SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339632404|ref|YP_004724046.1| from Mycobacterium africanum GM041182

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339632404|ref|YP_004724046.1|
Domain Number 1 Region: 3-240
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000197
Family C-terminal domain of adrenodoxin reductase-like 0.065
Further Details:      
 
Weak hits

Sequence:  gi|339632404|ref|YP_004724046.1|
Domain Number - Region: 196-234,272-337
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00015
Family Siroheme synthase N-terminal domain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339632404|ref|YP_004724046.1|
Sequence length 431
Comment lysine-N-oxygenase [Mycobacterium africanum GM041182]
Sequence
MNPTLAVLGAGAKAVAVAAKASVLRDMGVDVPDVIAVERIGVGANWQASGGWTDGAHRLG
TSPEKDVGFPYRSALVPRRNAELDERMTRYSWQSYLIATASFAEWIDRGRPAPTHRRWSQ
YLAWVADHIGLKVIHGEVERLAVTGDRWALCTHETTVQADALMITGPGQAEKSLLPGNPR
VLSIAQFWDRAAGHDRINAERVAVIGGGETAASMLNELFRHRVSTITVISPQVTLFTRGE
GFFENSLFSDPTDWAALTFDERRDALARTDRGVFSATVQEALLADDRIHHLRGRVAHAVG
RQGQIRLTLSTNRGSENFETVHGFDLVIDGSGADPLWFTSLFSQHTLDLLELGLGGPLTA
DRLQEAIGYDLAVTDVTPKLFLPTLSGLTQGPGFPNLSCLGLLSDRVLGAGIFTPTKHND
TRRSGEHQSFR
Download sequence
Identical sequences A0A045I8C5 A0A083W3H9 A0A0H3LID1 A0A0H3MCH7 A0A0K2HY61 A0A109SPI3 A0A109SYF3 A0A197IVY2 A0A1S1B9W7 A5U571 F8M1G7 I6X426 P9WKF6 P9WKF7 Q7TYQ9
gi|31793555|ref|NP_856048.1| gi|506926903|ref|YP_008007353.1| gi|385991703|ref|YP_005910001.1| gi|121638257|ref|YP_978481.1| gi|392432015|ref|YP_006473059.1| gi|339632404|ref|YP_004724046.1| gi|148662210|ref|YP_001283733.1| gi|385999158|ref|YP_005917457.1| NP_216894.1.84033 WP_003899296.1.100000 WP_003899296.1.100021 WP_003899296.1.100069 WP_003899296.1.100087 WP_003899296.1.10015 WP_003899296.1.100208 WP_003899296.1.100216 WP_003899296.1.10022 WP_003899296.1.100255 WP_003899296.1.100260 WP_003899296.1.100270 WP_003899296.1.100279 WP_003899296.1.100286 WP_003899296.1.100308 WP_003899296.1.100309 WP_003899296.1.100318 WP_003899296.1.100337 WP_003899296.1.100338 WP_003899296.1.100383 WP_003899296.1.100395 WP_003899296.1.100396 WP_003899296.1.1004 WP_003899296.1.100401 WP_003899296.1.100459 WP_003899296.1.100460 WP_003899296.1.100552 WP_003899296.1.100581 WP_003899296.1.100600 WP_003899296.1.100625 WP_003899296.1.100666 WP_003899296.1.100671 WP_003899296.1.100677 WP_003899296.1.100682 WP_003899296.1.100697 WP_003899296.1.100703 WP_003899296.1.100716 WP_003899296.1.100722 WP_003899296.1.100754 WP_003899296.1.100757 WP_003899296.1.100772 WP_003899296.1.1008 WP_003899296.1.100812 WP_003899296.1.100845 WP_003899296.1.100866 WP_003899296.1.10088 WP_003899296.1.100889 WP_003899296.1.10090 WP_003899296.1.100910 WP_003899296.1.100915 WP_003899296.1.100918 WP_003899296.1.100935 WP_003899296.1.100984 WP_003899296.1.100992 WP_003899296.1.100998 WP_003899296.1.101 WP_003899296.1.101028 WP_003899296.1.10104 WP_003899296.1.101048 WP_003899296.1.101054 WP_003899296.1.101075 WP_003899296.1.101143 WP_003899296.1.101146 WP_003899296.1.10116 WP_003899296.1.10117 WP_003899296.1.101209 WP_003899296.1.10125 WP_003899296.1.101290 WP_003899296.1.101323 WP_003899296.1.101324 WP_003899296.1.101350 WP_003899296.1.101367 WP_003899296.1.101398 WP_003899296.1.101403 WP_003899296.1.101421 WP_003899296.1.10144 WP_003899296.1.101442 WP_003899296.1.10145 WP_003899296.1.101452 WP_003899296.1.101456 WP_003899296.1.101481 WP_003899296.1.101493 WP_003899296.1.101496 WP_003899296.1.101525 WP_003899296.1.101533 WP_003899296.1.101535 WP_003899296.1.101553 WP_003899296.1.101558 WP_003899296.1.10156 WP_003899296.1.101573 WP_003899296.1.10159 WP_003899296.1.101592 WP_003899296.1.101604 WP_003899296.1.101607 WP_003899296.1.101622 WP_003899296.1.101644 WP_003899296.1.101671 WP_003899296.1.101687 WP_003899296.1.101698 WP_003899296.1.10170 WP_003899296.1.101713 WP_003899296.1.101722 WP_003899296.1.101733 WP_003899296.1.101743 WP_003899296.1.101754 WP_003899296.1.101764 WP_003899296.1.101795 WP_003899296.1.101797 WP_003899296.1.101798 WP_003899296.1.101826 WP_003899296.1.101836 WP_003899296.1.101859 WP_003899296.1.101862 WP_003899296.1.101888 WP_003899296.1.101894 WP_003899296.1.101899 WP_003899296.1.101923 WP_003899296.1.101925 WP_003899296.1.10193 WP_003899296.1.101996 WP_003899296.1.102 WP_003899296.1.102008 WP_003899296.1.102017 WP_003899296.1.102053 WP_003899296.1.102055 WP_003899296.1.102063 WP_003899296.1.102099 WP_003899296.1.1021 WP_003899296.1.10211 WP_003899296.1.102119 WP_003899296.1.102121 WP_003899296.1.102143 WP_003899296.1.10216 WP_003899296.1.10224 WP_003899296.1.10253 WP_003899296.1.10262 WP_003899296.1.10272 WP_003899296.1.10277 WP_003899296.1.1033 WP_003899296.1.10350 WP_003899296.1.10362 WP_003899296.1.10366 WP_003899296.1.10376 WP_003899296.1.10396 WP_003899296.1.10410 WP_003899296.1.10414 WP_003899296.1.10421 WP_003899296.1.10430 WP_003899296.1.1044 WP_003899296.1.10440 WP_003899296.1.10445 WP_003899296.1.10471 WP_003899296.1.10472 WP_003899296.1.10489 WP_003899296.1.105 WP_003899296.1.10518 WP_003899296.1.10545 WP_003899296.1.1057 WP_003899296.1.10594 WP_003899296.1.10603 WP_003899296.1.10606 WP_003899296.1.10615 WP_003899296.1.10623 WP_003899296.1.10635 WP_003899296.1.10643 WP_003899296.1.10648 WP_003899296.1.10662 WP_003899296.1.10709 WP_003899296.1.10735 WP_003899296.1.10740 WP_003899296.1.10756 WP_003899296.1.1078 WP_003899296.1.10791 WP_003899296.1.10799 WP_003899296.1.10825 WP_003899296.1.10848 WP_003899296.1.10863 WP_003899296.1.10879 WP_003899296.1.10912 WP_003899296.1.10916 WP_003899296.1.10923 WP_003899296.1.10927 WP_003899296.1.1095 WP_003899296.1.10956 WP_003899296.1.10958 WP_003899296.1.10962 WP_003899296.1.10981 WP_003899296.1.10993 WP_003899296.1.1100 WP_003899296.1.11040 WP_003899296.1.11061 WP_003899296.1.11070 WP_003899296.1.11141 WP_003899296.1.11171 WP_003899296.1.11175 WP_003899296.1.11176 WP_003899296.1.11222 WP_003899296.1.11236 WP_003899296.1.11329 WP_003899296.1.1133 WP_003899296.1.11342 WP_003899296.1.11373 WP_003899296.1.11376 WP_003899296.1.11390 WP_003899296.1.11402 WP_003899296.1.11481 WP_003899296.1.11487 WP_003899296.1.11489 WP_003899296.1.11491 WP_003899296.1.11514 WP_003899296.1.11587 WP_003899296.1.11589 WP_003899296.1.11596 WP_003899296.1.11604 WP_003899296.1.11610 WP_003899296.1.11697 WP_003899296.1.11707 WP_003899296.1.11752 WP_003899296.1.11758 WP_003899296.1.11761 WP_003899296.1.11775 WP_003899296.1.11804 WP_003899296.1.11822 WP_003899296.1.11826 WP_003899296.1.11856 WP_003899296.1.11898 WP_003899296.1.11906 WP_003899296.1.11939 WP_003899296.1.11960 WP_003899296.1.11961 WP_003899296.1.11972 WP_003899296.1.11984 WP_003899296.1.120 WP_003899296.1.12001 WP_003899296.1.12049 WP_003899296.1.12052 WP_003899296.1.12100 WP_003899296.1.12116 WP_003899296.1.12130 WP_003899296.1.12133 WP_003899296.1.12161 WP_003899296.1.12184 WP_003899296.1.12187 WP_003899296.1.12190 WP_003899296.1.12216 WP_003899296.1.12265 WP_003899296.1.12275 WP_003899296.1.12293 WP_003899296.1.12294 WP_003899296.1.123 WP_003899296.1.1231 WP_003899296.1.12314 WP_003899296.1.12327 WP_003899296.1.12338 WP_003899296.1.1236 WP_003899296.1.12371 WP_003899296.1.12372 WP_003899296.1.12389 WP_003899296.1.12406 WP_003899296.1.1241 WP_003899296.1.12421 WP_003899296.1.12424 WP_003899296.1.12446 WP_003899296.1.12464 WP_003899296.1.12479 WP_003899296.1.12519 WP_003899296.1.12523 WP_003899296.1.12526 WP_003899296.1.1255 WP_003899296.1.12550 WP_003899296.1.12551 WP_003899296.1.12611 WP_003899296.1.12669 WP_003899296.1.1267 WP_003899296.1.12672 WP_003899296.1.12692 WP_003899296.1.1271 WP_003899296.1.12710 WP_003899296.1.12768 WP_003899296.1.1279 WP_003899296.1.12794 WP_003899296.1.12801 WP_003899296.1.12804 WP_003899296.1.12821 WP_003899296.1.12841 WP_003899296.1.12854 WP_003899296.1.12871 WP_003899296.1.12901 WP_003899296.1.12941 WP_003899296.1.12947 WP_003899296.1.12957 WP_003899296.1.12972 WP_003899296.1.13028 WP_003899296.1.13043 WP_003899296.1.13087 WP_003899296.1.13090 WP_003899296.1.13096 WP_003899296.1.13163 WP_003899296.1.13175 WP_003899296.1.13183 WP_003899296.1.132 WP_003899296.1.13249 WP_003899296.1.13282 WP_003899296.1.13284 WP_003899296.1.13296 WP_003899296.1.13298 WP_003899296.1.13302 WP_003899296.1.13306 WP_003899296.1.13312 WP_003899296.1.13313 WP_003899296.1.13321 WP_003899296.1.13345 WP_003899296.1.13370 WP_003899296.1.1338 WP_003899296.1.13420 WP_003899296.1.13433 WP_003899296.1.13435 WP_003899296.1.13438 WP_003899296.1.13461 WP_003899296.1.13489 WP_003899296.1.13526 WP_003899296.1.13551 WP_003899296.1.13564 WP_003899296.1.13579 WP_003899296.1.13647 WP_003899296.1.13667 WP_003899296.1.13687 WP_003899296.1.13697 WP_003899296.1.13719 WP_003899296.1.13763 WP_003899296.1.1377 WP_003899296.1.13774 WP_003899296.1.13786 WP_003899296.1.13793 WP_003899296.1.13817 WP_003899296.1.13834 WP_003899296.1.13866 WP_003899296.1.13880 WP_003899296.1.13899 WP_003899296.1.13909 WP_003899296.1.13919 WP_003899296.1.13920 WP_003899296.1.13952 WP_003899296.1.13953 WP_003899296.1.13962 WP_003899296.1.1398 WP_003899296.1.13988 WP_003899296.1.14027 WP_003899296.1.14046 WP_003899296.1.14115 WP_003899296.1.1415 WP_003899296.1.14152 WP_003899296.1.14158 WP_003899296.1.14162 WP_003899296.1.14175 WP_003899296.1.14178 WP_003899296.1.14194 WP_003899296.1.14195 WP_003899296.1.14208 WP_003899296.1.14238 WP_003899296.1.14266 WP_003899296.1.14273 WP_003899296.1.14303 WP_003899296.1.14306 WP_003899296.1.14310 WP_003899296.1.14341 WP_003899296.1.14382 WP_003899296.1.14416 WP_003899296.1.14428 WP_003899296.1.14441 WP_003899296.1.14469 WP_003899296.1.14477 WP_003899296.1.14504 WP_003899296.1.14514 WP_003899296.1.1452 WP_003899296.1.14527 WP_003899296.1.1454 WP_003899296.1.14544 WP_003899296.1.14548 WP_003899296.1.14551 WP_003899296.1.14561 WP_003899296.1.14573 WP_003899296.1.1462 WP_003899296.1.14658 WP_003899296.1.14667 WP_003899296.1.14668 WP_003899296.1.14675 WP_003899296.1.14694 WP_003899296.1.14695 WP_003899296.1.14709 WP_003899296.1.14766 WP_003899296.1.14783 WP_003899296.1.14865 WP_003899296.1.14872 WP_003899296.1.14905 WP_003899296.1.14926 WP_003899296.1.14951 WP_003899296.1.14955 WP_003899296.1.15003 WP_003899296.1.15009 WP_003899296.1.15028 WP_003899296.1.15040 WP_003899296.1.15052 WP_003899296.1.15065 WP_003899296.1.15072 WP_003899296.1.15089 WP_003899296.1.1509 WP_003899296.1.15126 WP_003899296.1.15168 WP_003899296.1.15172 WP_003899296.1.15174 WP_003899296.1.15187 WP_003899296.1.15196 WP_003899296.1.15210 WP_003899296.1.15216 WP_003899296.1.15217 WP_003899296.1.1523 WP_003899296.1.15232 WP_003899296.1.15238 WP_003899296.1.15240 WP_003899296.1.15253 WP_003899296.1.15267 WP_003899296.1.1527 WP_003899296.1.15292 WP_003899296.1.15302 WP_003899296.1.15322 WP_003899296.1.1534 WP_003899296.1.15345 WP_003899296.1.15365 WP_003899296.1.15372 WP_003899296.1.15386 WP_003899296.1.15387 WP_003899296.1.15442 WP_003899296.1.15447 WP_003899296.1.15449 WP_003899296.1.15477 WP_003899296.1.15481 WP_003899296.1.15492 WP_003899296.1.15511 WP_003899296.1.15512 WP_003899296.1.15558 WP_003899296.1.15559 WP_003899296.1.15566 WP_003899296.1.15599 WP_003899296.1.1560 WP_003899296.1.15611 WP_003899296.1.1563 WP_003899296.1.15633 WP_003899296.1.15643 WP_003899296.1.15688 WP_003899296.1.15755 WP_003899296.1.15763 WP_003899296.1.15774 WP_003899296.1.1578 WP_003899296.1.15780 WP_003899296.1.15827 WP_003899296.1.15834 WP_003899296.1.15842 WP_003899296.1.15853 WP_003899296.1.15870 WP_003899296.1.15877 WP_003899296.1.15896 WP_003899296.1.15926 WP_003899296.1.15933 WP_003899296.1.15946 WP_003899296.1.15958 WP_003899296.1.15973 WP_003899296.1.15987 WP_003899296.1.15993 WP_003899296.1.16009 WP_003899296.1.16025 WP_003899296.1.16066 WP_003899296.1.16069 WP_003899296.1.16077 WP_003899296.1.16106 WP_003899296.1.16108 WP_003899296.1.16110 WP_003899296.1.16130 WP_003899296.1.16136 WP_003899296.1.16139 WP_003899296.1.16141 WP_003899296.1.16143 WP_003899296.1.1630 WP_003899296.1.1632 WP_003899296.1.16327 WP_003899296.1.16334 WP_003899296.1.16341 WP_003899296.1.16345 WP_003899296.1.16374 WP_003899296.1.16384 WP_003899296.1.16386 WP_003899296.1.164 WP_003899296.1.1642 WP_003899296.1.16421 WP_003899296.1.16424 WP_003899296.1.16426 WP_003899296.1.16431 WP_003899296.1.16438 WP_003899296.1.1644 WP_003899296.1.16442 WP_003899296.1.16448 WP_003899296.1.16451 WP_003899296.1.16476 WP_003899296.1.16480 WP_003899296.1.16494 WP_003899296.1.1652 WP_003899296.1.16549 WP_003899296.1.16560 WP_003899296.1.16598 WP_003899296.1.16609 WP_003899296.1.16619 WP_003899296.1.16620 WP_003899296.1.16622 WP_003899296.1.16637 WP_003899296.1.16707 WP_003899296.1.16724 WP_003899296.1.16731 WP_003899296.1.16743 WP_003899296.1.1683 WP_003899296.1.16837 WP_003899296.1.16852 WP_003899296.1.16937 WP_003899296.1.16940 WP_003899296.1.16950 WP_003899296.1.16959 WP_003899296.1.16968 WP_003899296.1.1697 WP_003899296.1.16973 WP_003899296.1.16977 WP_003899296.1.16987 WP_003899296.1.17005 WP_003899296.1.17006 WP_003899296.1.17015 WP_003899296.1.17019 WP_003899296.1.17039 WP_003899296.1.17041 WP_003899296.1.17052 WP_003899296.1.17057 WP_003899296.1.17062 WP_003899296.1.1707 WP_003899296.1.17094 WP_003899296.1.17130 WP_003899296.1.17138 WP_003899296.1.17147 WP_003899296.1.17167 WP_003899296.1.17224 WP_003899296.1.17251 WP_003899296.1.17288 WP_003899296.1.17314 WP_003899296.1.17345 WP_003899296.1.17381 WP_003899296.1.17391 WP_003899296.1.17412 WP_003899296.1.1743 WP_003899296.1.17440 WP_003899296.1.17466 WP_003899296.1.17477 WP_003899296.1.17483 WP_003899296.1.17505 WP_003899296.1.17527 WP_003899296.1.17535 WP_003899296.1.17540 WP_003899296.1.17553 WP_003899296.1.17558 WP_003899296.1.17599 WP_003899296.1.17635 WP_003899296.1.17655 WP_003899296.1.17679 WP_003899296.1.1768 WP_003899296.1.17687 WP_003899296.1.17700 WP_003899296.1.17710 WP_003899296.1.17713 WP_003899296.1.17722 WP_003899296.1.17746 WP_003899296.1.17788 WP_003899296.1.17803 WP_003899296.1.17816 WP_003899296.1.17821 WP_003899296.1.17830 WP_003899296.1.17878 WP_003899296.1.1792 WP_003899296.1.17923 WP_003899296.1.1795 WP_003899296.1.17955 WP_003899296.1.17973 WP_003899296.1.18013 WP_003899296.1.18033 WP_003899296.1.18057 WP_003899296.1.18065 WP_003899296.1.18070 WP_003899296.1.18116 WP_003899296.1.18120 WP_003899296.1.18126 WP_003899296.1.1817 WP_003899296.1.18206 WP_003899296.1.18216 WP_003899296.1.18240 WP_003899296.1.18257 WP_003899296.1.18297 WP_003899296.1.18306 WP_003899296.1.18364 WP_003899296.1.18399 WP_003899296.1.18411 WP_003899296.1.18444 WP_003899296.1.18448 WP_003899296.1.18467 WP_003899296.1.18476 WP_003899296.1.18522 WP_003899296.1.18580 WP_003899296.1.18582 WP_003899296.1.18587 WP_003899296.1.18601 WP_003899296.1.18639 WP_003899296.1.18647 WP_003899296.1.1868 WP_003899296.1.18694 WP_003899296.1.18710 WP_003899296.1.18751 WP_003899296.1.18781 WP_003899296.1.18793 WP_003899296.1.18804 WP_003899296.1.18816 WP_003899296.1.18823 WP_003899296.1.18827 WP_003899296.1.18838 WP_003899296.1.18849 WP_003899296.1.18856 WP_003899296.1.18945 WP_003899296.1.19005 WP_003899296.1.19056 WP_003899296.1.19063 WP_003899296.1.19066 WP_003899296.1.19085 WP_003899296.1.19094 WP_003899296.1.19144 WP_003899296.1.19159 WP_003899296.1.19193 WP_003899296.1.19231 WP_003899296.1.19243 WP_003899296.1.19264 WP_003899296.1.19295 WP_003899296.1.19307 WP_003899296.1.19326 WP_003899296.1.1933 WP_003899296.1.19364 WP_003899296.1.19382 WP_003899296.1.19400 WP_003899296.1.19426 WP_003899296.1.19429 WP_003899296.1.19464 WP_003899296.1.19480 WP_003899296.1.19512 WP_003899296.1.19553 WP_003899296.1.19562 WP_003899296.1.19564 WP_003899296.1.19568 WP_003899296.1.19572 WP_003899296.1.19595 WP_003899296.1.19596 WP_003899296.1.19600 WP_003899296.1.19630 WP_003899296.1.19694 WP_003899296.1.1970 WP_003899296.1.19707 WP_003899296.1.19742 WP_003899296.1.19785 WP_003899296.1.19820 WP_003899296.1.19868 WP_003899296.1.19874 WP_003899296.1.19890 WP_003899296.1.19900 WP_003899296.1.19922 WP_003899296.1.19936 WP_003899296.1.19946 WP_003899296.1.19949 WP_003899296.1.19960 WP_003899296.1.19964 WP_003899296.1.20007 WP_003899296.1.20016 WP_003899296.1.20028 WP_003899296.1.2003 WP_003899296.1.20037 WP_003899296.1.20039 WP_003899296.1.20082 WP_003899296.1.20085 WP_003899296.1.20097 WP_003899296.1.20116 WP_003899296.1.20130 WP_003899296.1.20140 WP_003899296.1.20141 WP_003899296.1.20142 WP_003899296.1.20158 WP_003899296.1.20239 WP_003899296.1.20243 WP_003899296.1.20259 WP_003899296.1.20262 WP_003899296.1.20268 WP_003899296.1.20272 WP_003899296.1.20273 WP_003899296.1.20280 WP_003899296.1.20294 WP_003899296.1.20300 WP_003899296.1.20322 WP_003899296.1.2037 WP_003899296.1.20372 WP_003899296.1.20381 WP_003899296.1.204 WP_003899296.1.20427 WP_003899296.1.20457 WP_003899296.1.20459 WP_003899296.1.20460 WP_003899296.1.20542 WP_003899296.1.20578 WP_003899296.1.20608 WP_003899296.1.20624 WP_003899296.1.20628 WP_003899296.1.2066 WP_003899296.1.20707 WP_003899296.1.20722 WP_003899296.1.20729 WP_003899296.1.20742 WP_003899296.1.20751 WP_003899296.1.20776 WP_003899296.1.20843 WP_003899296.1.20850 WP_003899296.1.2086 WP_003899296.1.20868 WP_003899296.1.20876 WP_003899296.1.20897 WP_003899296.1.20898 WP_003899296.1.2090 WP_003899296.1.20911 WP_003899296.1.20916 WP_003899296.1.20921 WP_003899296.1.20926 WP_003899296.1.20927 WP_003899296.1.20951 WP_003899296.1.20970 WP_003899296.1.2104 WP_003899296.1.21070 WP_003899296.1.21127 WP_003899296.1.21135 WP_003899296.1.21173 WP_003899296.1.21187 WP_003899296.1.212 WP_003899296.1.2120 WP_003899296.1.21219 WP_003899296.1.2123 WP_003899296.1.21231 WP_003899296.1.21234 WP_003899296.1.2126 WP_003899296.1.21292 WP_003899296.1.21307 WP_003899296.1.2131 WP_003899296.1.21311 WP_003899296.1.21321 WP_003899296.1.21365 WP_003899296.1.2137 WP_003899296.1.21392 WP_003899296.1.21397 WP_003899296.1.21403 WP_003899296.1.21415 WP_003899296.1.21418 WP_003899296.1.21430 WP_003899296.1.21434 WP_003899296.1.21444 WP_003899296.1.21468 WP_003899296.1.21498 WP_003899296.1.21509 WP_003899296.1.21513 WP_003899296.1.21560 WP_003899296.1.21565 WP_003899296.1.21586 WP_003899296.1.21591 WP_003899296.1.21602 WP_003899296.1.21615 WP_003899296.1.21638 WP_003899296.1.21639 WP_003899296.1.21655 WP_003899296.1.21658 WP_003899296.1.2168 WP_003899296.1.2174 WP_003899296.1.21741 WP_003899296.1.21742 WP_003899296.1.21777 WP_003899296.1.21786 WP_003899296.1.21795 WP_003899296.1.218 WP_003899296.1.21826 WP_003899296.1.21829 WP_003899296.1.21840 WP_003899296.1.21843 WP_003899296.1.21872 WP_003899296.1.2188 WP_003899296.1.21882 WP_003899296.1.21906 WP_003899296.1.21912 WP_003899296.1.2194 WP_003899296.1.21941 WP_003899296.1.21956 WP_003899296.1.21958 WP_003899296.1.21960 WP_003899296.1.21971 WP_003899296.1.21973 WP_003899296.1.21983 WP_003899296.1.22003 WP_003899296.1.22013 WP_003899296.1.22025 WP_003899296.1.22036 WP_003899296.1.22075 WP_003899296.1.22092 WP_003899296.1.2212 WP_003899296.1.22127 WP_003899296.1.22140 WP_003899296.1.22233 WP_003899296.1.22277 WP_003899296.1.22305 WP_003899296.1.22348 WP_003899296.1.22356 WP_003899296.1.22366 WP_003899296.1.2238 WP_003899296.1.22437 WP_003899296.1.22438 WP_003899296.1.22445 WP_003899296.1.22490 WP_003899296.1.22511 WP_003899296.1.22524 WP_003899296.1.2253 WP_003899296.1.22585 WP_003899296.1.22589 WP_003899296.1.22606 WP_003899296.1.22608 WP_003899296.1.22609 WP_003899296.1.22618 WP_003899296.1.2262 WP_003899296.1.22624 WP_003899296.1.22629 WP_003899296.1.22647 WP_003899296.1.22664 WP_003899296.1.22665 WP_003899296.1.22670 WP_003899296.1.22674 WP_003899296.1.22680 WP_003899296.1.22725 WP_003899296.1.22728 WP_003899296.1.22733 WP_003899296.1.22737 WP_003899296.1.2275 WP_003899296.1.22754 WP_003899296.1.22797 WP_003899296.1.22800 WP_003899296.1.22804 WP_003899296.1.22844 WP_003899296.1.22963 WP_003899296.1.22970 WP_003899296.1.22996 WP_003899296.1.22997 WP_003899296.1.22999 WP_003899296.1.23015 WP_003899296.1.23032 WP_003899296.1.231 WP_003899296.1.23101 WP_003899296.1.2312 WP_003899296.1.23140 WP_003899296.1.23153 WP_003899296.1.23171 WP_003899296.1.23199 WP_003899296.1.2320 WP_003899296.1.23204 WP_003899296.1.23216 WP_003899296.1.23229 WP_003899296.1.23233 WP_003899296.1.2326 WP_003899296.1.23261 WP_003899296.1.23272 WP_003899296.1.23289 WP_003899296.1.2329 WP_003899296.1.23308 WP_003899296.1.23316 WP_003899296.1.23321 WP_003899296.1.23325 WP_003899296.1.2339 WP_003899296.1.23406 WP_003899296.1.23438 WP_003899296.1.23445 WP_003899296.1.23447 WP_003899296.1.23452 WP_003899296.1.23461 WP_003899296.1.2349 WP_003899296.1.23496 WP_003899296.1.23497 WP_003899296.1.23506 WP_003899296.1.23530 WP_003899296.1.23539 WP_003899296.1.23546 WP_003899296.1.23551 WP_003899296.1.23573 WP_003899296.1.23583 WP_003899296.1.23628 WP_003899296.1.23677 WP_003899296.1.23683 WP_003899296.1.23692 WP_003899296.1.23694 WP_003899296.1.23699 WP_003899296.1.2371 WP_003899296.1.23803 WP_003899296.1.23807 WP_003899296.1.23825 WP_003899296.1.23832 WP_003899296.1.2384 WP_003899296.1.23843 WP_003899296.1.23863 WP_003899296.1.23894 WP_003899296.1.23993 WP_003899296.1.2400 WP_003899296.1.24007 WP_003899296.1.24008 WP_003899296.1.24046 WP_003899296.1.24057 WP_003899296.1.24062 WP_003899296.1.24113 WP_003899296.1.24119 WP_003899296.1.24128 WP_003899296.1.24140 WP_003899296.1.24176 WP_003899296.1.24190 WP_003899296.1.24202 WP_003899296.1.24244 WP_003899296.1.24261 WP_003899296.1.24284 WP_003899296.1.24294 WP_003899296.1.24357 WP_003899296.1.24396 WP_003899296.1.24414 WP_003899296.1.24423 WP_003899296.1.2443 WP_003899296.1.24446 WP_003899296.1.24461 WP_003899296.1.24500 WP_003899296.1.24507 WP_003899296.1.24529 WP_003899296.1.24553 WP_003899296.1.24599 WP_003899296.1.24629 WP_003899296.1.24638 WP_003899296.1.2466 WP_003899296.1.24767 WP_003899296.1.24824 WP_003899296.1.24831 WP_003899296.1.24840 WP_003899296.1.24848 WP_003899296.1.2487 WP_003899296.1.24893 WP_003899296.1.24907 WP_003899296.1.24933 WP_003899296.1.24956 WP_003899296.1.24958 WP_003899296.1.24985 WP_003899296.1.2499 WP_003899296.1.2505 WP_003899296.1.2507 WP_003899296.1.25103 WP_003899296.1.25129 WP_003899296.1.25171 WP_003899296.1.25184 WP_003899296.1.25247 WP_003899296.1.25252 WP_003899296.1.25278 WP_003899296.1.25283 WP_003899296.1.25309 WP_003899296.1.25313 WP_003899296.1.25338 WP_003899296.1.25342 WP_003899296.1.25343 WP_003899296.1.25367 WP_003899296.1.25393 WP_003899296.1.25406 WP_003899296.1.25435 WP_003899296.1.25437 WP_003899296.1.25445 WP_003899296.1.25455 WP_003899296.1.25473 WP_003899296.1.25504 WP_003899296.1.25513 WP_003899296.1.25542 WP_003899296.1.25579 WP_003899296.1.25594 WP_003899296.1.25606 WP_003899296.1.25645 WP_003899296.1.2566 WP_003899296.1.25673 WP_003899296.1.25674 WP_003899296.1.25699 WP_003899296.1.25736 WP_003899296.1.25738 WP_003899296.1.25756 WP_003899296.1.25759 WP_003899296.1.25813 WP_003899296.1.25853 WP_003899296.1.25854 WP_003899296.1.25874 WP_003899296.1.25885 WP_003899296.1.25892 WP_003899296.1.25906 WP_003899296.1.25914 WP_003899296.1.25916 WP_003899296.1.2594 WP_003899296.1.25965 WP_003899296.1.25972 WP_003899296.1.26017 WP_003899296.1.26032 WP_003899296.1.26038 WP_003899296.1.26072 WP_003899296.1.26089 WP_003899296.1.26098 WP_003899296.1.26118 WP_003899296.1.26126 WP_003899296.1.26168 WP_003899296.1.26182 WP_003899296.1.26190 WP_003899296.1.2620 WP_003899296.1.26234 WP_003899296.1.26243 WP_003899296.1.26265 WP_003899296.1.26267 WP_003899296.1.26292 WP_003899296.1.26310 WP_003899296.1.26328 WP_003899296.1.26349 WP_003899296.1.26366 WP_003899296.1.26374 WP_003899296.1.26407 WP_003899296.1.26412 WP_003899296.1.26454 WP_003899296.1.26464 WP_003899296.1.2653 WP_003899296.1.26571 WP_003899296.1.2659 WP_003899296.1.26597 WP_003899296.1.26603 WP_003899296.1.26629 WP_003899296.1.26651 WP_003899296.1.26702 WP_003899296.1.26707 WP_003899296.1.26710 WP_003899296.1.26719 WP_003899296.1.26737 WP_003899296.1.26738 WP_003899296.1.26745 WP_003899296.1.26756 WP_003899296.1.2676 WP_003899296.1.2677 WP_003899296.1.26779 WP_003899296.1.26780 WP_003899296.1.26798 WP_003899296.1.26854 WP_003899296.1.26868 WP_003899296.1.26876 WP_003899296.1.26888 WP_003899296.1.26945 WP_003899296.1.26959 WP_003899296.1.26969 WP_003899296.1.26984 WP_003899296.1.26992 WP_003899296.1.27004 WP_003899296.1.27017 WP_003899296.1.27045 WP_003899296.1.27074 WP_003899296.1.27075 WP_003899296.1.27128 WP_003899296.1.27130 WP_003899296.1.27139 WP_003899296.1.27152 WP_003899296.1.27162 WP_003899296.1.27164 WP_003899296.1.27193 WP_003899296.1.27235 WP_003899296.1.27254 WP_003899296.1.27278 WP_003899296.1.27343 WP_003899296.1.27352 WP_003899296.1.27369 WP_003899296.1.27391 WP_003899296.1.27398 WP_003899296.1.27402 WP_003899296.1.27410 WP_003899296.1.27411 WP_003899296.1.27449 WP_003899296.1.27460 WP_003899296.1.27463 WP_003899296.1.2749 WP_003899296.1.27492 WP_003899296.1.27528 WP_003899296.1.27541 WP_003899296.1.27576 WP_003899296.1.27582 WP_003899296.1.27596 WP_003899296.1.27607 WP_003899296.1.277 WP_003899296.1.27724 WP_003899296.1.27730 WP_003899296.1.27736 WP_003899296.1.27743 WP_003899296.1.27750 WP_003899296.1.27771 WP_003899296.1.27779 WP_003899296.1.27795 WP_003899296.1.27803 WP_003899296.1.27819 WP_003899296.1.27835 WP_003899296.1.27915 WP_003899296.1.27935 WP_003899296.1.27962 WP_003899296.1.28053 WP_003899296.1.28092 WP_003899296.1.28106 WP_003899296.1.28131 WP_003899296.1.28142 WP_003899296.1.28159 WP_003899296.1.2816 WP_003899296.1.28161 WP_003899296.1.28192 WP_003899296.1.28202 WP_003899296.1.28241 WP_003899296.1.28242 WP_003899296.1.28251 WP_003899296.1.28269 WP_003899296.1.28276 WP_003899296.1.28293 WP_003899296.1.28331 WP_003899296.1.28367 WP_003899296.1.28391 WP_003899296.1.2842 WP_003899296.1.28448 WP_003899296.1.28471 WP_003899296.1.28473 WP_003899296.1.28493 WP_003899296.1.28497 WP_003899296.1.28530 WP_003899296.1.28545 WP_003899296.1.28561 WP_003899296.1.28567 WP_003899296.1.28585 WP_003899296.1.286 WP_003899296.1.28610 WP_003899296.1.28617 WP_003899296.1.28634 WP_003899296.1.28642 WP_003899296.1.28671 WP_003899296.1.28682 WP_003899296.1.28698 WP_003899296.1.28703 WP_003899296.1.28739 WP_003899296.1.28758 WP_003899296.1.28781 WP_003899296.1.28787 WP_003899296.1.28827 WP_003899296.1.28839 WP_003899296.1.28847 WP_003899296.1.28850 WP_003899296.1.28851 WP_003899296.1.28865 WP_003899296.1.28897 WP_003899296.1.28914 WP_003899296.1.28935 WP_003899296.1.28939 WP_003899296.1.28943 WP_003899296.1.28975 WP_003899296.1.28993 WP_003899296.1.2901 WP_003899296.1.29028 WP_003899296.1.29033 WP_003899296.1.29058 WP_003899296.1.29078 WP_003899296.1.29102 WP_003899296.1.29115 WP_003899296.1.2916 WP_003899296.1.29217 WP_003899296.1.29223 WP_003899296.1.29234 WP_003899296.1.29264 WP_003899296.1.29275 WP_003899296.1.29306 WP_003899296.1.29339 WP_003899296.1.29348 WP_003899296.1.29364 WP_003899296.1.29367 WP_003899296.1.29426 WP_003899296.1.2944 WP_003899296.1.29449 WP_003899296.1.29450 WP_003899296.1.29452 WP_003899296.1.2949 WP_003899296.1.29510 WP_003899296.1.29515 WP_003899296.1.29525 WP_003899296.1.2953 WP_003899296.1.29559 WP_003899296.1.29587 WP_003899296.1.2959 WP_003899296.1.29592 WP_003899296.1.29599 WP_003899296.1.29611 WP_003899296.1.29632 WP_003899296.1.29649 WP_003899296.1.2965 WP_003899296.1.29659 WP_003899296.1.2969 WP_003899296.1.29698 WP_003899296.1.29718 WP_003899296.1.29742 WP_003899296.1.29745 WP_003899296.1.29747 WP_003899296.1.29769 WP_003899296.1.29825 WP_003899296.1.29830 WP_003899296.1.29847 WP_003899296.1.29861 WP_003899296.1.29869 WP_003899296.1.29883 WP_003899296.1.29890 WP_003899296.1.299 WP_003899296.1.29931 WP_003899296.1.29960 WP_003899296.1.30014 WP_003899296.1.3004 WP_003899296.1.30040 WP_003899296.1.30074 WP_003899296.1.30097 WP_003899296.1.30101 WP_003899296.1.30106 WP_003899296.1.30114 WP_003899296.1.30126 WP_003899296.1.30131 WP_003899296.1.30138 WP_003899296.1.30139 WP_003899296.1.30145 WP_003899296.1.30211 WP_003899296.1.30224 WP_003899296.1.30235 WP_003899296.1.30237 WP_003899296.1.3027 WP_003899296.1.30279 WP_003899296.1.30282 WP_003899296.1.30283 WP_003899296.1.30288 WP_003899296.1.30291 WP_003899296.1.30363 WP_003899296.1.30374 WP_003899296.1.30404 WP_003899296.1.3043 WP_003899296.1.30433 WP_003899296.1.30438 WP_003899296.1.30462 WP_003899296.1.30464 WP_003899296.1.30468 WP_003899296.1.30500 WP_003899296.1.3057 WP_003899296.1.30574 WP_003899296.1.30628 WP_003899296.1.30641 WP_003899296.1.30642 WP_003899296.1.30661 WP_003899296.1.30669 WP_003899296.1.30683 WP_003899296.1.30699 WP_003899296.1.30709 WP_003899296.1.30713 WP_003899296.1.30716 WP_003899296.1.30719 WP_003899296.1.30730 WP_003899296.1.30732 WP_003899296.1.30736 WP_003899296.1.30745 WP_003899296.1.30760 WP_003899296.1.30791 WP_003899296.1.308 WP_003899296.1.30807 WP_003899296.1.30818 WP_003899296.1.30824 WP_003899296.1.30877 WP_003899296.1.30888 WP_003899296.1.30901 WP_003899296.1.30912 WP_003899296.1.30913 WP_003899296.1.30914 WP_003899296.1.30919 WP_003899296.1.30977 WP_003899296.1.3100 WP_003899296.1.31002 WP_003899296.1.3101 WP_003899296.1.31034 WP_003899296.1.31047 WP_003899296.1.31070 WP_003899296.1.31074 WP_003899296.1.31102 WP_003899296.1.31127 WP_003899296.1.31184 WP_003899296.1.31199 WP_003899296.1.31226 WP_003899296.1.31230 WP_003899296.1.31233 WP_003899296.1.31263 WP_003899296.1.31264 WP_003899296.1.31270 WP_003899296.1.31287 WP_003899296.1.31304 WP_003899296.1.31346 WP_003899296.1.31348 WP_003899296.1.31354 WP_003899296.1.31390 WP_003899296.1.31414 WP_003899296.1.31417 WP_003899296.1.31428 WP_003899296.1.3143 WP_003899296.1.31458 WP_003899296.1.31483 WP_003899296.1.3149 WP_003899296.1.31498 WP_003899296.1.31507 WP_003899296.1.31548 WP_003899296.1.31569 WP_003899296.1.316 WP_003899296.1.31629 WP_003899296.1.31666 WP_003899296.1.31703 WP_003899296.1.31744 WP_003899296.1.31745 WP_003899296.1.31770 WP_003899296.1.31776 WP_003899296.1.31783 WP_003899296.1.318 WP_003899296.1.31840 WP_003899296.1.31880 WP_003899296.1.31911 WP_003899296.1.31930 WP_003899296.1.31932 WP_003899296.1.31955 WP_003899296.1.31985 WP_003899296.1.31991 WP_003899296.1.31995 WP_003899296.1.32004 WP_003899296.1.32039 WP_003899296.1.3204 WP_003899296.1.32045 WP_003899296.1.32071 WP_003899296.1.32098 WP_003899296.1.32132 WP_003899296.1.32157 WP_003899296.1.32164 WP_003899296.1.32179 WP_003899296.1.32198 WP_003899296.1.32297 WP_003899296.1.32317 WP_003899296.1.32383 WP_003899296.1.32403 WP_003899296.1.32416 WP_003899296.1.32433 WP_003899296.1.32461 WP_003899296.1.32482 WP_003899296.1.32503 WP_003899296.1.32556 WP_003899296.1.32562 WP_003899296.1.32569 WP_003899296.1.32592 WP_003899296.1.32620 WP_003899296.1.32647 WP_003899296.1.32653 WP_003899296.1.32654 WP_003899296.1.32695 WP_003899296.1.32706 WP_003899296.1.32716 WP_003899296.1.32738 WP_003899296.1.32752 WP_003899296.1.32780 WP_003899296.1.32781 WP_003899296.1.32793 WP_003899296.1.32799 WP_003899296.1.32822 WP_003899296.1.32833 WP_003899296.1.32862 WP_003899296.1.32880 WP_003899296.1.32909 WP_003899296.1.32935 WP_003899296.1.32974 WP_003899296.1.33007 WP_003899296.1.3302 WP_003899296.1.33028 WP_003899296.1.33035 WP_003899296.1.33044 WP_003899296.1.33054 WP_003899296.1.33141 WP_003899296.1.33148 WP_003899296.1.33155 WP_003899296.1.33168 WP_003899296.1.3321 WP_003899296.1.33215 WP_003899296.1.3325 WP_003899296.1.3327 WP_003899296.1.33278 WP_003899296.1.33288 WP_003899296.1.33305 WP_003899296.1.3331 WP_003899296.1.33319 WP_003899296.1.3333 WP_003899296.1.33393 WP_003899296.1.33403 WP_003899296.1.33452 WP_003899296.1.33467 WP_003899296.1.33477 WP_003899296.1.3349 WP_003899296.1.33519 WP_003899296.1.33542 WP_003899296.1.33601 WP_003899296.1.33602 WP_003899296.1.33633 WP_003899296.1.33646 WP_003899296.1.33673 WP_003899296.1.3369 WP_003899296.1.33705 WP_003899296.1.33762 WP_003899296.1.33783 WP_003899296.1.3383 WP_003899296.1.33832 WP_003899296.1.33839 WP_003899296.1.33848 WP_003899296.1.3387 WP_003899296.1.33886 WP_003899296.1.33895 WP_003899296.1.33906 WP_003899296.1.33912 WP_003899296.1.33954 WP_003899296.1.3399 WP_003899296.1.34042 WP_003899296.1.3405 WP_003899296.1.34055 WP_003899296.1.34056 WP_003899296.1.34065 WP_003899296.1.34090 WP_003899296.1.34109 WP_003899296.1.34111 WP_003899296.1.34131 WP_003899296.1.34152 WP_003899296.1.34153 WP_003899296.1.34181 WP_003899296.1.34197 WP_003899296.1.34198 WP_003899296.1.34215 WP_003899296.1.34219 WP_003899296.1.34260 WP_003899296.1.34275 WP_003899296.1.343 WP_003899296.1.34347 WP_003899296.1.34358 WP_003899296.1.34392 WP_003899296.1.344 WP_003899296.1.34428 WP_003899296.1.3443 WP_003899296.1.34435 WP_003899296.1.34499 WP_003899296.1.34505 WP_003899296.1.34516 WP_003899296.1.34529 WP_003899296.1.34551 WP_003899296.1.34563 WP_003899296.1.34576 WP_003899296.1.34581 WP_003899296.1.34588 WP_003899296.1.34596 WP_003899296.1.34599 WP_003899296.1.34639 WP_003899296.1.34673 WP_003899296.1.34724 WP_003899296.1.34740 WP_003899296.1.34755 WP_003899296.1.34777 WP_003899296.1.34783 WP_003899296.1.34841 WP_003899296.1.34908 WP_003899296.1.34919 WP_003899296.1.3492 WP_003899296.1.34933 WP_003899296.1.34945 WP_003899296.1.34946 WP_003899296.1.34954 WP_003899296.1.34960 WP_003899296.1.34961 WP_003899296.1.34963 WP_003899296.1.34965 WP_003899296.1.34968 WP_003899296.1.35023 WP_003899296.1.35069 WP_003899296.1.35072 WP_003899296.1.35078 WP_003899296.1.35100 WP_003899296.1.35146 WP_003899296.1.35156 WP_003899296.1.35160 WP_003899296.1.35162 WP_003899296.1.35173 WP_003899296.1.35176 WP_003899296.1.3520 WP_003899296.1.35213 WP_003899296.1.35221 WP_003899296.1.35246 WP_003899296.1.35278 WP_003899296.1.35301 WP_003899296.1.35311 WP_003899296.1.35312 WP_003899296.1.35317 WP_003899296.1.35319 WP_003899296.1.35347 WP_003899296.1.35363 WP_003899296.1.35382 WP_003899296.1.35385 WP_003899296.1.35396 WP_003899296.1.35426 WP_003899296.1.35439 WP_003899296.1.3548 WP_003899296.1.35484 WP_003899296.1.35492 WP_003899296.1.3553 WP_003899296.1.35553 WP_003899296.1.35555 WP_003899296.1.35561 WP_003899296.1.35602 WP_003899296.1.35610 WP_003899296.1.35635 WP_003899296.1.35680 WP_003899296.1.35687 WP_003899296.1.35689 WP_003899296.1.35707 WP_003899296.1.35732 WP_003899296.1.35754 WP_003899296.1.35767 WP_003899296.1.35770 WP_003899296.1.35771 WP_003899296.1.35780 WP_003899296.1.35805 WP_003899296.1.35811 WP_003899296.1.35821 WP_003899296.1.3584 WP_003899296.1.35848 WP_003899296.1.35864 WP_003899296.1.35874 WP_003899296.1.35876 WP_003899296.1.35897 WP_003899296.1.35899 WP_003899296.1.35923 WP_003899296.1.3593 WP_003899296.1.35954 WP_003899296.1.36005 WP_003899296.1.36014 WP_003899296.1.36023 WP_003899296.1.36053 WP_003899296.1.36075 WP_003899296.1.36089 WP_003899296.1.36097 WP_003899296.1.36098 WP_003899296.1.36116 WP_003899296.1.36145 WP_003899296.1.36156 WP_003899296.1.36205 WP_003899296.1.36228 WP_003899296.1.36246 WP_003899296.1.36252 WP_003899296.1.36260 WP_003899296.1.36270 WP_003899296.1.36271 WP_003899296.1.36303 WP_003899296.1.36309 WP_003899296.1.36315 WP_003899296.1.36319 WP_003899296.1.36321 WP_003899296.1.36326 WP_003899296.1.3634 WP_003899296.1.36356 WP_003899296.1.36357 WP_003899296.1.3636 WP_003899296.1.36385 WP_003899296.1.36399 WP_003899296.1.36436 WP_003899296.1.36465 WP_003899296.1.36469 WP_003899296.1.36473 WP_003899296.1.36485 WP_003899296.1.36508 WP_003899296.1.36540 WP_003899296.1.36561 WP_003899296.1.36571 WP_003899296.1.36573 WP_003899296.1.36578 WP_003899296.1.36585 WP_003899296.1.36597 WP_003899296.1.36614 WP_003899296.1.36657 WP_003899296.1.36674 WP_003899296.1.36720 WP_003899296.1.36727 WP_003899296.1.36733 WP_003899296.1.36785 WP_003899296.1.36810 WP_003899296.1.36844 WP_003899296.1.36851 WP_003899296.1.36862 WP_003899296.1.36893 WP_003899296.1.36921 WP_003899296.1.36935 WP_003899296.1.36941 WP_003899296.1.3695 WP_003899296.1.36951 WP_003899296.1.36968 WP_003899296.1.3700 WP_003899296.1.37004 WP_003899296.1.37012 WP_003899296.1.37071 WP_003899296.1.37088 WP_003899296.1.37131 WP_003899296.1.37157 WP_003899296.1.37175 WP_003899296.1.37188 WP_003899296.1.37213 WP_003899296.1.37229 WP_003899296.1.3724 WP_003899296.1.37277 WP_003899296.1.37305 WP_003899296.1.37330 WP_003899296.1.37389 WP_003899296.1.37400 WP_003899296.1.37440 WP_003899296.1.37459 WP_003899296.1.37468 WP_003899296.1.37475 WP_003899296.1.37484 WP_003899296.1.37601 WP_003899296.1.37612 WP_003899296.1.37632 WP_003899296.1.37643 WP_003899296.1.37655 WP_003899296.1.37660 WP_003899296.1.37674 WP_003899296.1.37700 WP_003899296.1.37701 WP_003899296.1.37709 WP_003899296.1.37711 WP_003899296.1.37721 WP_003899296.1.37722 WP_003899296.1.37765 WP_003899296.1.37772 WP_003899296.1.37804 WP_003899296.1.37809 WP_003899296.1.37877 WP_003899296.1.37912 WP_003899296.1.37913 WP_003899296.1.37943 WP_003899296.1.37950 WP_003899296.1.37973 WP_003899296.1.37975 WP_003899296.1.37983 WP_003899296.1.38 WP_003899296.1.38002 WP_003899296.1.3802 WP_003899296.1.38039 WP_003899296.1.38040 WP_003899296.1.38067 WP_003899296.1.38068 WP_003899296.1.38135 WP_003899296.1.38138 WP_003899296.1.38144 WP_003899296.1.38158 WP_003899296.1.38159 WP_003899296.1.38210 WP_003899296.1.38240 WP_003899296.1.38299 WP_003899296.1.38332 WP_003899296.1.38347 WP_003899296.1.38354 WP_003899296.1.38380 WP_003899296.1.38384 WP_003899296.1.38389 WP_003899296.1.38398 WP_003899296.1.38402 WP_003899296.1.38418 WP_003899296.1.38421 WP_003899296.1.38466 WP_003899296.1.38483 WP_003899296.1.3849 WP_003899296.1.385 WP_003899296.1.38530 WP_003899296.1.38535 WP_003899296.1.38539 WP_003899296.1.38594 WP_003899296.1.38601 WP_003899296.1.38611 WP_003899296.1.38638 WP_003899296.1.38639 WP_003899296.1.38646 WP_003899296.1.38648 WP_003899296.1.38654 WP_003899296.1.38659 WP_003899296.1.38660 WP_003899296.1.38666 WP_003899296.1.38671 WP_003899296.1.38672 WP_003899296.1.38677 WP_003899296.1.38750 WP_003899296.1.38772 WP_003899296.1.38812 WP_003899296.1.38821 WP_003899296.1.38844 WP_003899296.1.38863 WP_003899296.1.38865 WP_003899296.1.38873 WP_003899296.1.3889 WP_003899296.1.38894 WP_003899296.1.38909 WP_003899296.1.38939 WP_003899296.1.38975 WP_003899296.1.38991 WP_003899296.1.39025 WP_003899296.1.39070 WP_003899296.1.39072 WP_003899296.1.39095 WP_003899296.1.39106 WP_003899296.1.39165 WP_003899296.1.39176 WP_003899296.1.39190 WP_003899296.1.39201 WP_003899296.1.39207 WP_003899296.1.39211 WP_003899296.1.39236 WP_003899296.1.39239 WP_003899296.1.39252 WP_003899296.1.39288 WP_003899296.1.39295 WP_003899296.1.39306 WP_003899296.1.39359 WP_003899296.1.39364 WP_003899296.1.39400 WP_003899296.1.39447 WP_003899296.1.3945 WP_003899296.1.39450 WP_003899296.1.39455 WP_003899296.1.3949 WP_003899296.1.39521 WP_003899296.1.39560 WP_003899296.1.39592 WP_003899296.1.39593 WP_003899296.1.396 WP_003899296.1.3960 WP_003899296.1.39616 WP_003899296.1.39654 WP_003899296.1.39657 WP_003899296.1.39661 WP_003899296.1.39674 WP_003899296.1.39678 WP_003899296.1.3968 WP_003899296.1.39694 WP_003899296.1.3971 WP_003899296.1.39728 WP_003899296.1.39739 WP_003899296.1.39748 WP_003899296.1.39751 WP_003899296.1.39759 WP_003899296.1.39801 WP_003899296.1.39804 WP_003899296.1.39877 WP_003899296.1.39925 WP_003899296.1.3994 WP_003899296.1.39959 WP_003899296.1.3996 WP_003899296.1.39960 WP_003899296.1.3997 WP_003899296.1.39980 WP_003899296.1.40000 WP_003899296.1.40028 WP_003899296.1.40029 WP_003899296.1.4003 WP_003899296.1.40094 WP_003899296.1.40096 WP_003899296.1.40150 WP_003899296.1.40156 WP_003899296.1.40174 WP_003899296.1.40186 WP_003899296.1.40276 WP_003899296.1.40277 WP_003899296.1.40323 WP_003899296.1.40336 WP_003899296.1.40353 WP_003899296.1.4036 WP_003899296.1.40372 WP_003899296.1.40402 WP_003899296.1.40413 WP_003899296.1.40440 WP_003899296.1.40446 WP_003899296.1.40451 WP_003899296.1.40455 WP_003899296.1.40523 WP_003899296.1.40543 WP_003899296.1.40641 WP_003899296.1.40646 WP_003899296.1.40651 WP_003899296.1.40653 WP_003899296.1.4067 WP_003899296.1.40705 WP_003899296.1.40723 WP_003899296.1.40731 WP_003899296.1.40735 WP_003899296.1.40795 WP_003899296.1.40799 WP_003899296.1.40852 WP_003899296.1.40876 WP_003899296.1.40881 WP_003899296.1.40922 WP_003899296.1.40948 WP_003899296.1.4095 WP_003899296.1.40956 WP_003899296.1.40957 WP_003899296.1.40964 WP_003899296.1.4097 WP_003899296.1.410 WP_003899296.1.41000 WP_003899296.1.41055 WP_003899296.1.41123 WP_003899296.1.41177 WP_003899296.1.41202 WP_003899296.1.41219 WP_003899296.1.41231 WP_003899296.1.41249 WP_003899296.1.4127 WP_003899296.1.41296 WP_003899296.1.41355 WP_003899296.1.41376 WP_003899296.1.41430 WP_003899296.1.41447 WP_003899296.1.41469 WP_003899296.1.41504 WP_003899296.1.41564 WP_003899296.1.41583 WP_003899296.1.41632 WP_003899296.1.41635 WP_003899296.1.41636 WP_003899296.1.41648 WP_003899296.1.41660 WP_003899296.1.41685 WP_003899296.1.41695 WP_003899296.1.41704 WP_003899296.1.4171 WP_003899296.1.41719 WP_003899296.1.41733 WP_003899296.1.41744 WP_003899296.1.41774 WP_003899296.1.41791 WP_003899296.1.41803 WP_003899296.1.41820 WP_003899296.1.41828 WP_003899296.1.41829 WP_003899296.1.41860 WP_003899296.1.41912 WP_003899296.1.41921 WP_003899296.1.41933 WP_003899296.1.41944 WP_003899296.1.42043 WP_003899296.1.42075 WP_003899296.1.42078 WP_003899296.1.42094 WP_003899296.1.42112 WP_003899296.1.4212 WP_003899296.1.42122 WP_003899296.1.42134 WP_003899296.1.42183 WP_003899296.1.42188 WP_003899296.1.42201 WP_003899296.1.42202 WP_003899296.1.42208 WP_003899296.1.42247 WP_003899296.1.42255 WP_003899296.1.42273 WP_003899296.1.42278 WP_003899296.1.42304 WP_003899296.1.42309 WP_003899296.1.42370 WP_003899296.1.42385 WP_003899296.1.42400 WP_003899296.1.42409 WP_003899296.1.42414 WP_003899296.1.42417 WP_003899296.1.42430 WP_003899296.1.42461 WP_003899296.1.42465 WP_003899296.1.42467 WP_003899296.1.42473 WP_003899296.1.42474 WP_003899296.1.42494 WP_003899296.1.42519 WP_003899296.1.42524 WP_003899296.1.42534 WP_003899296.1.4255 WP_003899296.1.42562 WP_003899296.1.42568 WP_003899296.1.42570 WP_003899296.1.42618 WP_003899296.1.42660 WP_003899296.1.42695 WP_003899296.1.42704 WP_003899296.1.42705 WP_003899296.1.42722 WP_003899296.1.42777 WP_003899296.1.42835 WP_003899296.1.42839 WP_003899296.1.42842 WP_003899296.1.42905 WP_003899296.1.42916 WP_003899296.1.42930 WP_003899296.1.42971 WP_003899296.1.43005 WP_003899296.1.43009 WP_003899296.1.43053 WP_003899296.1.43082 WP_003899296.1.43087 WP_003899296.1.43098 WP_003899296.1.43208 WP_003899296.1.43236 WP_003899296.1.43246 WP_003899296.1.43255 WP_003899296.1.43266 WP_003899296.1.43269 WP_003899296.1.43273 WP_003899296.1.43296 WP_003899296.1.4335 WP_003899296.1.43368 WP_003899296.1.43395 WP_003899296.1.43462 WP_003899296.1.43475 WP_003899296.1.43478 WP_003899296.1.43484 WP_003899296.1.43557 WP_003899296.1.43578 WP_003899296.1.43588 WP_003899296.1.43643 WP_003899296.1.43664 WP_003899296.1.43684 WP_003899296.1.43686 WP_003899296.1.43706 WP_003899296.1.43716 WP_003899296.1.43781 WP_003899296.1.43794 WP_003899296.1.43815 WP_003899296.1.43846 WP_003899296.1.43861 WP_003899296.1.43863 WP_003899296.1.43866 WP_003899296.1.43872 WP_003899296.1.43885 WP_003899296.1.43897 WP_003899296.1.4390 WP_003899296.1.43902 WP_003899296.1.43921 WP_003899296.1.43936 WP_003899296.1.43937 WP_003899296.1.43960 WP_003899296.1.43965 WP_003899296.1.4399 WP_003899296.1.43993 WP_003899296.1.43996 WP_003899296.1.44 WP_003899296.1.44008 WP_003899296.1.44016 WP_003899296.1.44033 WP_003899296.1.44041 WP_003899296.1.44071 WP_003899296.1.44076 WP_003899296.1.44104 WP_003899296.1.44111 WP_003899296.1.44124 WP_003899296.1.44169 WP_003899296.1.44219 WP_003899296.1.44237 WP_003899296.1.44277 WP_003899296.1.44279 WP_003899296.1.44336 WP_003899296.1.44355 WP_003899296.1.44358 WP_003899296.1.4438 WP_003899296.1.44392 WP_003899296.1.4441 WP_003899296.1.44415 WP_003899296.1.44464 WP_003899296.1.44466 WP_003899296.1.44489 WP_003899296.1.44492 WP_003899296.1.44494 WP_003899296.1.44500 WP_003899296.1.44519 WP_003899296.1.44526 WP_003899296.1.44532 WP_003899296.1.44534 WP_003899296.1.44562 WP_003899296.1.44589 WP_003899296.1.44597 WP_003899296.1.44600 WP_003899296.1.44602 WP_003899296.1.44615 WP_003899296.1.4464 WP_003899296.1.44651 WP_003899296.1.44659 WP_003899296.1.44665 WP_003899296.1.44694 WP_003899296.1.44700 WP_003899296.1.44713 WP_003899296.1.44735 WP_003899296.1.44740 WP_003899296.1.44757 WP_003899296.1.4476 WP_003899296.1.44761 WP_003899296.1.44767 WP_003899296.1.44776 WP_003899296.1.44779 WP_003899296.1.44786 WP_003899296.1.44808 WP_003899296.1.44864 WP_003899296.1.44901 WP_003899296.1.44908 WP_003899296.1.44913 WP_003899296.1.4492 WP_003899296.1.44939 WP_003899296.1.44979 WP_003899296.1.44981 WP_003899296.1.45002 WP_003899296.1.45011 WP_003899296.1.4504 WP_003899296.1.45066 WP_003899296.1.45081 WP_003899296.1.45113 WP_003899296.1.45129 WP_003899296.1.45135 WP_003899296.1.45147 WP_003899296.1.45168 WP_003899296.1.4517 WP_003899296.1.45181 WP_003899296.1.45185 WP_003899296.1.45192 WP_003899296.1.45200 WP_003899296.1.45205 WP_003899296.1.45211 WP_003899296.1.45249 WP_003899296.1.4526 WP_003899296.1.45286 WP_003899296.1.45326 WP_003899296.1.45347 WP_003899296.1.45374 WP_003899296.1.45390 WP_003899296.1.454 WP_003899296.1.45407 WP_003899296.1.45451 WP_003899296.1.45453 WP_003899296.1.45460 WP_003899296.1.45463 WP_003899296.1.45470 WP_003899296.1.45474 WP_003899296.1.45491 WP_003899296.1.45510 WP_003899296.1.45563 WP_003899296.1.45584 WP_003899296.1.45590 WP_003899296.1.45619 WP_003899296.1.45626 WP_003899296.1.45631 WP_003899296.1.45666 WP_003899296.1.45697 WP_003899296.1.4571 WP_003899296.1.45731 WP_003899296.1.45743 WP_003899296.1.45765 WP_003899296.1.45776 WP_003899296.1.45783 WP_003899296.1.45805 WP_003899296.1.45815 WP_003899296.1.45849 WP_003899296.1.45867 WP_003899296.1.45884 WP_003899296.1.45923 WP_003899296.1.45926 WP_003899296.1.45963 WP_003899296.1.45989 WP_003899296.1.45992 WP_003899296.1.46025 WP_003899296.1.46083 WP_003899296.1.46090 WP_003899296.1.46092 WP_003899296.1.46101 WP_003899296.1.46107 WP_003899296.1.46127 WP_003899296.1.46128 WP_003899296.1.46129 WP_003899296.1.46141 WP_003899296.1.46150 WP_003899296.1.46201 WP_003899296.1.46226 WP_003899296.1.46253 WP_003899296.1.46268 WP_003899296.1.46285 WP_003899296.1.46300 WP_003899296.1.46336 WP_003899296.1.46365 WP_003899296.1.46370 WP_003899296.1.46381 WP_003899296.1.46402 WP_003899296.1.46411 WP_003899296.1.4644 WP_003899296.1.46442 WP_003899296.1.46453 WP_003899296.1.46463 WP_003899296.1.46478 WP_003899296.1.46492 WP_003899296.1.46521 WP_003899296.1.4653 WP_003899296.1.46532 WP_003899296.1.46539 WP_003899296.1.46568 WP_003899296.1.46585 WP_003899296.1.46609 WP_003899296.1.46613 WP_003899296.1.46625 WP_003899296.1.46642 WP_003899296.1.46647 WP_003899296.1.46674 WP_003899296.1.46773 WP_003899296.1.46786 WP_003899296.1.46792 WP_003899296.1.46847 WP_003899296.1.46851 WP_003899296.1.4687 WP_003899296.1.46897 WP_003899296.1.46936 WP_003899296.1.46980 WP_003899296.1.47011 WP_003899296.1.47012 WP_003899296.1.47066 WP_003899296.1.47106 WP_003899296.1.47142 WP_003899296.1.47147 WP_003899296.1.47166 WP_003899296.1.47194 WP_003899296.1.47207 WP_003899296.1.47210 WP_003899296.1.47261 WP_003899296.1.47262 WP_003899296.1.47402 WP_003899296.1.47423 WP_003899296.1.47467 WP_003899296.1.47502 WP_003899296.1.4751 WP_003899296.1.47511 WP_003899296.1.47540 WP_003899296.1.47568 WP_003899296.1.47572 WP_003899296.1.47588 WP_003899296.1.47636 WP_003899296.1.4764 WP_003899296.1.47653 WP_003899296.1.47679 WP_003899296.1.47690 WP_003899296.1.4771 WP_003899296.1.47717 WP_003899296.1.47743 WP_003899296.1.47754 WP_003899296.1.47773 WP_003899296.1.47776 WP_003899296.1.47780 WP_003899296.1.47805 WP_003899296.1.47832 WP_003899296.1.47847 WP_003899296.1.47858 WP_003899296.1.47861 WP_003899296.1.47868 WP_003899296.1.47893 WP_003899296.1.47899 WP_003899296.1.479 WP_003899296.1.47912 WP_003899296.1.47913 WP_003899296.1.47926 WP_003899296.1.4794 WP_003899296.1.47943 WP_003899296.1.47944 WP_003899296.1.47959 WP_003899296.1.47974 WP_003899296.1.47993 WP_003899296.1.48004 WP_003899296.1.48039 WP_003899296.1.48050 WP_003899296.1.48084 WP_003899296.1.48097 WP_003899296.1.48101 WP_003899296.1.48109 WP_003899296.1.4813 WP_003899296.1.48130 WP_003899296.1.48135 WP_003899296.1.48152 WP_003899296.1.48155 WP_003899296.1.48170 WP_003899296.1.48173 WP_003899296.1.48177 WP_003899296.1.48185 WP_003899296.1.48219 WP_003899296.1.4823 WP_003899296.1.48240 WP_003899296.1.48256 WP_003899296.1.48264 WP_003899296.1.48287 WP_003899296.1.48330 WP_003899296.1.48333 WP_003899296.1.48348 WP_003899296.1.48354 WP_003899296.1.48372 WP_003899296.1.48383 WP_003899296.1.48388 WP_003899296.1.48423 WP_003899296.1.48443 WP_003899296.1.48450 WP_003899296.1.48543 WP_003899296.1.48550 WP_003899296.1.48605 WP_003899296.1.4863 WP_003899296.1.48648 WP_003899296.1.48658 WP_003899296.1.48666 WP_003899296.1.48687 WP_003899296.1.48779 WP_003899296.1.4878 WP_003899296.1.48798 WP_003899296.1.48802 WP_003899296.1.48826 WP_003899296.1.48843 WP_003899296.1.48857 WP_003899296.1.4890 WP_003899296.1.48946 WP_003899296.1.48979 WP_003899296.1.49017 WP_003899296.1.49048 WP_003899296.1.4906 WP_003899296.1.4907 WP_003899296.1.49103 WP_003899296.1.49110 WP_003899296.1.49111 WP_003899296.1.4919 WP_003899296.1.49251 WP_003899296.1.49254 WP_003899296.1.49263 WP_003899296.1.49291 WP_003899296.1.49296 WP_003899296.1.49335 WP_003899296.1.49337 WP_003899296.1.49419 WP_003899296.1.49426 WP_003899296.1.49437 WP_003899296.1.49439 WP_003899296.1.49474 WP_003899296.1.49506 WP_003899296.1.49516 WP_003899296.1.49523 WP_003899296.1.49526 WP_003899296.1.49532 WP_003899296.1.49588 WP_003899296.1.4959 WP_003899296.1.49687 WP_003899296.1.49699 WP_003899296.1.49709 WP_003899296.1.4971 WP_003899296.1.4972 WP_003899296.1.49746 WP_003899296.1.49764 WP_003899296.1.49773 WP_003899296.1.49796 WP_003899296.1.49814 WP_003899296.1.49815 WP_003899296.1.49816 WP_003899296.1.49839 WP_003899296.1.49857 WP_003899296.1.49878 WP_003899296.1.49880 WP_003899296.1.49944 WP_003899296.1.4999 WP_003899296.1.50068 WP_003899296.1.5008 WP_003899296.1.50081 WP_003899296.1.50122 WP_003899296.1.50126 WP_003899296.1.50149 WP_003899296.1.50162 WP_003899296.1.5018 WP_003899296.1.50194 WP_003899296.1.50218 WP_003899296.1.50235 WP_003899296.1.50249 WP_003899296.1.50265 WP_003899296.1.50271 WP_003899296.1.50324 WP_003899296.1.50347 WP_003899296.1.50372 WP_003899296.1.50398 WP_003899296.1.50407 WP_003899296.1.50444 WP_003899296.1.50466 WP_003899296.1.50472 WP_003899296.1.5048 WP_003899296.1.50498 WP_003899296.1.5050 WP_003899296.1.50540 WP_003899296.1.50554 WP_003899296.1.50557 WP_003899296.1.50610 WP_003899296.1.50632 WP_003899296.1.50633 WP_003899296.1.50642 WP_003899296.1.50655 WP_003899296.1.50659 WP_003899296.1.50683 WP_003899296.1.50689 WP_003899296.1.50692 WP_003899296.1.50714 WP_003899296.1.50729 WP_003899296.1.50756 WP_003899296.1.50784 WP_003899296.1.50794 WP_003899296.1.50841 WP_003899296.1.50860 WP_003899296.1.50868 WP_003899296.1.50877 WP_003899296.1.5096 WP_003899296.1.50981 WP_003899296.1.50987 WP_003899296.1.51009 WP_003899296.1.51037 WP_003899296.1.51074 WP_003899296.1.51082 WP_003899296.1.51101 WP_003899296.1.51116 WP_003899296.1.51149 WP_003899296.1.51156 WP_003899296.1.51157 WP_003899296.1.51213 WP_003899296.1.51232 WP_003899296.1.51247 WP_003899296.1.51266 WP_003899296.1.51279 WP_003899296.1.51291 WP_003899296.1.51301 WP_003899296.1.51329 WP_003899296.1.51391 WP_003899296.1.51422 WP_003899296.1.51445 WP_003899296.1.51455 WP_003899296.1.51466 WP_003899296.1.51468 WP_003899296.1.51478 WP_003899296.1.51497 WP_003899296.1.51520 WP_003899296.1.51593 WP_003899296.1.51628 WP_003899296.1.5164 WP_003899296.1.51647 WP_003899296.1.51660 WP_003899296.1.51696 WP_003899296.1.51721 WP_003899296.1.51788 WP_003899296.1.51795 WP_003899296.1.51801 WP_003899296.1.51817 WP_003899296.1.51819 WP_003899296.1.51854 WP_003899296.1.51923 WP_003899296.1.51942 WP_003899296.1.51948 WP_003899296.1.51963 WP_003899296.1.51969 WP_003899296.1.52000 WP_003899296.1.52001 WP_003899296.1.52003 WP_003899296.1.52006 WP_003899296.1.52036 WP_003899296.1.52038 WP_003899296.1.52046 WP_003899296.1.52059 WP_003899296.1.52069 WP_003899296.1.52082 WP_003899296.1.52102 WP_003899296.1.52106 WP_003899296.1.52166 WP_003899296.1.52168 WP_003899296.1.52173 WP_003899296.1.52178 WP_003899296.1.52206 WP_003899296.1.52216 WP_003899296.1.52238 WP_003899296.1.52241 WP_003899296.1.52280 WP_003899296.1.52314 WP_003899296.1.52385 WP_003899296.1.52390 WP_003899296.1.524 WP_003899296.1.52460 WP_003899296.1.52485 WP_003899296.1.52486 WP_003899296.1.52495 WP_003899296.1.52504 WP_003899296.1.52522 WP_003899296.1.52531 WP_003899296.1.52533 WP_003899296.1.52545 WP_003899296.1.52553 WP_003899296.1.52563 WP_003899296.1.52564 WP_003899296.1.52574 WP_003899296.1.52641 WP_003899296.1.52673 WP_003899296.1.52674 WP_003899296.1.52708 WP_003899296.1.52713 WP_003899296.1.52761 WP_003899296.1.52778 WP_003899296.1.52791 WP_003899296.1.52797 WP_003899296.1.52818 WP_003899296.1.52872 WP_003899296.1.52873 WP_003899296.1.52891 WP_003899296.1.52892 WP_003899296.1.52909 WP_003899296.1.52970 WP_003899296.1.52998 WP_003899296.1.53053 WP_003899296.1.53056 WP_003899296.1.5306 WP_003899296.1.53088 WP_003899296.1.5309 WP_003899296.1.531 WP_003899296.1.53117 WP_003899296.1.53118 WP_003899296.1.53142 WP_003899296.1.53143 WP_003899296.1.53157 WP_003899296.1.53167 WP_003899296.1.53200 WP_003899296.1.53204 WP_003899296.1.53213 WP_003899296.1.53217 WP_003899296.1.53226 WP_003899296.1.53229 WP_003899296.1.53230 WP_003899296.1.53237 WP_003899296.1.53254 WP_003899296.1.53257 WP_003899296.1.5327 WP_003899296.1.53276 WP_003899296.1.53278 WP_003899296.1.53302 WP_003899296.1.53306 WP_003899296.1.5334 WP_003899296.1.5335 WP_003899296.1.53353 WP_003899296.1.53381 WP_003899296.1.53413 WP_003899296.1.53458 WP_003899296.1.53460 WP_003899296.1.53480 WP_003899296.1.53517 WP_003899296.1.53522 WP_003899296.1.53525 WP_003899296.1.53526 WP_003899296.1.53553 WP_003899296.1.53606 WP_003899296.1.53609 WP_003899296.1.53628 WP_003899296.1.53643 WP_003899296.1.53667 WP_003899296.1.53679 WP_003899296.1.53715 WP_003899296.1.53730 WP_003899296.1.53742 WP_003899296.1.53743 WP_003899296.1.53754 WP_003899296.1.53775 WP_003899296.1.53787 WP_003899296.1.53803 WP_003899296.1.53818 WP_003899296.1.53822 WP_003899296.1.53853 WP_003899296.1.53865 WP_003899296.1.53888 WP_003899296.1.53912 WP_003899296.1.53914 WP_003899296.1.53973 WP_003899296.1.5398 WP_003899296.1.54089 WP_003899296.1.54093 WP_003899296.1.54099 WP_003899296.1.54112 WP_003899296.1.54125 WP_003899296.1.54141 WP_003899296.1.54162 WP_003899296.1.54179 WP_003899296.1.54218 WP_003899296.1.54225 WP_003899296.1.54227 WP_003899296.1.54232 WP_003899296.1.54241 WP_003899296.1.54247 WP_003899296.1.54260 WP_003899296.1.54275 WP_003899296.1.54280 WP_003899296.1.5429 WP_003899296.1.54294 WP_003899296.1.54314 WP_003899296.1.54347 WP_003899296.1.54351 WP_003899296.1.54370 WP_003899296.1.54428 WP_003899296.1.54449 WP_003899296.1.54494 WP_003899296.1.54502 WP_003899296.1.54514 WP_003899296.1.54519 WP_003899296.1.5452 WP_003899296.1.54531 WP_003899296.1.54537 WP_003899296.1.54553 WP_003899296.1.54555 WP_003899296.1.54575 WP_003899296.1.54633 WP_003899296.1.54686 WP_003899296.1.54687 WP_003899296.1.54705 WP_003899296.1.54730 WP_003899296.1.54732 WP_003899296.1.5475 WP_003899296.1.54797 WP_003899296.1.54807 WP_003899296.1.54836 WP_003899296.1.54838 WP_003899296.1.54860 WP_003899296.1.54888 WP_003899296.1.54897 WP_003899296.1.54905 WP_003899296.1.54909 WP_003899296.1.54937 WP_003899296.1.54939 WP_003899296.1.54944 WP_003899296.1.54945 WP_003899296.1.54953 WP_003899296.1.54964 WP_003899296.1.55015 WP_003899296.1.55022 WP_003899296.1.55023 WP_003899296.1.55051 WP_003899296.1.55072 WP_003899296.1.55088 WP_003899296.1.55106 WP_003899296.1.55126 WP_003899296.1.55128 WP_003899296.1.55140 WP_003899296.1.55150 WP_003899296.1.55210 WP_003899296.1.55227 WP_003899296.1.55248 WP_003899296.1.55257 WP_003899296.1.55258 WP_003899296.1.55267 WP_003899296.1.55279 WP_003899296.1.55307 WP_003899296.1.55326 WP_003899296.1.55328 WP_003899296.1.5533 WP_003899296.1.55345 WP_003899296.1.55396 WP_003899296.1.55398 WP_003899296.1.55441 WP_003899296.1.55459 WP_003899296.1.55501 WP_003899296.1.55504 WP_003899296.1.55578 WP_003899296.1.55626 WP_003899296.1.55641 WP_003899296.1.5569 WP_003899296.1.55723 WP_003899296.1.55735 WP_003899296.1.5574 WP_003899296.1.55772 WP_003899296.1.55802 WP_003899296.1.55807 WP_003899296.1.55819 WP_003899296.1.55821 WP_003899296.1.5583 WP_003899296.1.55849 WP_003899296.1.55856 WP_003899296.1.55882 WP_003899296.1.55883 WP_003899296.1.55894 WP_003899296.1.55902 WP_003899296.1.55909 WP_003899296.1.5591 WP_003899296.1.55961 WP_003899296.1.55977 WP_003899296.1.55983 WP_003899296.1.56028 WP_003899296.1.56057 WP_003899296.1.56060 WP_003899296.1.56107 WP_003899296.1.56132 WP_003899296.1.56163 WP_003899296.1.56167 WP_003899296.1.56178 WP_003899296.1.56287 WP_003899296.1.56292 WP_003899296.1.56327 WP_003899296.1.56341 WP_003899296.1.56359 WP_003899296.1.56365 WP_003899296.1.56394 WP_003899296.1.56443 WP_003899296.1.56473 WP_003899296.1.56478 WP_003899296.1.56500 WP_003899296.1.56517 WP_003899296.1.56534 WP_003899296.1.5656 WP_003899296.1.56577 WP_003899296.1.56593 WP_003899296.1.56625 WP_003899296.1.56637 WP_003899296.1.56670 WP_003899296.1.56697 WP_003899296.1.567 WP_003899296.1.56701 WP_003899296.1.56709 WP_003899296.1.56729 WP_003899296.1.56743 WP_003899296.1.56764 WP_003899296.1.56769 WP_003899296.1.56770 WP_003899296.1.56795 WP_003899296.1.5681 WP_003899296.1.56827 WP_003899296.1.56839 WP_003899296.1.56863 WP_003899296.1.56868 WP_003899296.1.56869 WP_003899296.1.56915 WP_003899296.1.56926 WP_003899296.1.56961 WP_003899296.1.56971 WP_003899296.1.56972 WP_003899296.1.57023 WP_003899296.1.57035 WP_003899296.1.57077 WP_003899296.1.57087 WP_003899296.1.57094 WP_003899296.1.57134 WP_003899296.1.57151 WP_003899296.1.57169 WP_003899296.1.57208 WP_003899296.1.57212 WP_003899296.1.57230 WP_003899296.1.5724 WP_003899296.1.5725 WP_003899296.1.5727 WP_003899296.1.57273 WP_003899296.1.573 WP_003899296.1.57314 WP_003899296.1.57326 WP_003899296.1.57328 WP_003899296.1.57331 WP_003899296.1.57351 WP_003899296.1.57352 WP_003899296.1.57380 WP_003899296.1.57430 WP_003899296.1.5744 WP_003899296.1.57440 WP_003899296.1.5745 WP_003899296.1.57461 WP_003899296.1.57469 WP_003899296.1.57489 WP_003899296.1.575 WP_003899296.1.57509 WP_003899296.1.57519 WP_003899296.1.57525 WP_003899296.1.57551 WP_003899296.1.5758 WP_003899296.1.57596 WP_003899296.1.57604 WP_003899296.1.57616 WP_003899296.1.57617 WP_003899296.1.57619 WP_003899296.1.57627 WP_003899296.1.57642 WP_003899296.1.57658 WP_003899296.1.57667 WP_003899296.1.57675 WP_003899296.1.57689 WP_003899296.1.57708 WP_003899296.1.57794 WP_003899296.1.57821 WP_003899296.1.57825 WP_003899296.1.57843 WP_003899296.1.57906 WP_003899296.1.57924 WP_003899296.1.57926 WP_003899296.1.57930 WP_003899296.1.57957 WP_003899296.1.57960 WP_003899296.1.57964 WP_003899296.1.57991 WP_003899296.1.58000 WP_003899296.1.58086 WP_003899296.1.58101 WP_003899296.1.58103 WP_003899296.1.58108 WP_003899296.1.5811 WP_003899296.1.58121 WP_003899296.1.58145 WP_003899296.1.58164 WP_003899296.1.58174 WP_003899296.1.582 WP_003899296.1.58202 WP_003899296.1.5824 WP_003899296.1.58259 WP_003899296.1.58283 WP_003899296.1.58288 WP_003899296.1.5830 WP_003899296.1.58303 WP_003899296.1.58311 WP_003899296.1.58330 WP_003899296.1.58359 WP_003899296.1.58386 WP_003899296.1.58393 WP_003899296.1.58431 WP_003899296.1.5844 WP_003899296.1.58488 WP_003899296.1.58518 WP_003899296.1.58534 WP_003899296.1.58559 WP_003899296.1.58567 WP_003899296.1.58573 WP_003899296.1.58602 WP_003899296.1.58619 WP_003899296.1.58630 WP_003899296.1.5865 WP_003899296.1.58671 WP_003899296.1.58690 WP_003899296.1.58702 WP_003899296.1.58743 WP_003899296.1.58754 WP_003899296.1.5879 WP_003899296.1.5881 WP_003899296.1.58848 WP_003899296.1.58857 WP_003899296.1.58891 WP_003899296.1.58892 WP_003899296.1.5890 WP_003899296.1.58921 WP_003899296.1.58939 WP_003899296.1.58941 WP_003899296.1.58953 WP_003899296.1.5898 WP_003899296.1.59025 WP_003899296.1.59029 WP_003899296.1.59037 WP_003899296.1.59044 WP_003899296.1.59085 WP_003899296.1.59088 WP_003899296.1.59130 WP_003899296.1.5914 WP_003899296.1.59147 WP_003899296.1.59166 WP_003899296.1.59205 WP_003899296.1.59209 WP_003899296.1.59237 WP_003899296.1.59240 WP_003899296.1.59253 WP_003899296.1.59254 WP_003899296.1.59262 WP_003899296.1.59270 WP_003899296.1.5928 WP_003899296.1.59304 WP_003899296.1.59305 WP_003899296.1.59309 WP_003899296.1.59316 WP_003899296.1.59326 WP_003899296.1.59328 WP_003899296.1.59333 WP_003899296.1.59338 WP_003899296.1.59388 WP_003899296.1.59428 WP_003899296.1.59487 WP_003899296.1.59537 WP_003899296.1.59561 WP_003899296.1.59677 WP_003899296.1.59722 WP_003899296.1.59732 WP_003899296.1.59738 WP_003899296.1.59750 WP_003899296.1.59757 WP_003899296.1.59808 WP_003899296.1.59850 WP_003899296.1.59856 WP_003899296.1.59860 WP_003899296.1.59861 WP_003899296.1.5987 WP_003899296.1.59878 WP_003899296.1.59888 WP_003899296.1.59952 WP_003899296.1.5996 WP_003899296.1.59961 WP_003899296.1.59974 WP_003899296.1.6000 WP_003899296.1.60007 WP_003899296.1.60016 WP_003899296.1.6003 WP_003899296.1.60047 WP_003899296.1.6007 WP_003899296.1.60091 WP_003899296.1.60121 WP_003899296.1.60125 WP_003899296.1.60135 WP_003899296.1.60139 WP_003899296.1.60152 WP_003899296.1.60171 WP_003899296.1.60197 WP_003899296.1.6020 WP_003899296.1.60205 WP_003899296.1.60207 WP_003899296.1.60215 WP_003899296.1.60267 WP_003899296.1.60288 WP_003899296.1.60291 WP_003899296.1.60301 WP_003899296.1.60305 WP_003899296.1.60312 WP_003899296.1.60313 WP_003899296.1.60314 WP_003899296.1.60413 WP_003899296.1.60421 WP_003899296.1.60451 WP_003899296.1.60460 WP_003899296.1.60479 WP_003899296.1.60487 WP_003899296.1.60512 WP_003899296.1.60573 WP_003899296.1.60583 WP_003899296.1.60632 WP_003899296.1.60657 WP_003899296.1.60687 WP_003899296.1.60689 WP_003899296.1.60727 WP_003899296.1.60738 WP_003899296.1.60763 WP_003899296.1.6077 WP_003899296.1.60791 WP_003899296.1.60834 WP_003899296.1.60870 WP_003899296.1.60878 WP_003899296.1.60879 WP_003899296.1.60913 WP_003899296.1.60978 WP_003899296.1.61000 WP_003899296.1.61001 WP_003899296.1.61012 WP_003899296.1.61014 WP_003899296.1.61015 WP_003899296.1.61037 WP_003899296.1.61052 WP_003899296.1.61065 WP_003899296.1.61100 WP_003899296.1.61101 WP_003899296.1.61138 WP_003899296.1.61142 WP_003899296.1.61198 WP_003899296.1.612 WP_003899296.1.61234 WP_003899296.1.61256 WP_003899296.1.61281 WP_003899296.1.61314 WP_003899296.1.61321 WP_003899296.1.61326 WP_003899296.1.61328 WP_003899296.1.61368 WP_003899296.1.61391 WP_003899296.1.61406 WP_003899296.1.61409 WP_003899296.1.61420 WP_003899296.1.61422 WP_003899296.1.61425 WP_003899296.1.61428 WP_003899296.1.61469 WP_003899296.1.61494 WP_003899296.1.61522 WP_003899296.1.61552 WP_003899296.1.61557 WP_003899296.1.61567 WP_003899296.1.61571 WP_003899296.1.61573 WP_003899296.1.61584 WP_003899296.1.61586 WP_003899296.1.6159 WP_003899296.1.61592 WP_003899296.1.6160 WP_003899296.1.61614 WP_003899296.1.6163 WP_003899296.1.61655 WP_003899296.1.61665 WP_003899296.1.61669 WP_003899296.1.61682 WP_003899296.1.61692 WP_003899296.1.61719 WP_003899296.1.61728 WP_003899296.1.61750 WP_003899296.1.61754 WP_003899296.1.61755 WP_003899296.1.61757 WP_003899296.1.61778 WP_003899296.1.6179 WP_003899296.1.61793 WP_003899296.1.61816 WP_003899296.1.61842 WP_003899296.1.61862 WP_003899296.1.61865 WP_003899296.1.61868 WP_003899296.1.61911 WP_003899296.1.61925 WP_003899296.1.61941 WP_003899296.1.61953 WP_003899296.1.61986 WP_003899296.1.61987 WP_003899296.1.61998 WP_003899296.1.62021 WP_003899296.1.62087 WP_003899296.1.62089 WP_003899296.1.62101 WP_003899296.1.62104 WP_003899296.1.6211 WP_003899296.1.62132 WP_003899296.1.62162 WP_003899296.1.62225 WP_003899296.1.62238 WP_003899296.1.62249 WP_003899296.1.62270 WP_003899296.1.62281 WP_003899296.1.62307 WP_003899296.1.6231 WP_003899296.1.62359 WP_003899296.1.62360 WP_003899296.1.62371 WP_003899296.1.62379 WP_003899296.1.62395 WP_003899296.1.62408 WP_003899296.1.62449 WP_003899296.1.62468 WP_003899296.1.6248 WP_003899296.1.62508 WP_003899296.1.62565 WP_003899296.1.62594 WP_003899296.1.62606 WP_003899296.1.62616 WP_003899296.1.62687 WP_003899296.1.62715 WP_003899296.1.62730 WP_003899296.1.62738 WP_003899296.1.62761 WP_003899296.1.62766 WP_003899296.1.62786 WP_003899296.1.62813 WP_003899296.1.62839 WP_003899296.1.62909 WP_003899296.1.62936 WP_003899296.1.6294 WP_003899296.1.6295 WP_003899296.1.62962 WP_003899296.1.63007 WP_003899296.1.63019 WP_003899296.1.63032 WP_003899296.1.63037 WP_003899296.1.63064 WP_003899296.1.63066 WP_003899296.1.63072 WP_003899296.1.6308 WP_003899296.1.63081 WP_003899296.1.63096 WP_003899296.1.63106 WP_003899296.1.6314 WP_003899296.1.63144 WP_003899296.1.63154 WP_003899296.1.63160 WP_003899296.1.63161 WP_003899296.1.63194 WP_003899296.1.6322 WP_003899296.1.63222 WP_003899296.1.63247 WP_003899296.1.6328 WP_003899296.1.63291 WP_003899296.1.63317 WP_003899296.1.63331 WP_003899296.1.63373 WP_003899296.1.63384 WP_003899296.1.63403 WP_003899296.1.63424 WP_003899296.1.63428 WP_003899296.1.6345 WP_003899296.1.63464 WP_003899296.1.63483 WP_003899296.1.63502 WP_003899296.1.63504 WP_003899296.1.63522 WP_003899296.1.63538 WP_003899296.1.63564 WP_003899296.1.63567 WP_003899296.1.63596 WP_003899296.1.63600 WP_003899296.1.63623 WP_003899296.1.63624 WP_003899296.1.63625 WP_003899296.1.63627 WP_003899296.1.63654 WP_003899296.1.63662 WP_003899296.1.63711 WP_003899296.1.63734 WP_003899296.1.63807 WP_003899296.1.63819 WP_003899296.1.63844 WP_003899296.1.63888 WP_003899296.1.63913 WP_003899296.1.63915 WP_003899296.1.63918 WP_003899296.1.63961 WP_003899296.1.63970 WP_003899296.1.64000 WP_003899296.1.64027 WP_003899296.1.64058 WP_003899296.1.64065 WP_003899296.1.6407 WP_003899296.1.64082 WP_003899296.1.64091 WP_003899296.1.64102 WP_003899296.1.64104 WP_003899296.1.64119 WP_003899296.1.64219 WP_003899296.1.6422 WP_003899296.1.64222 WP_003899296.1.64223 WP_003899296.1.64228 WP_003899296.1.64235 WP_003899296.1.64249 WP_003899296.1.6427 WP_003899296.1.64278 WP_003899296.1.64414 WP_003899296.1.64419 WP_003899296.1.6443 WP_003899296.1.64463 WP_003899296.1.64480 WP_003899296.1.64497 WP_003899296.1.64506 WP_003899296.1.64513 WP_003899296.1.64514 WP_003899296.1.64515 WP_003899296.1.64522 WP_003899296.1.64526 WP_003899296.1.64543 WP_003899296.1.6456 WP_003899296.1.64567 WP_003899296.1.64588 WP_003899296.1.64589 WP_003899296.1.64594 WP_003899296.1.64595 WP_003899296.1.64608 WP_003899296.1.64619 WP_003899296.1.64629 WP_003899296.1.6464 WP_003899296.1.64664 WP_003899296.1.64669 WP_003899296.1.64672 WP_003899296.1.64680 WP_003899296.1.64682 WP_003899296.1.64727 WP_003899296.1.64729 WP_003899296.1.64774 WP_003899296.1.64776 WP_003899296.1.64802 WP_003899296.1.64832 WP_003899296.1.6486 WP_003899296.1.64870 WP_003899296.1.64898 WP_003899296.1.64922 WP_003899296.1.64924 WP_003899296.1.6493 WP_003899296.1.64937 WP_003899296.1.64941 WP_003899296.1.64966 WP_003899296.1.64973 WP_003899296.1.65001 WP_003899296.1.65026 WP_003899296.1.65053 WP_003899296.1.65070 WP_003899296.1.65079 WP_003899296.1.65102 WP_003899296.1.65157 WP_003899296.1.65181 WP_003899296.1.65212 WP_003899296.1.65229 WP_003899296.1.6523 WP_003899296.1.65253 WP_003899296.1.65289 WP_003899296.1.65291 WP_003899296.1.65315 WP_003899296.1.65329 WP_003899296.1.65359 WP_003899296.1.6536 WP_003899296.1.65374 WP_003899296.1.65386 WP_003899296.1.65414 WP_003899296.1.65416 WP_003899296.1.65433 WP_003899296.1.65455 WP_003899296.1.65467 WP_003899296.1.65488 WP_003899296.1.65529 WP_003899296.1.65539 WP_003899296.1.65583 WP_003899296.1.65612 WP_003899296.1.65623 WP_003899296.1.65635 WP_003899296.1.65637 WP_003899296.1.65648 WP_003899296.1.65683 WP_003899296.1.65686 WP_003899296.1.65688 WP_003899296.1.65707 WP_003899296.1.65733 WP_003899296.1.65746 WP_003899296.1.65747 WP_003899296.1.65759 WP_003899296.1.65816 WP_003899296.1.65830 WP_003899296.1.65858 WP_003899296.1.65862 WP_003899296.1.65869 WP_003899296.1.65929 WP_003899296.1.65974 WP_003899296.1.66004 WP_003899296.1.66013 WP_003899296.1.6606 WP_003899296.1.66089 WP_003899296.1.66149 WP_003899296.1.66151 WP_003899296.1.66229 WP_003899296.1.66276 WP_003899296.1.66293 WP_003899296.1.66297 WP_003899296.1.66323 WP_003899296.1.66325 WP_003899296.1.6633 WP_003899296.1.66334 WP_003899296.1.66355 WP_003899296.1.66367 WP_003899296.1.66394 WP_003899296.1.66396 WP_003899296.1.66451 WP_003899296.1.66455 WP_003899296.1.66457 WP_003899296.1.66460 WP_003899296.1.66464 WP_003899296.1.66466 WP_003899296.1.66487 WP_003899296.1.66504 WP_003899296.1.66558 WP_003899296.1.66580 WP_003899296.1.66582 WP_003899296.1.66612 WP_003899296.1.66615 WP_003899296.1.66617 WP_003899296.1.66635 WP_003899296.1.66656 WP_003899296.1.66663 WP_003899296.1.66675 WP_003899296.1.66715 WP_003899296.1.66718 WP_003899296.1.66762 WP_003899296.1.66776 WP_003899296.1.66808 WP_003899296.1.66817 WP_003899296.1.66819 WP_003899296.1.66826 WP_003899296.1.66830 WP_003899296.1.66878 WP_003899296.1.66880 WP_003899296.1.66893 WP_003899296.1.66961 WP_003899296.1.67005 WP_003899296.1.6704 WP_003899296.1.67044 WP_003899296.1.67061 WP_003899296.1.67089 WP_003899296.1.67098 WP_003899296.1.67146 WP_003899296.1.67197 WP_003899296.1.67198 WP_003899296.1.6720 WP_003899296.1.67207 WP_003899296.1.67218 WP_003899296.1.67220 WP_003899296.1.67225 WP_003899296.1.67231 WP_003899296.1.6724 WP_003899296.1.67257 WP_003899296.1.67298 WP_003899296.1.67307 WP_003899296.1.67324 WP_003899296.1.67332 WP_003899296.1.67346 WP_003899296.1.67354 WP_003899296.1.67360 WP_003899296.1.67381 WP_003899296.1.67396 WP_003899296.1.67417 WP_003899296.1.67422 WP_003899296.1.67453 WP_003899296.1.67459 WP_003899296.1.6746 WP_003899296.1.67473 WP_003899296.1.67481 WP_003899296.1.67482 WP_003899296.1.67496 WP_003899296.1.67499 WP_003899296.1.67516 WP_003899296.1.67523 WP_003899296.1.67536 WP_003899296.1.67575 WP_003899296.1.67598 WP_003899296.1.67600 WP_003899296.1.67602 WP_003899296.1.67679 WP_003899296.1.67692 WP_003899296.1.67744 WP_003899296.1.6775 WP_003899296.1.67750 WP_003899296.1.6777 WP_003899296.1.67809 WP_003899296.1.67816 WP_003899296.1.67844 WP_003899296.1.67848 WP_003899296.1.67870 WP_003899296.1.67888 WP_003899296.1.67915 WP_003899296.1.67945 WP_003899296.1.67949 WP_003899296.1.67980 WP_003899296.1.67982 WP_003899296.1.68029 WP_003899296.1.68037 WP_003899296.1.68038 WP_003899296.1.68045 WP_003899296.1.68057 WP_003899296.1.68083 WP_003899296.1.68088 WP_003899296.1.68164 WP_003899296.1.68169 WP_003899296.1.68193 WP_003899296.1.68212 WP_003899296.1.68227 WP_003899296.1.68243 WP_003899296.1.6825 WP_003899296.1.68297 WP_003899296.1.68309 WP_003899296.1.68325 WP_003899296.1.68329 WP_003899296.1.68340 WP_003899296.1.68384 WP_003899296.1.68388 WP_003899296.1.68429 WP_003899296.1.6843 WP_003899296.1.68433 WP_003899296.1.68444 WP_003899296.1.68465 WP_003899296.1.68484 WP_003899296.1.68518 WP_003899296.1.68569 WP_003899296.1.68576 WP_003899296.1.68580 WP_003899296.1.68586 WP_003899296.1.68623 WP_003899296.1.68624 WP_003899296.1.68637 WP_003899296.1.68646 WP_003899296.1.68667 WP_003899296.1.68669 WP_003899296.1.68672 WP_003899296.1.68684 WP_003899296.1.68704 WP_003899296.1.68708 WP_003899296.1.68730 WP_003899296.1.68734 WP_003899296.1.68748 WP_003899296.1.68754 WP_003899296.1.6876 WP_003899296.1.68761 WP_003899296.1.68763 WP_003899296.1.68766 WP_003899296.1.68774 WP_003899296.1.68796 WP_003899296.1.68824 WP_003899296.1.68832 WP_003899296.1.68833 WP_003899296.1.68841 WP_003899296.1.68859 WP_003899296.1.68876 WP_003899296.1.68906 WP_003899296.1.68916 WP_003899296.1.68923 WP_003899296.1.68945 WP_003899296.1.6896 WP_003899296.1.68981 WP_003899296.1.68984 WP_003899296.1.68997 WP_003899296.1.69008 WP_003899296.1.69076 WP_003899296.1.69079 WP_003899296.1.6908 WP_003899296.1.69082 WP_003899296.1.69178 WP_003899296.1.69181 WP_003899296.1.69208 WP_003899296.1.69231 WP_003899296.1.69256 WP_003899296.1.69311 WP_003899296.1.69315 WP_003899296.1.69322 WP_003899296.1.69342 WP_003899296.1.6935 WP_003899296.1.6936 WP_003899296.1.69374 WP_003899296.1.69398 WP_003899296.1.69401 WP_003899296.1.69426 WP_003899296.1.69427 WP_003899296.1.69429 WP_003899296.1.6949 WP_003899296.1.6951 WP_003899296.1.69511 WP_003899296.1.69526 WP_003899296.1.69528 WP_003899296.1.69547 WP_003899296.1.69573 WP_003899296.1.69581 WP_003899296.1.6960 WP_003899296.1.69617 WP_003899296.1.69634 WP_003899296.1.69647 WP_003899296.1.69659 WP_003899296.1.69673 WP_003899296.1.69682 WP_003899296.1.69684 WP_003899296.1.69686 WP_003899296.1.69709 WP_003899296.1.69723 WP_003899296.1.69736 WP_003899296.1.69778 WP_003899296.1.69800 WP_003899296.1.69802 WP_003899296.1.69845 WP_003899296.1.69870 WP_003899296.1.69873 WP_003899296.1.69898 WP_003899296.1.69913 WP_003899296.1.69931 WP_003899296.1.69938 WP_003899296.1.69955 WP_003899296.1.69957 WP_003899296.1.69981 WP_003899296.1.69990 WP_003899296.1.70 WP_003899296.1.70000 WP_003899296.1.70017 WP_003899296.1.70032 WP_003899296.1.70055 WP_003899296.1.70062 WP_003899296.1.70072 WP_003899296.1.70131 WP_003899296.1.70132 WP_003899296.1.7022 WP_003899296.1.70227 WP_003899296.1.70255 WP_003899296.1.70271 WP_003899296.1.70274 WP_003899296.1.7029 WP_003899296.1.70325 WP_003899296.1.70328 WP_003899296.1.70356 WP_003899296.1.70364 WP_003899296.1.70368 WP_003899296.1.70369 WP_003899296.1.70418 WP_003899296.1.70422 WP_003899296.1.70435 WP_003899296.1.70444 WP_003899296.1.70463 WP_003899296.1.70471 WP_003899296.1.70480 WP_003899296.1.70494 WP_003899296.1.70498 WP_003899296.1.70505 WP_003899296.1.70525 WP_003899296.1.70573 WP_003899296.1.70577 WP_003899296.1.70610 WP_003899296.1.70615 WP_003899296.1.70618 WP_003899296.1.70622 WP_003899296.1.70626 WP_003899296.1.70668 WP_003899296.1.70699 WP_003899296.1.70704 WP_003899296.1.70729 WP_003899296.1.70757 WP_003899296.1.70782 WP_003899296.1.70796 WP_003899296.1.70830 WP_003899296.1.70834 WP_003899296.1.7084 WP_003899296.1.70840 WP_003899296.1.70864 WP_003899296.1.70871 WP_003899296.1.70915 WP_003899296.1.70955 WP_003899296.1.70958 WP_003899296.1.70964 WP_003899296.1.70976 WP_003899296.1.71015 WP_003899296.1.71026 WP_003899296.1.71063 WP_003899296.1.71076 WP_003899296.1.71083 WP_003899296.1.7111 WP_003899296.1.71118 WP_003899296.1.71128 WP_003899296.1.7113 WP_003899296.1.71187 WP_003899296.1.71191 WP_003899296.1.71255 WP_003899296.1.71258 WP_003899296.1.71259 WP_003899296.1.71289 WP_003899296.1.71326 WP_003899296.1.71329 WP_003899296.1.71331 WP_003899296.1.71344 WP_003899296.1.71390 WP_003899296.1.71399 WP_003899296.1.71440 WP_003899296.1.71457 WP_003899296.1.7146 WP_003899296.1.71464 WP_003899296.1.71490 WP_003899296.1.71492 WP_003899296.1.71509 WP_003899296.1.71516 WP_003899296.1.71517 WP_003899296.1.71527 WP_003899296.1.71532 WP_003899296.1.71545 WP_003899296.1.71546 WP_003899296.1.71569 WP_003899296.1.71604 WP_003899296.1.71621 WP_003899296.1.71630 WP_003899296.1.71638 WP_003899296.1.71654 WP_003899296.1.71665 WP_003899296.1.71683 WP_003899296.1.71701 WP_003899296.1.71718 WP_003899296.1.71731 WP_003899296.1.71778 WP_003899296.1.71781 WP_003899296.1.71803 WP_003899296.1.71820 WP_003899296.1.71847 WP_003899296.1.7185 WP_003899296.1.71851 WP_003899296.1.71871 WP_003899296.1.71909 WP_003899296.1.71957 WP_003899296.1.71970 WP_003899296.1.72047 WP_003899296.1.72061 WP_003899296.1.72072 WP_003899296.1.72111 WP_003899296.1.72122 WP_003899296.1.72128 WP_003899296.1.72143 WP_003899296.1.7216 WP_003899296.1.72168 WP_003899296.1.72179 WP_003899296.1.72209 WP_003899296.1.72218 WP_003899296.1.72219 WP_003899296.1.72227 WP_003899296.1.7224 WP_003899296.1.72268 WP_003899296.1.72332 WP_003899296.1.72380 WP_003899296.1.72401 WP_003899296.1.72405 WP_003899296.1.72420 WP_003899296.1.72441 WP_003899296.1.72451 WP_003899296.1.72452 WP_003899296.1.72457 WP_003899296.1.72459 WP_003899296.1.72460 WP_003899296.1.72466 WP_003899296.1.72487 WP_003899296.1.72488 WP_003899296.1.72492 WP_003899296.1.72506 WP_003899296.1.72543 WP_003899296.1.7256 WP_003899296.1.72576 WP_003899296.1.72578 WP_003899296.1.72585 WP_003899296.1.72591 WP_003899296.1.72592 WP_003899296.1.72640 WP_003899296.1.7266 WP_003899296.1.72684 WP_003899296.1.72739 WP_003899296.1.72744 WP_003899296.1.72755 WP_003899296.1.72759 WP_003899296.1.72784 WP_003899296.1.72792 WP_003899296.1.72826 WP_003899296.1.72831 WP_003899296.1.72852 WP_003899296.1.72853 WP_003899296.1.72879 WP_003899296.1.72880 WP_003899296.1.72938 WP_003899296.1.72954 WP_003899296.1.72957 WP_003899296.1.72959 WP_003899296.1.72973 WP_003899296.1.7298 WP_003899296.1.72982 WP_003899296.1.72988 WP_003899296.1.72993 WP_003899296.1.73006 WP_003899296.1.73013 WP_003899296.1.73025 WP_003899296.1.73028 WP_003899296.1.73042 WP_003899296.1.73092 WP_003899296.1.73118 WP_003899296.1.7312 WP_003899296.1.73134 WP_003899296.1.73150 WP_003899296.1.73154 WP_003899296.1.73163 WP_003899296.1.73182 WP_003899296.1.73205 WP_003899296.1.7321 WP_003899296.1.73310 WP_003899296.1.73315 WP_003899296.1.73365 WP_003899296.1.73391 WP_003899296.1.73404 WP_003899296.1.73424 WP_003899296.1.73436 WP_003899296.1.73445 WP_003899296.1.73453 WP_003899296.1.73465 WP_003899296.1.73466 WP_003899296.1.73470 WP_003899296.1.73471 WP_003899296.1.73478 WP_003899296.1.73482 WP_003899296.1.73507 WP_003899296.1.73532 WP_003899296.1.73550 WP_003899296.1.73564 WP_003899296.1.73623 WP_003899296.1.73629 WP_003899296.1.73644 WP_003899296.1.7368 WP_003899296.1.73688 WP_003899296.1.73723 WP_003899296.1.73744 WP_003899296.1.73750 WP_003899296.1.73760 WP_003899296.1.73774 WP_003899296.1.7379 WP_003899296.1.73813 WP_003899296.1.73840 WP_003899296.1.73876 WP_003899296.1.7389 WP_003899296.1.74016 WP_003899296.1.74039 WP_003899296.1.74083 WP_003899296.1.74101 WP_003899296.1.74107 WP_003899296.1.74120 WP_003899296.1.74129 WP_003899296.1.74144 WP_003899296.1.7417 WP_003899296.1.74190 WP_003899296.1.74210 WP_003899296.1.7423 WP_003899296.1.74259 WP_003899296.1.74262 WP_003899296.1.74269 WP_003899296.1.74282 WP_003899296.1.74291 WP_003899296.1.74296 WP_003899296.1.74304 WP_003899296.1.7432 WP_003899296.1.74347 WP_003899296.1.7436 WP_003899296.1.74378 WP_003899296.1.74395 WP_003899296.1.74400 WP_003899296.1.74401 WP_003899296.1.74432 WP_003899296.1.74442 WP_003899296.1.74477 WP_003899296.1.74487 WP_003899296.1.74499 WP_003899296.1.74504 WP_003899296.1.74511 WP_003899296.1.74523 WP_003899296.1.74525 WP_003899296.1.74551 WP_003899296.1.74555 WP_003899296.1.74628 WP_003899296.1.74641 WP_003899296.1.74653 WP_003899296.1.74660 WP_003899296.1.74683 WP_003899296.1.7469 WP_003899296.1.74725 WP_003899296.1.74760 WP_003899296.1.74786 WP_003899296.1.74809 WP_003899296.1.74820 WP_003899296.1.74870 WP_003899296.1.74881 WP_003899296.1.74888 WP_003899296.1.74952 WP_003899296.1.7496 WP_003899296.1.74988 WP_003899296.1.75043 WP_003899296.1.75045 WP_003899296.1.75055 WP_003899296.1.75078 WP_003899296.1.75081 WP_003899296.1.75120 WP_003899296.1.75163 WP_003899296.1.75188 WP_003899296.1.75200 WP_003899296.1.75202 WP_003899296.1.75234 WP_003899296.1.75239 WP_003899296.1.75250 WP_003899296.1.75263 WP_003899296.1.75281 WP_003899296.1.75342 WP_003899296.1.7535 WP_003899296.1.75376 WP_003899296.1.75391 WP_003899296.1.75395 WP_003899296.1.75441 WP_003899296.1.75510 WP_003899296.1.75581 WP_003899296.1.75598 WP_003899296.1.75635 WP_003899296.1.75645 WP_003899296.1.75665 WP_003899296.1.75671 WP_003899296.1.75741 WP_003899296.1.75749 WP_003899296.1.75772 WP_003899296.1.75774 WP_003899296.1.75811 WP_003899296.1.75833 WP_003899296.1.7585 WP_003899296.1.75868 WP_003899296.1.75878 WP_003899296.1.75927 WP_003899296.1.75946 WP_003899296.1.75968 WP_003899296.1.75974 WP_003899296.1.76007 WP_003899296.1.76016 WP_003899296.1.76032 WP_003899296.1.76037 WP_003899296.1.7604 WP_003899296.1.76045 WP_003899296.1.76052 WP_003899296.1.76058 WP_003899296.1.76064 WP_003899296.1.76110 WP_003899296.1.76138 WP_003899296.1.76157 WP_003899296.1.76172 WP_003899296.1.76177 WP_003899296.1.76183 WP_003899296.1.76239 WP_003899296.1.76272 WP_003899296.1.76277 WP_003899296.1.76280 WP_003899296.1.76281 WP_003899296.1.76291 WP_003899296.1.76297 WP_003899296.1.76379 WP_003899296.1.76403 WP_003899296.1.76414 WP_003899296.1.76427 WP_003899296.1.76436 WP_003899296.1.76442 WP_003899296.1.76443 WP_003899296.1.76456 WP_003899296.1.76521 WP_003899296.1.76533 WP_003899296.1.76616 WP_003899296.1.76625 WP_003899296.1.76629 WP_003899296.1.76638 WP_003899296.1.76639 WP_003899296.1.76640 WP_003899296.1.76644 WP_003899296.1.76677 WP_003899296.1.76678 WP_003899296.1.76679 WP_003899296.1.76734 WP_003899296.1.76744 WP_003899296.1.76750 WP_003899296.1.76754 WP_003899296.1.76757 WP_003899296.1.76781 WP_003899296.1.76818 WP_003899296.1.76824 WP_003899296.1.76835 WP_003899296.1.76873 WP_003899296.1.76888 WP_003899296.1.76900 WP_003899296.1.7691 WP_003899296.1.76947 WP_003899296.1.76954 WP_003899296.1.76955 WP_003899296.1.76963 WP_003899296.1.76976 WP_003899296.1.770 WP_003899296.1.77000 WP_003899296.1.77008 WP_003899296.1.77021 WP_003899296.1.77056 WP_003899296.1.77065 WP_003899296.1.77075 WP_003899296.1.77093 WP_003899296.1.77107 WP_003899296.1.77115 WP_003899296.1.77118 WP_003899296.1.77125 WP_003899296.1.77141 WP_003899296.1.77142 WP_003899296.1.77166 WP_003899296.1.77250 WP_003899296.1.77252 WP_003899296.1.77260 WP_003899296.1.77266 WP_003899296.1.77280 WP_003899296.1.77285 WP_003899296.1.77312 WP_003899296.1.77348 WP_003899296.1.77351 WP_003899296.1.77352 WP_003899296.1.77361 WP_003899296.1.774 WP_003899296.1.7740 WP_003899296.1.77404 WP_003899296.1.77425 WP_003899296.1.77463 WP_003899296.1.77474 WP_003899296.1.7748 WP_003899296.1.77484 WP_003899296.1.77491 WP_003899296.1.77499 WP_003899296.1.77510 WP_003899296.1.77530 WP_003899296.1.77554 WP_003899296.1.77599 WP_003899296.1.77605 WP_003899296.1.7762 WP_003899296.1.77627 WP_003899296.1.77649 WP_003899296.1.77654 WP_003899296.1.7766 WP_003899296.1.77667 WP_003899296.1.77704 WP_003899296.1.77706 WP_003899296.1.77726 WP_003899296.1.77774 WP_003899296.1.7778 WP_003899296.1.77790 WP_003899296.1.77809 WP_003899296.1.77820 WP_003899296.1.77843 WP_003899296.1.77855 WP_003899296.1.77865 WP_003899296.1.77868 WP_003899296.1.77879 WP_003899296.1.77909 WP_003899296.1.77911 WP_003899296.1.77931 WP_003899296.1.77984 WP_003899296.1.78020 WP_003899296.1.78024 WP_003899296.1.78075 WP_003899296.1.78084 WP_003899296.1.78086 WP_003899296.1.7809 WP_003899296.1.78098 WP_003899296.1.78105 WP_003899296.1.78113 WP_003899296.1.78136 WP_003899296.1.78162 WP_003899296.1.7817 WP_003899296.1.78200 WP_003899296.1.78216 WP_003899296.1.78236 WP_003899296.1.78238 WP_003899296.1.78322 WP_003899296.1.78338 WP_003899296.1.7836 WP_003899296.1.78360 WP_003899296.1.78386 WP_003899296.1.78429 WP_003899296.1.78435 WP_003899296.1.7844 WP_003899296.1.78459 WP_003899296.1.78488 WP_003899296.1.7849 WP_003899296.1.78499 WP_003899296.1.785 WP_003899296.1.78516 WP_003899296.1.78524 WP_003899296.1.78526 WP_003899296.1.78544 WP_003899296.1.78545 WP_003899296.1.78547 WP_003899296.1.78574 WP_003899296.1.78580 WP_003899296.1.7860 WP_003899296.1.78620 WP_003899296.1.78646 WP_003899296.1.78648 WP_003899296.1.78649 WP_003899296.1.78655 WP_003899296.1.78657 WP_003899296.1.78659 WP_003899296.1.7869 WP_003899296.1.78692 WP_003899296.1.78760 WP_003899296.1.78766 WP_003899296.1.78776 WP_003899296.1.78778 WP_003899296.1.78784 WP_003899296.1.78788 WP_003899296.1.78790 WP_003899296.1.78793 WP_003899296.1.78848 WP_003899296.1.78860 WP_003899296.1.7887 WP_003899296.1.78884 WP_003899296.1.78932 WP_003899296.1.78969 WP_003899296.1.78977 WP_003899296.1.78980 WP_003899296.1.79005 WP_003899296.1.79016 WP_003899296.1.79064 WP_003899296.1.79066 WP_003899296.1.79068 WP_003899296.1.79077 WP_003899296.1.79112 WP_003899296.1.79122 WP_003899296.1.79145 WP_003899296.1.79152 WP_003899296.1.79163 WP_003899296.1.79182 WP_003899296.1.79198 WP_003899296.1.79213 WP_003899296.1.79218 WP_003899296.1.79268 WP_003899296.1.79273 WP_003899296.1.79278 WP_003899296.1.79290 WP_003899296.1.79319 WP_003899296.1.79325 WP_003899296.1.79326 WP_003899296.1.79330 WP_003899296.1.79339 WP_003899296.1.79394 WP_003899296.1.79399 WP_003899296.1.79413 WP_003899296.1.79422 WP_003899296.1.79445 WP_003899296.1.79447 WP_003899296.1.79455 WP_003899296.1.79471 WP_003899296.1.79480 WP_003899296.1.79482 WP_003899296.1.79488 WP_003899296.1.79500 WP_003899296.1.79502 WP_003899296.1.79508 WP_003899296.1.79514 WP_003899296.1.79561 WP_003899296.1.79565 WP_003899296.1.79578 WP_003899296.1.79588 WP_003899296.1.79598 WP_003899296.1.79615 WP_003899296.1.79684 WP_003899296.1.79698 WP_003899296.1.797 WP_003899296.1.79744 WP_003899296.1.79784 WP_003899296.1.79802 WP_003899296.1.79806 WP_003899296.1.79819 WP_003899296.1.79826 WP_003899296.1.79828 WP_003899296.1.79851 WP_003899296.1.79853 WP_003899296.1.79863 WP_003899296.1.79881 WP_003899296.1.79885 WP_003899296.1.7990 WP_003899296.1.79900 WP_003899296.1.79913 WP_003899296.1.79918 WP_003899296.1.79947 WP_003899296.1.79948 WP_003899296.1.7995 WP_003899296.1.7997 WP_003899296.1.80004 WP_003899296.1.80015 WP_003899296.1.80022 WP_003899296.1.80030 WP_003899296.1.80054 WP_003899296.1.80084 WP_003899296.1.80099 WP_003899296.1.80129 WP_003899296.1.80177 WP_003899296.1.80234 WP_003899296.1.8026 WP_003899296.1.80275 WP_003899296.1.8029 WP_003899296.1.80299 WP_003899296.1.80300 WP_003899296.1.80304 WP_003899296.1.80326 WP_003899296.1.80351 WP_003899296.1.8037 WP_003899296.1.80370 WP_003899296.1.80387 WP_003899296.1.80399 WP_003899296.1.8044 WP_003899296.1.80451 WP_003899296.1.80458 WP_003899296.1.80461 WP_003899296.1.80490 WP_003899296.1.80503 WP_003899296.1.80507 WP_003899296.1.80552 WP_003899296.1.80576 WP_003899296.1.80588 WP_003899296.1.80599 WP_003899296.1.8060 WP_003899296.1.80624 WP_003899296.1.80636 WP_003899296.1.80669 WP_003899296.1.80673 WP_003899296.1.80711 WP_003899296.1.80714 WP_003899296.1.80743 WP_003899296.1.80784 WP_003899296.1.80815 WP_003899296.1.80853 WP_003899296.1.80918 WP_003899296.1.8093 WP_003899296.1.80967 WP_003899296.1.8097 WP_003899296.1.80988 WP_003899296.1.81007 WP_003899296.1.81013 WP_003899296.1.8105 WP_003899296.1.81059 WP_003899296.1.81063 WP_003899296.1.81066 WP_003899296.1.81075 WP_003899296.1.81091 WP_003899296.1.81119 WP_003899296.1.81125 WP_003899296.1.81136 WP_003899296.1.8114 WP_003899296.1.81189 WP_003899296.1.81192 WP_003899296.1.81230 WP_003899296.1.81249 WP_003899296.1.81250 WP_003899296.1.8128 WP_003899296.1.81287 WP_003899296.1.81297 WP_003899296.1.8138 WP_003899296.1.81407 WP_003899296.1.8143 WP_003899296.1.81439 WP_003899296.1.81465 WP_003899296.1.81529 WP_003899296.1.81538 WP_003899296.1.81541 WP_003899296.1.81560 WP_003899296.1.81561 WP_003899296.1.81567 WP_003899296.1.81583 WP_003899296.1.81686 WP_003899296.1.81712 WP_003899296.1.81720 WP_003899296.1.81731 WP_003899296.1.81774 WP_003899296.1.81788 WP_003899296.1.81809 WP_003899296.1.81820 WP_003899296.1.81850 WP_003899296.1.81883 WP_003899296.1.81891 WP_003899296.1.81911 WP_003899296.1.81918 WP_003899296.1.82011 WP_003899296.1.82048 WP_003899296.1.82069 WP_003899296.1.82071 WP_003899296.1.82108 WP_003899296.1.82136 WP_003899296.1.82142 WP_003899296.1.8215 WP_003899296.1.82158 WP_003899296.1.8217 WP_003899296.1.82209 WP_003899296.1.82210 WP_003899296.1.82228 WP_003899296.1.82236 WP_003899296.1.82251 WP_003899296.1.82271 WP_003899296.1.82305 WP_003899296.1.82307 WP_003899296.1.82309 WP_003899296.1.82317 WP_003899296.1.8232 WP_003899296.1.82346 WP_003899296.1.82374 WP_003899296.1.82385 WP_003899296.1.82429 WP_003899296.1.82460 WP_003899296.1.82462 WP_003899296.1.82483 WP_003899296.1.82494 WP_003899296.1.82531 WP_003899296.1.82546 WP_003899296.1.82547 WP_003899296.1.82549 WP_003899296.1.82577 WP_003899296.1.82592 WP_003899296.1.82597 WP_003899296.1.82598 WP_003899296.1.82625 WP_003899296.1.82642 WP_003899296.1.82651 WP_003899296.1.82653 WP_003899296.1.82681 WP_003899296.1.82685 WP_003899296.1.8271 WP_003899296.1.82712 WP_003899296.1.8273 WP_003899296.1.82757 WP_003899296.1.82774 WP_003899296.1.82803 WP_003899296.1.82836 WP_003899296.1.82860 WP_003899296.1.82892 WP_003899296.1.82935 WP_003899296.1.82957 WP_003899296.1.82973 WP_003899296.1.82981 WP_003899296.1.82983 WP_003899296.1.83004 WP_003899296.1.83009 WP_003899296.1.83044 WP_003899296.1.83065 WP_003899296.1.83074 WP_003899296.1.83110 WP_003899296.1.83146 WP_003899296.1.83149 WP_003899296.1.83159 WP_003899296.1.8317 WP_003899296.1.83173 WP_003899296.1.83181 WP_003899296.1.83182 WP_003899296.1.83191 WP_003899296.1.83197 WP_003899296.1.83212 WP_003899296.1.8326 WP_003899296.1.83262 WP_003899296.1.83268 WP_003899296.1.83273 WP_003899296.1.83309 WP_003899296.1.83332 WP_003899296.1.83334 WP_003899296.1.83341 WP_003899296.1.83349 WP_003899296.1.8335 WP_003899296.1.83353 WP_003899296.1.83367 WP_003899296.1.83380 WP_003899296.1.83381 WP_003899296.1.83389 WP_003899296.1.83408 WP_003899296.1.83409 WP_003899296.1.83435 WP_003899296.1.83470 WP_003899296.1.83524 WP_003899296.1.83526 WP_003899296.1.8358 WP_003899296.1.83589 WP_003899296.1.83601 WP_003899296.1.83638 WP_003899296.1.83648 WP_003899296.1.83656 WP_003899296.1.83667 WP_003899296.1.83704 WP_003899296.1.83705 WP_003899296.1.83766 WP_003899296.1.83793 WP_003899296.1.83794 WP_003899296.1.83802 WP_003899296.1.83805 WP_003899296.1.83839 WP_003899296.1.83842 WP_003899296.1.83850 WP_003899296.1.83861 WP_003899296.1.83884 WP_003899296.1.83920 WP_003899296.1.83929 WP_003899296.1.83930 WP_003899296.1.83975 WP_003899296.1.83991 WP_003899296.1.8400 WP_003899296.1.84027 WP_003899296.1.8404 WP_003899296.1.84057 WP_003899296.1.84070 WP_003899296.1.8409 WP_003899296.1.84112 WP_003899296.1.84146 WP_003899296.1.8415 WP_003899296.1.84176 WP_003899296.1.84186 WP_003899296.1.84192 WP_003899296.1.8424 WP_003899296.1.84244 WP_003899296.1.84259 WP_003899296.1.8426 WP_003899296.1.84277 WP_003899296.1.84287 WP_003899296.1.8434 WP_003899296.1.84388 WP_003899296.1.84408 WP_003899296.1.84409 WP_003899296.1.84438 WP_003899296.1.84460 WP_003899296.1.84488 WP_003899296.1.84504 WP_003899296.1.84525 WP_003899296.1.84620 WP_003899296.1.84623 WP_003899296.1.84641 WP_003899296.1.84655 WP_003899296.1.84666 WP_003899296.1.84670 WP_003899296.1.84739 WP_003899296.1.84748 WP_003899296.1.84766 WP_003899296.1.84772 WP_003899296.1.84774 WP_003899296.1.848 WP_003899296.1.84812 WP_003899296.1.84836 WP_003899296.1.84839 WP_003899296.1.84846 WP_003899296.1.84873 WP_003899296.1.84911 WP_003899296.1.84938 WP_003899296.1.84968 WP_003899296.1.84973 WP_003899296.1.84981 WP_003899296.1.84985 WP_003899296.1.8503 WP_003899296.1.85038 WP_003899296.1.85041 WP_003899296.1.85043 WP_003899296.1.8505 WP_003899296.1.85074 WP_003899296.1.8509 WP_003899296.1.8512 WP_003899296.1.85148 WP_003899296.1.8518 WP_003899296.1.8522 WP_003899296.1.85242 WP_003899296.1.85276 WP_003899296.1.85281 WP_003899296.1.85284 WP_003899296.1.85314 WP_003899296.1.85319 WP_003899296.1.85330 WP_003899296.1.85341 WP_003899296.1.85346 WP_003899296.1.8535 WP_003899296.1.85363 WP_003899296.1.85371 WP_003899296.1.85377 WP_003899296.1.85387 WP_003899296.1.85399 WP_003899296.1.85458 WP_003899296.1.8546 WP_003899296.1.85464 WP_003899296.1.85478 WP_003899296.1.85480 WP_003899296.1.85488 WP_003899296.1.85495 WP_003899296.1.85551 WP_003899296.1.85557 WP_003899296.1.85577 WP_003899296.1.85597 WP_003899296.1.85599 WP_003899296.1.85610 WP_003899296.1.8563 WP_003899296.1.85648 WP_003899296.1.85679 WP_003899296.1.85704 WP_003899296.1.85737 WP_003899296.1.85808 WP_003899296.1.85819 WP_003899296.1.85820 WP_003899296.1.85823 WP_003899296.1.8586 WP_003899296.1.85872 WP_003899296.1.85894 WP_003899296.1.85913 WP_003899296.1.85953 WP_003899296.1.85986 WP_003899296.1.86024 WP_003899296.1.86025 WP_003899296.1.86032 WP_003899296.1.86048 WP_003899296.1.86052 WP_003899296.1.86067 WP_003899296.1.86103 WP_003899296.1.86122 WP_003899296.1.86124 WP_003899296.1.86160 WP_003899296.1.86164 WP_003899296.1.86168 WP_003899296.1.86204 WP_003899296.1.86208 WP_003899296.1.86235 WP_003899296.1.86249 WP_003899296.1.86260 WP_003899296.1.86290 WP_003899296.1.863 WP_003899296.1.86327 WP_003899296.1.86334 WP_003899296.1.86337 WP_003899296.1.86368 WP_003899296.1.86377 WP_003899296.1.86425 WP_003899296.1.86459 WP_003899296.1.8649 WP_003899296.1.86499 WP_003899296.1.86520 WP_003899296.1.86561 WP_003899296.1.86568 WP_003899296.1.86575 WP_003899296.1.86584 WP_003899296.1.86605 WP_003899296.1.86626 WP_003899296.1.86648 WP_003899296.1.8666 WP_003899296.1.86684 WP_003899296.1.86696 WP_003899296.1.86705 WP_003899296.1.86718 WP_003899296.1.86725 WP_003899296.1.86757 WP_003899296.1.86766 WP_003899296.1.86801 WP_003899296.1.86814 WP_003899296.1.86820 WP_003899296.1.86825 WP_003899296.1.86834 WP_003899296.1.8685 WP_003899296.1.86851 WP_003899296.1.86867 WP_003899296.1.86877 WP_003899296.1.86883 WP_003899296.1.8689 WP_003899296.1.86892 WP_003899296.1.86933 WP_003899296.1.86941 WP_003899296.1.86950 WP_003899296.1.86962 WP_003899296.1.86963 WP_003899296.1.86979 WP_003899296.1.8700 WP_003899296.1.87002 WP_003899296.1.87031 WP_003899296.1.87116 WP_003899296.1.87117 WP_003899296.1.8714 WP_003899296.1.87162 WP_003899296.1.87178 WP_003899296.1.87191 WP_003899296.1.87201 WP_003899296.1.87209 WP_003899296.1.87240 WP_003899296.1.87266 WP_003899296.1.87273 WP_003899296.1.87275 WP_003899296.1.8733 WP_003899296.1.87345 WP_003899296.1.8737 WP_003899296.1.87401 WP_003899296.1.87404 WP_003899296.1.87406 WP_003899296.1.87409 WP_003899296.1.87444 WP_003899296.1.87446 WP_003899296.1.87459 WP_003899296.1.87472 WP_003899296.1.87489 WP_003899296.1.87494 WP_003899296.1.87496 WP_003899296.1.87582 WP_003899296.1.87588 WP_003899296.1.87619 WP_003899296.1.87620 WP_003899296.1.87634 WP_003899296.1.87643 WP_003899296.1.8765 WP_003899296.1.87650 WP_003899296.1.87654 WP_003899296.1.87658 WP_003899296.1.87665 WP_003899296.1.87676 WP_003899296.1.87677 WP_003899296.1.87684 WP_003899296.1.87692 WP_003899296.1.87707 WP_003899296.1.87732 WP_003899296.1.87784 WP_003899296.1.87796 WP_003899296.1.87809 WP_003899296.1.87817 WP_003899296.1.87827 WP_003899296.1.87831 WP_003899296.1.87835 WP_003899296.1.87837 WP_003899296.1.87866 WP_003899296.1.8789 WP_003899296.1.87911 WP_003899296.1.87924 WP_003899296.1.87951 WP_003899296.1.87955 WP_003899296.1.87956 WP_003899296.1.87991 WP_003899296.1.88 WP_003899296.1.88002 WP_003899296.1.88037 WP_003899296.1.88039 WP_003899296.1.88072 WP_003899296.1.88077 WP_003899296.1.88121 WP_003899296.1.88180 WP_003899296.1.88205 WP_003899296.1.88217 WP_003899296.1.88219 WP_003899296.1.88245 WP_003899296.1.88253 WP_003899296.1.88294 WP_003899296.1.88315 WP_003899296.1.88316 WP_003899296.1.88320 WP_003899296.1.88338 WP_003899296.1.8840 WP_003899296.1.88437 WP_003899296.1.88453 WP_003899296.1.88469 WP_003899296.1.88489 WP_003899296.1.88507 WP_003899296.1.88521 WP_003899296.1.88530 WP_003899296.1.88537 WP_003899296.1.88541 WP_003899296.1.88592 WP_003899296.1.88616 WP_003899296.1.88618 WP_003899296.1.8862 WP_003899296.1.88632 WP_003899296.1.88634 WP_003899296.1.88649 WP_003899296.1.8870 WP_003899296.1.88737 WP_003899296.1.888 WP_003899296.1.88824 WP_003899296.1.88886 WP_003899296.1.88965 WP_003899296.1.88985 WP_003899296.1.8902 WP_003899296.1.89025 WP_003899296.1.89041 WP_003899296.1.89046 WP_003899296.1.89082 WP_003899296.1.89162 WP_003899296.1.89168 WP_003899296.1.8917 WP_003899296.1.89193 WP_003899296.1.89205 WP_003899296.1.89207 WP_003899296.1.89225 WP_003899296.1.8925 WP_003899296.1.89277 WP_003899296.1.89286 WP_003899296.1.89293 WP_003899296.1.89320 WP_003899296.1.89371 WP_003899296.1.89378 WP_003899296.1.89392 WP_003899296.1.89406 WP_003899296.1.8943 WP_003899296.1.89451 WP_003899296.1.89453 WP_003899296.1.89473 WP_003899296.1.89475 WP_003899296.1.89483 WP_003899296.1.895 WP_003899296.1.89513 WP_003899296.1.89517 WP_003899296.1.89522 WP_003899296.1.8954 WP_003899296.1.89543 WP_003899296.1.89567 WP_003899296.1.8957 WP_003899296.1.89572 WP_003899296.1.89589 WP_003899296.1.89607 WP_003899296.1.89613 WP_003899296.1.89625 WP_003899296.1.89648 WP_003899296.1.8967 WP_003899296.1.89670 WP_003899296.1.89676 WP_003899296.1.89729 WP_003899296.1.89739 WP_003899296.1.89762 WP_003899296.1.8977 WP_003899296.1.89802 WP_003899296.1.89808 WP_003899296.1.8982 WP_003899296.1.89829 WP_003899296.1.89831 WP_003899296.1.89844 WP_003899296.1.89849 WP_003899296.1.8989 WP_003899296.1.89901 WP_003899296.1.89903 WP_003899296.1.89909 WP_003899296.1.8992 WP_003899296.1.89922 WP_003899296.1.89926 WP_003899296.1.89963 WP_003899296.1.89971 WP_003899296.1.8998 WP_003899296.1.89987 WP_003899296.1.900 WP_003899296.1.90048 WP_003899296.1.9007 WP_003899296.1.90080 WP_003899296.1.90130 WP_003899296.1.90134 WP_003899296.1.90137 WP_003899296.1.90157 WP_003899296.1.90184 WP_003899296.1.90199 WP_003899296.1.90231 WP_003899296.1.90245 WP_003899296.1.90308 WP_003899296.1.90322 WP_003899296.1.90328 WP_003899296.1.90372 WP_003899296.1.90439 WP_003899296.1.90481 WP_003899296.1.90499 WP_003899296.1.9050 WP_003899296.1.90527 WP_003899296.1.90550 WP_003899296.1.90560 WP_003899296.1.90612 WP_003899296.1.90640 WP_003899296.1.90672 WP_003899296.1.90691 WP_003899296.1.90711 WP_003899296.1.90722 WP_003899296.1.90744 WP_003899296.1.9075 WP_003899296.1.90756 WP_003899296.1.90767 WP_003899296.1.90771 WP_003899296.1.90785 WP_003899296.1.90788 WP_003899296.1.90800 WP_003899296.1.90810 WP_003899296.1.90816 WP_003899296.1.90819 WP_003899296.1.9082 WP_003899296.1.90884 WP_003899296.1.90899 WP_003899296.1.90906 WP_003899296.1.90958 WP_003899296.1.90976 WP_003899296.1.90977 WP_003899296.1.90987 WP_003899296.1.9102 WP_003899296.1.91026 WP_003899296.1.91043 WP_003899296.1.91053 WP_003899296.1.91082 WP_003899296.1.91106 WP_003899296.1.91112 WP_003899296.1.91144 WP_003899296.1.91157 WP_003899296.1.91167 WP_003899296.1.91169 WP_003899296.1.91192 WP_003899296.1.91201 WP_003899296.1.91207 WP_003899296.1.91208 WP_003899296.1.91211 WP_003899296.1.91214 WP_003899296.1.91230 WP_003899296.1.91244 WP_003899296.1.91251 WP_003899296.1.91260 WP_003899296.1.91265 WP_003899296.1.9128 WP_003899296.1.91284 WP_003899296.1.91294 WP_003899296.1.91303 WP_003899296.1.91322 WP_003899296.1.91352 WP_003899296.1.91386 WP_003899296.1.9139 WP_003899296.1.91398 WP_003899296.1.91411 WP_003899296.1.91430 WP_003899296.1.91436 WP_003899296.1.91483 WP_003899296.1.91496 WP_003899296.1.91508 WP_003899296.1.91576 WP_003899296.1.91589 WP_003899296.1.91694 WP_003899296.1.91713 WP_003899296.1.91716 WP_003899296.1.91717 WP_003899296.1.91728 WP_003899296.1.91743 WP_003899296.1.91759 WP_003899296.1.91784 WP_003899296.1.91786 WP_003899296.1.91802 WP_003899296.1.91822 WP_003899296.1.91828 WP_003899296.1.9189 WP_003899296.1.91896 WP_003899296.1.9190 WP_003899296.1.91915 WP_003899296.1.91937 WP_003899296.1.91944 WP_003899296.1.91953 WP_003899296.1.91957 WP_003899296.1.91978 WP_003899296.1.92021 WP_003899296.1.92083 WP_003899296.1.92127 WP_003899296.1.92144 WP_003899296.1.92150 WP_003899296.1.92153 WP_003899296.1.92190 WP_003899296.1.92192 WP_003899296.1.92200 WP_003899296.1.92222 WP_003899296.1.92273 WP_003899296.1.92289 WP_003899296.1.9229 WP_003899296.1.92294 WP_003899296.1.92300 WP_003899296.1.92317 WP_003899296.1.92334 WP_003899296.1.92338 WP_003899296.1.92345 WP_003899296.1.92364 WP_003899296.1.92380 WP_003899296.1.92416 WP_003899296.1.92428 WP_003899296.1.92447 WP_003899296.1.92456 WP_003899296.1.92467 WP_003899296.1.92471 WP_003899296.1.92490 WP_003899296.1.92508 WP_003899296.1.9251 WP_003899296.1.92511 WP_003899296.1.92523 WP_003899296.1.92536 WP_003899296.1.92592 WP_003899296.1.92597 WP_003899296.1.92603 WP_003899296.1.92606 WP_003899296.1.92613 WP_003899296.1.9263 WP_003899296.1.9265 WP_003899296.1.92650 WP_003899296.1.92660 WP_003899296.1.92677 WP_003899296.1.92685 WP_003899296.1.92689 WP_003899296.1.92690 WP_003899296.1.92706 WP_003899296.1.92714 WP_003899296.1.92736 WP_003899296.1.9274 WP_003899296.1.92752 WP_003899296.1.92760 WP_003899296.1.92777 WP_003899296.1.92803 WP_003899296.1.92833 WP_003899296.1.92856 WP_003899296.1.92881 WP_003899296.1.92892 WP_003899296.1.92907 WP_003899296.1.92908 WP_003899296.1.9291 WP_003899296.1.92917 WP_003899296.1.92996 WP_003899296.1.93006 WP_003899296.1.93008 WP_003899296.1.93009 WP_003899296.1.93015 WP_003899296.1.93043 WP_003899296.1.9307 WP_003899296.1.93083 WP_003899296.1.93097 WP_003899296.1.93137 WP_003899296.1.93192 WP_003899296.1.93199 WP_003899296.1.93203 WP_003899296.1.93212 WP_003899296.1.93234 WP_003899296.1.93245 WP_003899296.1.93257 WP_003899296.1.93265 WP_003899296.1.93297 WP_003899296.1.93320 WP_003899296.1.93328 WP_003899296.1.93337 WP_003899296.1.93343 WP_003899296.1.93349 WP_003899296.1.93363 WP_003899296.1.93377 WP_003899296.1.9338 WP_003899296.1.93407 WP_003899296.1.93417 WP_003899296.1.93419 WP_003899296.1.93426 WP_003899296.1.9344 WP_003899296.1.93443 WP_003899296.1.93447 WP_003899296.1.93470 WP_003899296.1.93483 WP_003899296.1.93487 WP_003899296.1.93495 WP_003899296.1.93499 WP_003899296.1.93516 WP_003899296.1.93536 WP_003899296.1.93544 WP_003899296.1.93555 WP_003899296.1.93560 WP_003899296.1.93564 WP_003899296.1.9357 WP_003899296.1.93573 WP_003899296.1.93576 WP_003899296.1.93588 WP_003899296.1.9363 WP_003899296.1.93645 WP_003899296.1.93649 WP_003899296.1.93659 WP_003899296.1.93677 WP_003899296.1.9368 WP_003899296.1.93689 WP_003899296.1.93693 WP_003899296.1.93698 WP_003899296.1.93706 WP_003899296.1.9371 WP_003899296.1.93792 WP_003899296.1.93823 WP_003899296.1.93871 WP_003899296.1.9388 WP_003899296.1.93894 WP_003899296.1.93903 WP_003899296.1.93907 WP_003899296.1.93913 WP_003899296.1.93946 WP_003899296.1.93950 WP_003899296.1.93953 WP_003899296.1.93954 WP_003899296.1.93988 WP_003899296.1.9407 WP_003899296.1.94143 WP_003899296.1.94154 WP_003899296.1.94184 WP_003899296.1.94204 WP_003899296.1.94205 WP_003899296.1.94226 WP_003899296.1.94231 WP_003899296.1.94256 WP_003899296.1.94261 WP_003899296.1.94281 WP_003899296.1.94292 WP_003899296.1.94297 WP_003899296.1.9431 WP_003899296.1.94326 WP_003899296.1.94339 WP_003899296.1.94392 WP_003899296.1.94416 WP_003899296.1.94421 WP_003899296.1.94456 WP_003899296.1.94470 WP_003899296.1.94480 WP_003899296.1.94495 WP_003899296.1.94511 WP_003899296.1.94512 WP_003899296.1.94525 WP_003899296.1.94528 WP_003899296.1.94564 WP_003899296.1.94602 WP_003899296.1.94623 WP_003899296.1.9465 WP_003899296.1.94673 WP_003899296.1.94714 WP_003899296.1.94730 WP_003899296.1.94776 WP_003899296.1.9478 WP_003899296.1.94834 WP_003899296.1.94872 WP_003899296.1.94902 WP_003899296.1.94916 WP_003899296.1.94979 WP_003899296.1.94994 WP_003899296.1.94996 WP_003899296.1.94998 WP_003899296.1.95007 WP_003899296.1.95015 WP_003899296.1.95034 WP_003899296.1.95068 WP_003899296.1.95081 WP_003899296.1.95082 WP_003899296.1.95096 WP_003899296.1.95112 WP_003899296.1.95138 WP_003899296.1.9514 WP_003899296.1.95179 WP_003899296.1.95188 WP_003899296.1.95190 WP_003899296.1.95234 WP_003899296.1.95241 WP_003899296.1.95245 WP_003899296.1.95257 WP_003899296.1.95279 WP_003899296.1.9531 WP_003899296.1.95335 WP_003899296.1.9535 WP_003899296.1.95370 WP_003899296.1.95392 WP_003899296.1.95416 WP_003899296.1.95417 WP_003899296.1.95454 WP_003899296.1.95455 WP_003899296.1.95491 WP_003899296.1.95508 WP_003899296.1.95509 WP_003899296.1.95529 WP_003899296.1.95556 WP_003899296.1.95557 WP_003899296.1.95565 WP_003899296.1.95578 WP_003899296.1.95580 WP_003899296.1.95585 WP_003899296.1.95643 WP_003899296.1.95679 WP_003899296.1.95685 WP_003899296.1.957 WP_003899296.1.95724 WP_003899296.1.95727 WP_003899296.1.95730 WP_003899296.1.95735 WP_003899296.1.95758 WP_003899296.1.95772 WP_003899296.1.95797 WP_003899296.1.95839 WP_003899296.1.9585 WP_003899296.1.9590 WP_003899296.1.95902 WP_003899296.1.95908 WP_003899296.1.95924 WP_003899296.1.95926 WP_003899296.1.95953 WP_003899296.1.95958 WP_003899296.1.95964 WP_003899296.1.95973 WP_003899296.1.96006 WP_003899296.1.9602 WP_003899296.1.96036 WP_003899296.1.96062 WP_003899296.1.96065 WP_003899296.1.96098 WP_003899296.1.96146 WP_003899296.1.96171 WP_003899296.1.96204 WP_003899296.1.96230 WP_003899296.1.96235 WP_003899296.1.96242 WP_003899296.1.96245 WP_003899296.1.96254 WP_003899296.1.96259 WP_003899296.1.96313 WP_003899296.1.96318 WP_003899296.1.96345 WP_003899296.1.96360 WP_003899296.1.96373 WP_003899296.1.96456 WP_003899296.1.96486 WP_003899296.1.96560 WP_003899296.1.96569 WP_003899296.1.96573 WP_003899296.1.96575 WP_003899296.1.96576 WP_003899296.1.96611 WP_003899296.1.96621 WP_003899296.1.9667 WP_003899296.1.96681 WP_003899296.1.96726 WP_003899296.1.96733 WP_003899296.1.96742 WP_003899296.1.96754 WP_003899296.1.9678 WP_003899296.1.96832 WP_003899296.1.9685 WP_003899296.1.97008 WP_003899296.1.97009 WP_003899296.1.97056 WP_003899296.1.97084 WP_003899296.1.97087 WP_003899296.1.97094 WP_003899296.1.97096 WP_003899296.1.97099 WP_003899296.1.97108 WP_003899296.1.97113 WP_003899296.1.97122 WP_003899296.1.97127 WP_003899296.1.97129 WP_003899296.1.97136 WP_003899296.1.9716 WP_003899296.1.97176 WP_003899296.1.97222 WP_003899296.1.97223 WP_003899296.1.97237 WP_003899296.1.97242 WP_003899296.1.97270 WP_003899296.1.97283 WP_003899296.1.97296 WP_003899296.1.97321 WP_003899296.1.97330 WP_003899296.1.97366 WP_003899296.1.97376 WP_003899296.1.97380 WP_003899296.1.9739 WP_003899296.1.97462 WP_003899296.1.97517 WP_003899296.1.97519 WP_003899296.1.97535 WP_003899296.1.97540 WP_003899296.1.97546 WP_003899296.1.97550 WP_003899296.1.97568 WP_003899296.1.97577 WP_003899296.1.97584 WP_003899296.1.9759 WP_003899296.1.97591 WP_003899296.1.97596 WP_003899296.1.97609 WP_003899296.1.97618 WP_003899296.1.9763 WP_003899296.1.97669 WP_003899296.1.97673 WP_003899296.1.97700 WP_003899296.1.97701 WP_003899296.1.9773 WP_003899296.1.97730 WP_003899296.1.97740 WP_003899296.1.97751 WP_003899296.1.97754 WP_003899296.1.97797 WP_003899296.1.9782 WP_003899296.1.9784 WP_003899296.1.97888 WP_003899296.1.9795 WP_003899296.1.97951 WP_003899296.1.97958 WP_003899296.1.97966 WP_003899296.1.97979 WP_003899296.1.97995 WP_003899296.1.98018 WP_003899296.1.98034 WP_003899296.1.98052 WP_003899296.1.98071 WP_003899296.1.98072 WP_003899296.1.98113 WP_003899296.1.98114 WP_003899296.1.98128 WP_003899296.1.98181 WP_003899296.1.98188 WP_003899296.1.98189 WP_003899296.1.98213 WP_003899296.1.98225 WP_003899296.1.98291 WP_003899296.1.98335 WP_003899296.1.98350 WP_003899296.1.98395 WP_003899296.1.98412 WP_003899296.1.98443 WP_003899296.1.98462 WP_003899296.1.9848 WP_003899296.1.98482 WP_003899296.1.98486 WP_003899296.1.98488 WP_003899296.1.98503 WP_003899296.1.98516 WP_003899296.1.98524 WP_003899296.1.98536 WP_003899296.1.98541 WP_003899296.1.98576 WP_003899296.1.98590 WP_003899296.1.98594 WP_003899296.1.98599 WP_003899296.1.98629 WP_003899296.1.98645 WP_003899296.1.98646 WP_003899296.1.98649 WP_003899296.1.98656 WP_003899296.1.98674 WP_003899296.1.98697 WP_003899296.1.98701 WP_003899296.1.98739 WP_003899296.1.98749 WP_003899296.1.98765 WP_003899296.1.98770 WP_003899296.1.98777 WP_003899296.1.98778 WP_003899296.1.98802 WP_003899296.1.98838 WP_003899296.1.98850 WP_003899296.1.98906 WP_003899296.1.98935 WP_003899296.1.98948 WP_003899296.1.98953 WP_003899296.1.98984 WP_003899296.1.99000 WP_003899296.1.99023 WP_003899296.1.99030 WP_003899296.1.99037 WP_003899296.1.99055 WP_003899296.1.99062 WP_003899296.1.99086 WP_003899296.1.99115 WP_003899296.1.99117 WP_003899296.1.99161 WP_003899296.1.99205 WP_003899296.1.99211 WP_003899296.1.99216 WP_003899296.1.99222 WP_003899296.1.99251 WP_003899296.1.99269 WP_003899296.1.99294 WP_003899296.1.99312 WP_003899296.1.99315 WP_003899296.1.99316 WP_003899296.1.99322 WP_003899296.1.99328 WP_003899296.1.99365 WP_003899296.1.99368 WP_003899296.1.99379 WP_003899296.1.99396 WP_003899296.1.99402 WP_003899296.1.99404 WP_003899296.1.99419 WP_003899296.1.99438 WP_003899296.1.99460 WP_003899296.1.99468 WP_003899296.1.99473 WP_003899296.1.99513 WP_003899296.1.99529 WP_003899296.1.99548 WP_003899296.1.99572 WP_003899296.1.99578 WP_003899296.1.99605 WP_003899296.1.99609 WP_003899296.1.99617 WP_003899296.1.99635 WP_003899296.1.99650 WP_003899296.1.99701 WP_003899296.1.99711 WP_003899296.1.99716 WP_003899296.1.99740 WP_003899296.1.99745 WP_003899296.1.99749 WP_003899296.1.9976 WP_003899296.1.99817 WP_003899296.1.99832 WP_003899296.1.99847 WP_003899296.1.99852 WP_003899296.1.99886 WP_003899296.1.99897 WP_003899296.1.99899 WP_003899296.1.99915 WP_003899296.1.9993 WP_003899296.1.99982 WP_003899296.1.99991 gi|224990751|ref|YP_002645438.1| gi|433627506|ref|YP_007261135.1| gi|197740971|ref|YP_002162285.1| gi|433635459|ref|YP_007269086.1| gi|253798545|ref|YP_003031546.1| gi|479315321|ref|YP_007855373.1| gi|15841890|ref|NP_336927.1| gi|479056340|ref|YP_007352146.1| gi|471338366|ref|YP_007611079.1| gi|378772108|ref|YP_005171841.1| gi|506926903|ref|YP_008007353.1| gi|375295808|ref|YP_005100075.1| gi|148823580|ref|YP_001288334.1| gi|433642572|ref|YP_007288331.1| gi|494700814|ref|YP_007966296.1| gi|449064439|ref|YP_007431522.1| gi|15609515|ref|NP_216894.1| NYSGRC-SEC-15609515 Rv2378c gi|525674958|ref|YP_008226470.1| gi|15609515|ref|NP_216894.1| gi|392387019|ref|YP_005308648.1| 233413.Mb2399c 336982.TBFG_12403 410289.BCG_2392c 419947.MRA_2401 478434.TBMG_01597 561275.JTY_2386 83331.MT2446 83332.Rv2378c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]