409566.1.88489 WP_003409566.1.88507 WP_003409566.1.88521 WP_003409566.1.88530 WP_003409566.1.88537 WP_003409566.1.88541 WP_003409566.1.88592 WP_003409566.1.88616 WP_003409566.1.88618 WP_003409566.1.8862 WP_003409566.1.88625 WP_003409566.1.88632 WP_003409566.1.88634 WP_003409566.1.88649 WP_003409566.1.8870 WP_003409566.1.88737 WP_003409566.1.88756 WP_003409566.1.888 WP_003409566.1.88824 WP_003409566.1.88886 WP_003409566.1.88965 WP_003409566.1.88985 WP_003409566.1.8902 WP_003409566.1.89025 WP_003409566.1.89041 WP_003409566.1.89046 WP_003409566.1.89162 WP_003409566.1.89168 WP_003409566.1.8917 WP_003409566.1.89193 WP_003409566.1.89205 WP_003409566.1.89207 WP_003409566.1.89225 WP_003409566.1.8925 WP_003409566.1.89277 WP_003409566.1.89286 WP_003409566.1.89293 WP_003409566.1.89320 WP_003409566.1.8935 WP_003409566.1.89371 WP_003409566.1.89378 WP_003409566.1.89392 WP_003409566.1.89406 WP_003409566.1.8943 WP_003409566.1.89451 WP_003409566.1.89453 WP_003409566.1.89473 WP_003409566.1.89475 WP_003409566.1.89483 WP_003409566.1.895 WP_003409566.1.89513 WP_003409566.1.89517 WP_003409566.1.89522 WP_003409566.1.8954 WP_003409566.1.89543 WP_003409566.1.89567 WP_003409566.1.8957 WP_003409566.1.89572 WP_003409566.1.89589 WP_003409566.1.89607 WP_003409566.1.89613 WP_003409566.1.89625 WP_003409566.1.89648 WP_003409566.1.8967 WP_003409566.1.89670 WP_003409566.1.89676 WP_003409566.1.89729 WP_003409566.1.89739 WP_003409566.1.89762 WP_003409566.1.8977 WP_003409566.1.89802 WP_003409566.1.89808 WP_003409566.1.8982 WP_003409566.1.89829 WP_003409566.1.89831 WP_003409566.1.89844 WP_003409566.1.89849 WP_003409566.1.8989 WP_003409566.1.89901 WP_003409566.1.89903 WP_003409566.1.89909 WP_003409566.1.89922 WP_003409566.1.89926 WP_003409566.1.89963 WP_003409566.1.89971 WP_003409566.1.8998 WP_003409566.1.89987 WP_003409566.1.900 WP_003409566.1.90048 WP_003409566.1.9007 WP_003409566.1.90080 WP_003409566.1.90130 WP_003409566.1.90134 WP_003409566.1.90137 WP_003409566.1.90157 WP_003409566.1.90184 WP_003409566.1.90199 WP_003409566.1.90231 WP_003409566.1.90245 WP_003409566.1.90308 WP_003409566.1.90322 WP_003409566.1.90328 WP_003409566.1.90372 WP_003409566.1.90439 WP_003409566.1.90481 WP_003409566.1.90499 WP_003409566.1.9050 WP_003409566.1.90527 WP_003409566.1.90550 WP_003409566.1.90560 WP_003409566.1.90612 WP_003409566.1.90640 WP_003409566.1.90672 WP_003409566.1.90691 WP_003409566.1.90711 WP_003409566.1.90722 WP_003409566.1.9075 WP_003409566.1.90756 WP_003409566.1.90767 WP_003409566.1.90771 WP_003409566.1.90785 WP_003409566.1.90788 WP_003409566.1.90800 WP_003409566.1.90810 WP_003409566.1.90816 WP_003409566.1.90819 WP_003409566.1.9082 WP_003409566.1.90831 WP_003409566.1.90884 WP_003409566.1.90899 WP_003409566.1.90906 WP_003409566.1.90958 WP_003409566.1.90976 WP_003409566.1.90977 WP_003409566.1.90987 WP_003409566.1.9102 WP_003409566.1.91026 WP_003409566.1.91032 WP_003409566.1.91043 WP_003409566.1.91053 WP_003409566.1.91082 WP_003409566.1.91106 WP_003409566.1.91112 WP_003409566.1.91144 WP_003409566.1.91151 WP_003409566.1.91157 WP_003409566.1.91167 WP_003409566.1.91169 WP_003409566.1.91192 WP_003409566.1.91201 WP_003409566.1.91208 WP_003409566.1.91211 WP_003409566.1.91214 WP_003409566.1.91230 WP_003409566.1.91244 WP_003409566.1.91251 WP_003409566.1.91260 WP_003409566.1.91265 WP_003409566.1.9128 WP_003409566.1.91284 WP_003409566.1.91294 WP_003409566.1.91303 WP_003409566.1.91322 WP_003409566.1.91352 WP_003409566.1.91386 WP_003409566.1.9139 WP_003409566.1.91398 WP_003409566.1.91411 WP_003409566.1.91430 WP_003409566.1.91436 WP_003409566.1.91483 WP_003409566.1.91496 WP_003409566.1.91507 WP_003409566.1.91508 WP_003409566.1.91576 WP_003409566.1.91589 WP_003409566.1.91694 WP_003409566.1.91695 WP_003409566.1.91713 WP_003409566.1.91716 WP_003409566.1.91717 WP_003409566.1.91728 WP_003409566.1.91743 WP_003409566.1.91759 WP_003409566.1.91784 WP_003409566.1.91785 WP_003409566.1.91786 WP_003409566.1.91802 WP_003409566.1.91828 WP_003409566.1.9189 WP_003409566.1.91896 WP_003409566.1.9190 WP_003409566.1.91915 WP_003409566.1.91931 WP_003409566.1.91937 WP_003409566.1.91944 WP_003409566.1.91953 WP_003409566.1.91957 WP_003409566.1.91976 WP_003409566.1.91978 WP_003409566.1.92021 WP_003409566.1.92083 WP_003409566.1.92127 WP_003409566.1.92144 WP_003409566.1.92150 WP_003409566.1.92153 WP_003409566.1.92190 WP_003409566.1.92192 WP_003409566.1.92200 WP_003409566.1.92220 WP_003409566.1.92221 WP_003409566.1.92222 WP_003409566.1.92273 WP_003409566.1.92289 WP_003409566.1.9229 WP_003409566.1.92294 WP_003409566.1.92300 WP_003409566.1.92317 WP_003409566.1.92334 WP_003409566.1.92338 WP_003409566.1.92345 WP_003409566.1.92356 WP_003409566.1.92364 WP_003409566.1.92380 WP_003409566.1.92416 WP_003409566.1.92428 WP_003409566.1.92447 WP_003409566.1.92456 WP_003409566.1.92467 WP_003409566.1.92471 WP_003409566.1.92490 WP_003409566.1.92508 WP_003409566.1.9251 WP_003409566.1.92511 WP_003409566.1.92523 WP_003409566.1.92527 WP_003409566.1.92536 WP_003409566.1.92592 WP_003409566.1.92597 WP_003409566.1.92606 WP_003409566.1.92610 WP_003409566.1.92613 WP_003409566.1.9263 WP_003409566.1.9265 WP_003409566.1.92650 WP_003409566.1.92660 WP_003409566.1.92677 WP_003409566.1.92685 WP_003409566.1.92689 WP_003409566.1.92690 WP_003409566.1.92706 WP_003409566.1.92714 WP_003409566.1.92736 WP_003409566.1.92752 WP_003409566.1.92760 WP_003409566.1.92777 WP_003409566.1.92803 WP_003409566.1.92833 WP_003409566.1.92856 WP_003409566.1.92881 WP_003409566.1.92892 WP_003409566.1.92907 WP_003409566.1.92908 WP_003409566.1.9291 WP_003409566.1.92917 WP_003409566.1.92996 WP_003409566.1.93006 WP_003409566.1.93008 WP_003409566.1.93009 WP_003409566.1.93015 WP_003409566.1.93043 WP_003409566.1.9307 WP_003409566.1.93083 WP_003409566.1.93097 WP_003409566.1.93137 WP_003409566.1.93192 WP_003409566.1.93199 WP_003409566.1.93203 WP_003409566.1.93212 WP_003409566.1.93234 WP_003409566.1.93245 WP_003409566.1.93257 WP_003409566.1.93265 WP_003409566.1.93297 WP_003409566.1.93320 WP_003409566.1.93328 WP_003409566.1.93337 WP_003409566.1.93343 WP_003409566.1.93349 WP_003409566.1.93363 WP_003409566.1.93377 WP_003409566.1.9338 WP_003409566.1.93407 WP_003409566.1.93417 WP_003409566.1.93419 WP_003409566.1.93426 WP_003409566.1.93443 WP_003409566.1.93447 WP_003409566.1.93470 WP_003409566.1.93483 WP_003409566.1.93487 WP_003409566.1.93495 WP_003409566.1.93499 WP_003409566.1.93516 WP_003409566.1.93536 WP_003409566.1.93544 WP_003409566.1.93555 WP_003409566.1.93560 WP_003409566.1.93564 WP_003409566.1.9357 WP_003409566.1.93573 WP_003409566.1.93576 WP_003409566.1.93588 WP_003409566.1.9363 WP_003409566.1.93645 WP_003409566.1.93649 WP_003409566.1.93659 WP_003409566.1.93677 WP_003409566.1.9368 WP_003409566.1.93689 WP_003409566.1.93693 WP_003409566.1.93698 WP_003409566.1.93706 WP_003409566.1.9371 WP_003409566.1.93792 WP_003409566.1.93823 WP_003409566.1.93871 WP_003409566.1.9388 WP_003409566.1.93894 WP_003409566.1.93903 WP_003409566.1.93907 WP_003409566.1.93913 WP_003409566.1.93946 WP_003409566.1.93950 WP_003409566.1.93953 WP_003409566.1.93954 WP_003409566.1.93988 WP_003409566.1.9407 WP_003409566.1.94143 WP_003409566.1.94154 WP_003409566.1.94184 WP_003409566.1.94204 WP_003409566.1.94205 WP_003409566.1.94226 WP_003409566.1.94231 WP_003409566.1.94256 WP_003409566.1.94261 WP_003409566.1.94281 WP_003409566.1.94292 WP_003409566.1.94297 WP_003409566.1.9431 WP_003409566.1.94326 WP_003409566.1.94339 WP_003409566.1.94392 WP_003409566.1.94416 WP_003409566.1.94421 WP_003409566.1.94456 WP_003409566.1.94470 WP_003409566.1.94480 WP_003409566.1.94495 WP_003409566.1.94511 WP_003409566.1.94512 WP_003409566.1.94525 WP_003409566.1.94528 WP_003409566.1.94564 WP_003409566.1.946 WP_003409566.1.94602 WP_003409566.1.94623 WP_003409566.1.94629 WP_003409566.1.9465 WP_003409566.1.94673 WP_003409566.1.94714 WP_003409566.1.94730 WP_003409566.1.94736 WP_003409566.1.94776 WP_003409566.1.9478 WP_003409566.1.94834 WP_003409566.1.94852 WP_003409566.1.94872 WP_003409566.1.9488 WP_003409566.1.94902 WP_003409566.1.94916 WP_003409566.1.94979 WP_003409566.1.94994 WP_003409566.1.94996 WP_003409566.1.94998 WP_003409566.1.95007 WP_003409566.1.95010 WP_003409566.1.95015 WP_003409566.1.95034 WP_003409566.1.95068 WP_003409566.1.95081 WP_003409566.1.9509 WP_003409566.1.95096 WP_003409566.1.95112 WP_003409566.1.95138 WP_003409566.1.95179 WP_003409566.1.95188 WP_003409566.1.95190 WP_003409566.1.95234 WP_003409566.1.95241 WP_003409566.1.95245 WP_003409566.1.95257 WP_003409566.1.95279 WP_003409566.1.9531 WP_003409566.1.95335 WP_003409566.1.95344 WP_003409566.1.9535 WP_003409566.1.95370 WP_003409566.1.95392 WP_003409566.1.95416 WP_003409566.1.95417 WP_003409566.1.95454 WP_003409566.1.95455 WP_003409566.1.95491 WP_003409566.1.95497 WP_003409566.1.95508 WP_003409566.1.95509 WP_003409566.1.95529 WP_003409566.1.95556 WP_003409566.1.95557 WP_003409566.1.95565 WP_003409566.1.95578 WP_003409566.1.95580 WP_003409566.1.95585 WP_003409566.1.95643 WP_003409566.1.95679 WP_003409566.1.95685 WP_003409566.1.957 WP_003409566.1.95724 WP_003409566.1.95727 WP_003409566.1.95730 WP_003409566.1.95735 WP_003409566.1.95758 WP_003409566.1.95772 WP_003409566.1.95797 WP_003409566.1.95839 WP_003409566.1.9585 WP_003409566.1.9590 WP_003409566.1.95902 WP_003409566.1.95908 WP_003409566.1.95924 WP_003409566.1.95926 WP_003409566.1.95953 WP_003409566.1.95958 WP_003409566.1.95964 WP_003409566.1.95973 WP_003409566.1.96006 WP_003409566.1.9602 WP_003409566.1.96036 WP_003409566.1.96062 WP_003409566.1.96065 WP_003409566.1.96098 WP_003409566.1.96146 WP_003409566.1.96171 WP_003409566.1.96182 WP_003409566.1.96204 WP_003409566.1.96230 WP_003409566.1.96235 WP_003409566.1.96242 WP_003409566.1.96245 WP_003409566.1.96254 WP_003409566.1.96259 WP_003409566.1.96286 WP_003409566.1.96313 WP_003409566.1.96318 WP_003409566.1.96345 WP_003409566.1.96360 WP_003409566.1.96373 WP_003409566.1.96456 WP_003409566.1.96486 WP_003409566.1.96560 WP_003409566.1.96569 WP_003409566.1.96573 WP_003409566.1.96575 WP_003409566.1.96576 WP_003409566.1.96611 WP_003409566.1.96621 WP_003409566.1.9667 WP_003409566.1.96681 WP_003409566.1.96726 WP_003409566.1.96733 WP_003409566.1.96742 WP_003409566.1.96754 WP_003409566.1.9678 WP_003409566.1.96832 WP_003409566.1.9685 WP_003409566.1.97008 WP_003409566.1.97009 WP_003409566.1.97084 WP_003409566.1.97087 WP_003409566.1.97094 WP_003409566.1.97096 WP_003409566.1.97099 WP_003409566.1.97108 WP_003409566.1.97113 WP_003409566.1.97122 WP_003409566.1.97127 WP_003409566.1.97129 WP_003409566.1.97136 WP_003409566.1.9716 WP_003409566.1.97176 WP_003409566.1.97222 WP_003409566.1.97223 WP_003409566.1.97237 WP_003409566.1.97242 WP_003409566.1.97270 WP_003409566.1.97283 WP_003409566.1.97296 WP_003409566.1.97321 WP_003409566.1.97325 WP_003409566.1.97330 WP_003409566.1.97366 WP_003409566.1.97376 WP_003409566.1.97380 WP_003409566.1.9739 WP_003409566.1.97462 WP_003409566.1.97517 WP_003409566.1.97519 WP_003409566.1.97535 WP_003409566.1.97540 WP_003409566.1.97545 WP_003409566.1.97546 WP_003409566.1.97550 WP_003409566.1.97568 WP_003409566.1.97577 WP_003409566.1.97584 WP_003409566.1.9759 WP_003409566.1.97591 WP_003409566.1.97596 WP_003409566.1.97618 WP_003409566.1.9763 WP_003409566.1.97669 WP_003409566.1.97673 WP_003409566.1.97700 WP_003409566.1.97701 WP_003409566.1.9773 WP_003409566.1.97730 WP_003409566.1.97740 WP_003409566.1.97751 WP_003409566.1.97754 WP_003409566.1.97797 WP_003409566.1.9782 WP_003409566.1.9784 WP_003409566.1.97888 WP_003409566.1.9790 WP_003409566.1.9795 WP_003409566.1.97951 WP_003409566.1.97958 WP_003409566.1.97966 WP_003409566.1.97977 WP_003409566.1.97979 WP_003409566.1.97995 WP_003409566.1.98018 WP_003409566.1.98034 WP_003409566.1.98052 WP_003409566.1.98071 WP_003409566.1.98072 WP_003409566.1.98113 WP_003409566.1.98114 WP_003409566.1.98128 WP_003409566.1.98181 WP_003409566.1.98188 WP_003409566.1.98189 WP_003409566.1.98213 WP_003409566.1.98225 WP_003409566.1.98291 WP_003409566.1.98335 WP_003409566.1.98350 WP_003409566.1.98395 WP_003409566.1.98412 WP_003409566.1.98441 WP_003409566.1.98443 WP_003409566.1.98462 WP_003409566.1.9848 WP_003409566.1.98482 WP_003409566.1.98486 WP_003409566.1.98488 WP_003409566.1.98503 WP_003409566.1.98516 WP_003409566.1.98524 WP_003409566.1.98536 WP_003409566.1.98541 WP_003409566.1.98566 WP_003409566.1.98576 WP_003409566.1.98594 WP_003409566.1.98599 WP_003409566.1.98629 WP_003409566.1.98645 WP_003409566.1.98649 WP_003409566.1.98656 WP_003409566.1.9867 WP_003409566.1.98674 WP_003409566.1.98697 WP_003409566.1.98701 WP_003409566.1.98739 WP_003409566.1.98749 WP_003409566.1.98765 WP_003409566.1.98770 WP_003409566.1.98777 WP_003409566.1.98778 WP_003409566.1.98802 WP_003409566.1.98838 WP_003409566.1.98850 WP_003409566.1.98906 WP_003409566.1.98935 WP_003409566.1.98948 WP_003409566.1.98953 WP_003409566.1.98984 WP_003409566.1.99000 WP_003409566.1.99023 WP_003409566.1.99030 WP_003409566.1.99037 WP_003409566.1.99055 WP_003409566.1.99062 WP_003409566.1.99086 WP_003409566.1.99115 WP_003409566.1.99117 WP_003409566.1.99161 WP_003409566.1.99176 WP_003409566.1.99205 WP_003409566.1.99211 WP_003409566.1.99216 WP_003409566.1.99222 WP_003409566.1.99251 WP_003409566.1.99269 WP_003409566.1.99294 WP_003409566.1.99312 WP_003409566.1.99315 WP_003409566.1.99316 WP_003409566.1.99322 WP_003409566.1.99328 WP_003409566.1.99365 WP_003409566.1.99368 WP_003409566.1.99379 WP_003409566.1.99396 WP_003409566.1.99402 WP_003409566.1.99404 WP_003409566.1.99419 WP_003409566.1.99438 WP_003409566.1.99460 WP_003409566.1.99468 WP_003409566.1.99473 WP_003409566.1.99513 WP_003409566.1.99529 WP_003409566.1.99548 WP_003409566.1.99572 WP_003409566.1.99575 WP_003409566.1.99578 WP_003409566.1.99605 WP_003409566.1.99609 WP_003409566.1.99617 WP_003409566.1.99635 WP_003409566.1.99650 WP_003409566.1.99672 WP_003409566.1.99701 WP_003409566.1.99711 WP_003409566.1.99716 WP_003409566.1.99740 WP_003409566.1.99745 WP_003409566.1.99749 WP_003409566.1.9976 WP_003409566.1.99817 WP_003409566.1.99832 WP_003409566.1.99847 WP_003409566.1.99852 WP_003409566.1.99886 WP_003409566.1.99897 WP_003409566.1.99899 WP_003409566.1.99915 WP_003409566.1.9993 WP_003409566.1.99982 WP_003409566.1.99991 gi|433634959|ref|YP_007268586.1| gi|383307729|ref|YP_005360540.1| gi|339631963|ref|YP_004723605.1| gi|479055868|ref|YP_007351674.1| gi|494696281|ref|YP_007961784.1| gi|121637816|ref|YP_978039.1| gi|378771659|ref|YP_005171392.1| 233413.Mb1945c 410289.BCG_1949c 419947.MRA_1921 561275.JTY_1933 83332.Rv1910c gi|15609047|ref|NP_216426.1| gi|15609047|ref|NP_216426.1| gi|392386566|ref|YP_005308195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]