SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339632970|ref|YP_004724612.1| from Mycobacterium africanum GM041182

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339632970|ref|YP_004724612.1|
Domain Number 1 Region: 116-310
Classification Level Classification E-value
Superfamily Formyltransferase 4.32e-56
Family Formyltransferase 0.00028
Further Details:      
 
Domain Number 2 Region: 32-107
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000666
Family IlvH-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339632970|ref|YP_004724612.1|
Sequence length 310
Comment formyltetrahydrofolate deformylase [Mycobacterium africanum GM041182]
Sequence
MGKGSMTAHATPNEPDYPPPPGGPPPPADIGRLLLRCHDRPGIIAAVSTFLARAGANIIS
LDQHSTAPEGGTFLQRAIFHLPGLTAAVDELQRDFGSTVADKFGIDYRFAEAAKPKRVAI
MASTEDHCLLDLLWRNRRGELEMSVVMVIANHPDLAAHVRPFGVPFIHIPATRDTRTEAE
QRQLQLLSGNVDLVVLARYMQILSPGFLEAIGCPLINIHHSFLPAFTGAAPYQRARERGV
KLIGATAHYVTEVLDEGPIIEQDVVRVDHTHTVDDLVRVGADVERAVLSRAALWHCQDRV
IVHHNQTIVF
Download sequence
Identical sequences F8M4W3
WP_013988964.1.45989 WP_013988964.1.82309 WP_013988964.1.87162 WP_013988964.1.94470 WP_013988964.1.99379 gi|339632970|ref|YP_004724612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]