SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339632600|ref|YP_004724242.1| from Mycobacterium africanum GM041182

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339632600|ref|YP_004724242.1|
Domain Number 1 Region: 117-295,419-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.95e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000111
Further Details:      
 
Domain Number 2 Region: 292-414
Classification Level Classification E-value
Superfamily GAD domain-like 1.46e-33
Family GAD domain 0.00037
Further Details:      
 
Domain Number 3 Region: 5-109
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.35e-29
Family Anticodon-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339632600|ref|YP_004724242.1|
Sequence length 596
Comment aspartyl-tRNA synthetase [Mycobacterium africanum GM041182]
Sequence
MFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQDTEV
LAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPA
GEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDF
LVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEM
SFVDAEDIIAISEEVLTELWALIGYRIPAPIPRIGYAEAMRRFGTDKPDLRFGLELVECT
DFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGG
PVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWA
FVWVVDPPLFEPADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYD
IVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEVEEKFGFLLEAFMFGAPPHGGIAFGW
DRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQQA
Download sequence
Identical sequences F8M2S4
WP_013988931.1.99379 gi|339632600|ref|YP_004724242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]