SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339633409|ref|YP_004725051.1| from Mycobacterium africanum GM041182

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339633409|ref|YP_004725051.1|
Domain Number 1 Region: 53-169
Classification Level Classification E-value
Superfamily Formyltransferase 4.32e-27
Family Formyltransferase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339633409|ref|YP_004725051.1|
Sequence length 234
Comment hypothetical protein MAF_34180 [Mycobacterium africanum GM041182]
Sequence
MTILILTDNVHAHALAVDLQARHGDMDVYQSPIGQLPGVPRCDVAERVAEIVERYDLVLS
FHCKQRFPAALIDGVRCVNVHPGFNPYNRGWFPQVFSIIDGQKVGVTIHEIDDQLDHGPI
IAQRECAIESWDSSGSVYARLMDIERELVLEHFDAIRDGSYTAKSPATEGNLNLKKDFEQ
LRRLDLNERGTFGHFLNRLRALTHDDFRNAWFVDASGRKVFVRVVLEPEKPAEA
Download sequence
Identical sequences A0A045GRX6 A0A083VTD9 A0A0H3LFQ5 A0A0H3M919 A0A0K2I1A8 A0A109T0R4 A0A120IYK6 A0A197J0C0 A0A1S1B8R6 A5U879 F8M7J0 G0TIR5 I6XH42 M8D1I0 P65074 P9WKZ2 P9WKZ3 R4M2K7 R4MIX2
NP_217921.1.84033 WP_003417980.1.100000 WP_003417980.1.100021 WP_003417980.1.100069 WP_003417980.1.10015 WP_003417980.1.100208 WP_003417980.1.100216 WP_003417980.1.10022 WP_003417980.1.100255 WP_003417980.1.100260 WP_003417980.1.100270 WP_003417980.1.100279 WP_003417980.1.100286 WP_003417980.1.100308 WP_003417980.1.100309 WP_003417980.1.100318 WP_003417980.1.100337 WP_003417980.1.100338 WP_003417980.1.10037 WP_003417980.1.100383 WP_003417980.1.100395 WP_003417980.1.1004 WP_003417980.1.100401 WP_003417980.1.100459 WP_003417980.1.100460 WP_003417980.1.100552 WP_003417980.1.100581 WP_003417980.1.100600 WP_003417980.1.100625 WP_003417980.1.10064 WP_003417980.1.100666 WP_003417980.1.100671 WP_003417980.1.100677 WP_003417980.1.100682 WP_003417980.1.100697 WP_003417980.1.100703 WP_003417980.1.100716 WP_003417980.1.100722 WP_003417980.1.100754 WP_003417980.1.100757 WP_003417980.1.100772 WP_003417980.1.1008 WP_003417980.1.100812 WP_003417980.1.100845 WP_003417980.1.100866 WP_003417980.1.10088 WP_003417980.1.100889 WP_003417980.1.10090 WP_003417980.1.100910 WP_003417980.1.100915 WP_003417980.1.100918 WP_003417980.1.100935 WP_003417980.1.100984 WP_003417980.1.100992 WP_003417980.1.100998 WP_003417980.1.101 WP_003417980.1.101025 WP_003417980.1.101028 WP_003417980.1.10104 WP_003417980.1.101048 WP_003417980.1.101054 WP_003417980.1.101075 WP_003417980.1.101143 WP_003417980.1.101146 WP_003417980.1.10116 WP_003417980.1.10117 WP_003417980.1.101209 WP_003417980.1.10125 WP_003417980.1.101290 WP_003417980.1.101323 WP_003417980.1.101324 WP_003417980.1.101350 WP_003417980.1.101367 WP_003417980.1.101398 WP_003417980.1.101421 WP_003417980.1.10144 WP_003417980.1.101442 WP_003417980.1.10145 WP_003417980.1.101452 WP_003417980.1.101456 WP_003417980.1.101481 WP_003417980.1.101493 WP_003417980.1.101496 WP_003417980.1.101533 WP_003417980.1.101535 WP_003417980.1.101553 WP_003417980.1.101558 WP_003417980.1.10156 WP_003417980.1.101573 WP_003417980.1.101576 WP_003417980.1.10159 WP_003417980.1.101592 WP_003417980.1.101604 WP_003417980.1.101607 WP_003417980.1.101622 WP_003417980.1.101644 WP_003417980.1.101659 WP_003417980.1.101671 WP_003417980.1.101687 WP_003417980.1.101698 WP_003417980.1.10170 WP_003417980.1.101713 WP_003417980.1.101722 WP_003417980.1.101733 WP_003417980.1.101743 WP_003417980.1.101753 WP_003417980.1.101754 WP_003417980.1.101764 WP_003417980.1.101773 WP_003417980.1.101795 WP_003417980.1.101797 WP_003417980.1.101798 WP_003417980.1.101802 WP_003417980.1.101826 WP_003417980.1.101836 WP_003417980.1.101859 WP_003417980.1.101862 WP_003417980.1.101888 WP_003417980.1.101894 WP_003417980.1.101899 WP_003417980.1.1019 WP_003417980.1.101923 WP_003417980.1.101925 WP_003417980.1.10193 WP_003417980.1.101996 WP_003417980.1.102 WP_003417980.1.102008 WP_003417980.1.102017 WP_003417980.1.102053 WP_003417980.1.102055 WP_003417980.1.102063 WP_003417980.1.102099 WP_003417980.1.1021 WP_003417980.1.10211 WP_003417980.1.102119 WP_003417980.1.102121 WP_003417980.1.102143 WP_003417980.1.10216 WP_003417980.1.10224 WP_003417980.1.10253 WP_003417980.1.10262 WP_003417980.1.10272 WP_003417980.1.10277 WP_003417980.1.1033 WP_003417980.1.10350 WP_003417980.1.10362 WP_003417980.1.10366 WP_003417980.1.10376 WP_003417980.1.10396 WP_003417980.1.10410 WP_003417980.1.10414 WP_003417980.1.10430 WP_003417980.1.1044 WP_003417980.1.10440 WP_003417980.1.10445 WP_003417980.1.10471 WP_003417980.1.10472 WP_003417980.1.10489 WP_003417980.1.105 WP_003417980.1.10518 WP_003417980.1.10523 WP_003417980.1.10545 WP_003417980.1.1057 WP_003417980.1.10594 WP_003417980.1.10603 WP_003417980.1.10606 WP_003417980.1.10615 WP_003417980.1.10623 WP_003417980.1.10643 WP_003417980.1.10648 WP_003417980.1.10662 WP_003417980.1.10709 WP_003417980.1.10735 WP_003417980.1.10740 WP_003417980.1.10756 WP_003417980.1.1078 WP_003417980.1.10791 WP_003417980.1.10799 WP_003417980.1.10825 WP_003417980.1.10848 WP_003417980.1.10863 WP_003417980.1.10879 WP_003417980.1.10912 WP_003417980.1.10916 WP_003417980.1.10923 WP_003417980.1.10927 WP_003417980.1.1095 WP_003417980.1.10956 WP_003417980.1.10958 WP_003417980.1.10962 WP_003417980.1.10980 WP_003417980.1.10981 WP_003417980.1.10993 WP_003417980.1.1100 WP_003417980.1.11040 WP_003417980.1.11061 WP_003417980.1.11070 WP_003417980.1.11141 WP_003417980.1.11171 WP_003417980.1.11175 WP_003417980.1.11176 WP_003417980.1.11222 WP_003417980.1.11236 WP_003417980.1.11329 WP_003417980.1.1133 WP_003417980.1.11342 WP_003417980.1.11373 WP_003417980.1.11376 WP_003417980.1.11390 WP_003417980.1.11402 WP_003417980.1.11481 WP_003417980.1.11487 WP_003417980.1.11489 WP_003417980.1.11491 WP_003417980.1.11514 WP_003417980.1.11587 WP_003417980.1.11589 WP_003417980.1.11596 WP_003417980.1.11604 WP_003417980.1.11610 WP_003417980.1.11697 WP_003417980.1.11707 WP_003417980.1.11752 WP_003417980.1.11758 WP_003417980.1.11761 WP_003417980.1.11775 WP_003417980.1.11804 WP_003417980.1.11822 WP_003417980.1.11826 WP_003417980.1.11856 WP_003417980.1.11898 WP_003417980.1.11906 WP_003417980.1.11939 WP_003417980.1.11960 WP_003417980.1.11961 WP_003417980.1.11972 WP_003417980.1.11984 WP_003417980.1.120 WP_003417980.1.12001 WP_003417980.1.12049 WP_003417980.1.12052 WP_003417980.1.12100 WP_003417980.1.12116 WP_003417980.1.12133 WP_003417980.1.12165 WP_003417980.1.12184 WP_003417980.1.12187 WP_003417980.1.12190 WP_003417980.1.12216 WP_003417980.1.12265 WP_003417980.1.12275 WP_003417980.1.12293 WP_003417980.1.12294 WP_003417980.1.123 WP_003417980.1.1231 WP_003417980.1.12314 WP_003417980.1.12327 WP_003417980.1.12338 WP_003417980.1.1236 WP_003417980.1.12371 WP_003417980.1.12372 WP_003417980.1.12389 WP_003417980.1.12406 WP_003417980.1.12421 WP_003417980.1.12424 WP_003417980.1.12446 WP_003417980.1.12464 WP_003417980.1.12479 WP_003417980.1.12519 WP_003417980.1.12523 WP_003417980.1.12526 WP_003417980.1.1255 WP_003417980.1.12550 WP_003417980.1.12551 WP_003417980.1.12563 WP_003417980.1.12611 WP_003417980.1.12669 WP_003417980.1.1267 WP_003417980.1.12672 WP_003417980.1.12692 WP_003417980.1.1271 WP_003417980.1.12710 WP_003417980.1.12768 WP_003417980.1.1279 WP_003417980.1.12794 WP_003417980.1.12801 WP_003417980.1.12804 WP_003417980.1.12821 WP_003417980.1.12841 WP_003417980.1.12854 WP_003417980.1.12871 WP_003417980.1.12901 WP_003417980.1.12941 WP_003417980.1.12947 WP_003417980.1.12957 WP_003417980.1.12972 WP_003417980.1.13028 WP_003417980.1.13043 WP_003417980.1.13086 WP_003417980.1.13087 WP_003417980.1.13090 WP_003417980.1.13096 WP_003417980.1.13163 WP_003417980.1.13175 WP_003417980.1.13183 WP_003417980.1.132 WP_003417980.1.13249 WP_003417980.1.13282 WP_003417980.1.13284 WP_003417980.1.13296 WP_003417980.1.13298 WP_003417980.1.13302 WP_003417980.1.13306 WP_003417980.1.13312 WP_003417980.1.13313 WP_003417980.1.13321 WP_003417980.1.13358 WP_003417980.1.13370 WP_003417980.1.13375 WP_003417980.1.1338 WP_003417980.1.13420 WP_003417980.1.13433 WP_003417980.1.13435 WP_003417980.1.13438 WP_003417980.1.13461 WP_003417980.1.13466 WP_003417980.1.13489 WP_003417980.1.13526 WP_003417980.1.13551 WP_003417980.1.13561 WP_003417980.1.13564 WP_003417980.1.13579 WP_003417980.1.13647 WP_003417980.1.13667 WP_003417980.1.13687 WP_003417980.1.13697 WP_003417980.1.13719 WP_003417980.1.13763 WP_003417980.1.1377 WP_003417980.1.13774 WP_003417980.1.13786 WP_003417980.1.13794 WP_003417980.1.13817 WP_003417980.1.13834 WP_003417980.1.13866 WP_003417980.1.13880 WP_003417980.1.13899 WP_003417980.1.13909 WP_003417980.1.13910 WP_003417980.1.13919 WP_003417980.1.13920 WP_003417980.1.13952 WP_003417980.1.13953 WP_003417980.1.13962 WP_003417980.1.1398 WP_003417980.1.13988 WP_003417980.1.14027 WP_003417980.1.14046 WP_003417980.1.14115 WP_003417980.1.1415 WP_003417980.1.14152 WP_003417980.1.14158 WP_003417980.1.14162 WP_003417980.1.14175 WP_003417980.1.14178 WP_003417980.1.14194 WP_003417980.1.14195 WP_003417980.1.14208 WP_003417980.1.14238 WP_003417980.1.14266 WP_003417980.1.14273 WP_003417980.1.14303 WP_003417980.1.14306 WP_003417980.1.14307 WP_003417980.1.14310 WP_003417980.1.14341 WP_003417980.1.14382 WP_003417980.1.14416 WP_003417980.1.14428 WP_003417980.1.14441 WP_003417980.1.14477 WP_003417980.1.14504 WP_003417980.1.14514 WP_003417980.1.1452 WP_003417980.1.14527 WP_003417980.1.1454 WP_003417980.1.14544 WP_003417980.1.14548 WP_003417980.1.14551 WP_003417980.1.14561 WP_003417980.1.14573 WP_003417980.1.1462 WP_003417980.1.14658 WP_003417980.1.14667 WP_003417980.1.14668 WP_003417980.1.14675 WP_003417980.1.14694 WP_003417980.1.14695 WP_003417980.1.14709 WP_003417980.1.14766 WP_003417980.1.14783 WP_003417980.1.14865 WP_003417980.1.14872 WP_003417980.1.14905 WP_003417980.1.14926 WP_003417980.1.14951 WP_003417980.1.14955 WP_003417980.1.15003 WP_003417980.1.15009 WP_003417980.1.15028 WP_003417980.1.15040 WP_003417980.1.15052 WP_003417980.1.15065 WP_003417980.1.15072 WP_003417980.1.15089 WP_003417980.1.1509 WP_003417980.1.15126 WP_003417980.1.15131 WP_003417980.1.15168 WP_003417980.1.15172 WP_003417980.1.15174 WP_003417980.1.15187 WP_003417980.1.15196 WP_003417980.1.15210 WP_003417980.1.15216 WP_003417980.1.15217 WP_003417980.1.1523 WP_003417980.1.15232 WP_003417980.1.15238 WP_003417980.1.15240 WP_003417980.1.15253 WP_003417980.1.15267 WP_003417980.1.1527 WP_003417980.1.15292 WP_003417980.1.15299 WP_003417980.1.15302 WP_003417980.1.15322 WP_003417980.1.1534 WP_003417980.1.15345 WP_003417980.1.15365 WP_003417980.1.15372 WP_003417980.1.15386 WP_003417980.1.15387 WP_003417980.1.15442 WP_003417980.1.15447 WP_003417980.1.15449 WP_003417980.1.15477 WP_003417980.1.15481 WP_003417980.1.15492 WP_003417980.1.15511 WP_003417980.1.15512 WP_003417980.1.15558 WP_003417980.1.15559 WP_003417980.1.15566 WP_003417980.1.15599 WP_003417980.1.1560 WP_003417980.1.15611 WP_003417980.1.1563 WP_003417980.1.15633 WP_003417980.1.15643 WP_003417980.1.15688 WP_003417980.1.15755 WP_003417980.1.15763 WP_003417980.1.15774 WP_003417980.1.1578 WP_003417980.1.15780 WP_003417980.1.15827 WP_003417980.1.15834 WP_003417980.1.15842 WP_003417980.1.15848 WP_003417980.1.15853 WP_003417980.1.15870 WP_003417980.1.15877 WP_003417980.1.15893 WP_003417980.1.15896 WP_003417980.1.15926 WP_003417980.1.15933 WP_003417980.1.15946 WP_003417980.1.15958 WP_003417980.1.15973 WP_003417980.1.15987 WP_003417980.1.15993 WP_003417980.1.16009 WP_003417980.1.16025 WP_003417980.1.16043 WP_003417980.1.16066 WP_003417980.1.16069 WP_003417980.1.16077 WP_003417980.1.16106 WP_003417980.1.16108 WP_003417980.1.16130 WP_003417980.1.16136 WP_003417980.1.16139 WP_003417980.1.16141 WP_003417980.1.16143 WP_003417980.1.16318 WP_003417980.1.1632 WP_003417980.1.16327 WP_003417980.1.16334 WP_003417980.1.16341 WP_003417980.1.16345 WP_003417980.1.16374 WP_003417980.1.16384 WP_003417980.1.16386 WP_003417980.1.164 WP_003417980.1.1642 WP_003417980.1.16421 WP_003417980.1.16424 WP_003417980.1.16426 WP_003417980.1.16431 WP_003417980.1.16438 WP_003417980.1.16442 WP_003417980.1.16448 WP_003417980.1.16451 WP_003417980.1.16476 WP_003417980.1.16480 WP_003417980.1.16494 WP_003417980.1.1652 WP_003417980.1.16549 WP_003417980.1.16560 WP_003417980.1.16598 WP_003417980.1.16609 WP_003417980.1.16619 WP_003417980.1.16620 WP_003417980.1.16622 WP_003417980.1.16637 WP_003417980.1.1669 WP_003417980.1.16707 WP_003417980.1.16724 WP_003417980.1.16731 WP_003417980.1.16743 WP_003417980.1.1683 WP_003417980.1.16837 WP_003417980.1.16852 WP_003417980.1.16937 WP_003417980.1.16940 WP_003417980.1.16950 WP_003417980.1.16959 WP_003417980.1.16968 WP_003417980.1.1697 WP_003417980.1.16977 WP_003417980.1.16987 WP_003417980.1.17005 WP_003417980.1.17006 WP_003417980.1.17010 WP_003417980.1.17015 WP_003417980.1.17019 WP_003417980.1.17039 WP_003417980.1.17041 WP_003417980.1.17052 WP_003417980.1.17057 WP_003417980.1.17062 WP_003417980.1.1707 WP_003417980.1.17094 WP_003417980.1.17130 WP_003417980.1.17138 WP_003417980.1.17147 WP_003417980.1.17167 WP_003417980.1.17224 WP_003417980.1.17251 WP_003417980.1.17288 WP_003417980.1.17304 WP_003417980.1.17314 WP_003417980.1.17345 WP_003417980.1.17381 WP_003417980.1.17391 WP_003417980.1.17412 WP_003417980.1.1743 WP_003417980.1.17440 WP_003417980.1.17466 WP_003417980.1.17477 WP_003417980.1.17483 WP_003417980.1.17505 WP_003417980.1.17527 WP_003417980.1.17535 WP_003417980.1.17540 WP_003417980.1.17553 WP_003417980.1.17558 WP_003417980.1.17599 WP_003417980.1.17635 WP_003417980.1.17655 WP_003417980.1.17679 WP_003417980.1.17687 WP_003417980.1.17700 WP_003417980.1.17710 WP_003417980.1.17713 WP_003417980.1.17722 WP_003417980.1.17746 WP_003417980.1.17788 WP_003417980.1.17798 WP_003417980.1.17803 WP_003417980.1.17816 WP_003417980.1.17821 WP_003417980.1.17830 WP_003417980.1.17868 WP_003417980.1.17878 WP_003417980.1.1792 WP_003417980.1.17923 WP_003417980.1.1795 WP_003417980.1.17955 WP_003417980.1.17973 WP_003417980.1.18009 WP_003417980.1.18013 WP_003417980.1.18033 WP_003417980.1.18057 WP_003417980.1.18065 WP_003417980.1.18070 WP_003417980.1.18116 WP_003417980.1.18120 WP_003417980.1.18126 WP_003417980.1.1817 WP_003417980.1.18170 WP_003417980.1.18206 WP_003417980.1.18216 WP_003417980.1.18240 WP_003417980.1.18257 WP_003417980.1.18297 WP_003417980.1.18306 WP_003417980.1.18364 WP_003417980.1.18399 WP_003417980.1.18411 WP_003417980.1.18444 WP_003417980.1.18448 WP_003417980.1.18467 WP_003417980.1.18476 WP_003417980.1.18522 WP_003417980.1.18580 WP_003417980.1.18582 WP_003417980.1.18587 WP_003417980.1.18601 WP_003417980.1.18639 WP_003417980.1.18646 WP_003417980.1.18647 WP_003417980.1.1868 WP_003417980.1.18694 WP_003417980.1.18710 WP_003417980.1.18751 WP_003417980.1.18781 WP_003417980.1.18793 WP_003417980.1.18804 WP_003417980.1.18816 WP_003417980.1.18823 WP_003417980.1.18827 WP_003417980.1.18838 WP_003417980.1.18849 WP_003417980.1.18856 WP_003417980.1.18945 WP_003417980.1.1898 WP_003417980.1.19005 WP_003417980.1.19056 WP_003417980.1.19063 WP_003417980.1.19066 WP_003417980.1.19071 WP_003417980.1.19085 WP_003417980.1.19094 WP_003417980.1.19144 WP_003417980.1.19159 WP_003417980.1.19193 WP_003417980.1.19231 WP_003417980.1.19243 WP_003417980.1.19264 WP_003417980.1.19295 WP_003417980.1.19307 WP_003417980.1.19326 WP_003417980.1.1933 WP_003417980.1.19364 WP_003417980.1.19382 WP_003417980.1.19400 WP_003417980.1.19426 WP_003417980.1.19429 WP_003417980.1.19464 WP_003417980.1.19480 WP_003417980.1.19553 WP_003417980.1.19562 WP_003417980.1.19564 WP_003417980.1.19568 WP_003417980.1.19572 WP_003417980.1.19595 WP_003417980.1.19596 WP_003417980.1.19600 WP_003417980.1.19630 WP_003417980.1.1967 WP_003417980.1.19694 WP_003417980.1.1970 WP_003417980.1.19707 WP_003417980.1.19742 WP_003417980.1.19785 WP_003417980.1.19820 WP_003417980.1.19868 WP_003417980.1.19874 WP_003417980.1.19890 WP_003417980.1.19900 WP_003417980.1.19922 WP_003417980.1.19936 WP_003417980.1.19946 WP_003417980.1.19949 WP_003417980.1.19960 WP_003417980.1.19964 WP_003417980.1.20007 WP_003417980.1.20016 WP_003417980.1.2003 WP_003417980.1.20037 WP_003417980.1.20039 WP_003417980.1.20082 WP_003417980.1.20085 WP_003417980.1.20097 WP_003417980.1.20116 WP_003417980.1.20130 WP_003417980.1.20140 WP_003417980.1.20141 WP_003417980.1.20142 WP_003417980.1.20158 WP_003417980.1.20239 WP_003417980.1.20243 WP_003417980.1.20259 WP_003417980.1.20262 WP_003417980.1.20268 WP_003417980.1.20272 WP_003417980.1.20280 WP_003417980.1.20294 WP_003417980.1.20300 WP_003417980.1.20309 WP_003417980.1.20322 WP_003417980.1.2037 WP_003417980.1.20372 WP_003417980.1.20381 WP_003417980.1.204 WP_003417980.1.20427 WP_003417980.1.20457 WP_003417980.1.20459 WP_003417980.1.20460 WP_003417980.1.20542 WP_003417980.1.20578 WP_003417980.1.20608 WP_003417980.1.20624 WP_003417980.1.20628 WP_003417980.1.2066 WP_003417980.1.20707 WP_003417980.1.20722 WP_003417980.1.20729 WP_003417980.1.20742 WP_003417980.1.20751 WP_003417980.1.20776 WP_003417980.1.20843 WP_003417980.1.20850 WP_003417980.1.2086 WP_003417980.1.20868 WP_003417980.1.20876 WP_003417980.1.20897 WP_003417980.1.20898 WP_003417980.1.2090 WP_003417980.1.20911 WP_003417980.1.20916 WP_003417980.1.20921 WP_003417980.1.20926 WP_003417980.1.20927 WP_003417980.1.20951 WP_003417980.1.20970 WP_003417980.1.2104 WP_003417980.1.21070 WP_003417980.1.21127 WP_003417980.1.21135 WP_003417980.1.21173 WP_003417980.1.21187 WP_003417980.1.212 WP_003417980.1.2120 WP_003417980.1.21218 WP_003417980.1.21219 WP_003417980.1.2123 WP_003417980.1.21231 WP_003417980.1.21234 WP_003417980.1.2126 WP_003417980.1.21292 WP_003417980.1.21307 WP_003417980.1.2131 WP_003417980.1.21311 WP_003417980.1.21321 WP_003417980.1.21365 WP_003417980.1.21392 WP_003417980.1.21397 WP_003417980.1.21403 WP_003417980.1.21415 WP_003417980.1.21418 WP_003417980.1.21430 WP_003417980.1.21434 WP_003417980.1.21444 WP_003417980.1.21468 WP_003417980.1.21498 WP_003417980.1.21509 WP_003417980.1.21513 WP_003417980.1.21560 WP_003417980.1.21565 WP_003417980.1.21586 WP_003417980.1.21591 WP_003417980.1.21594 WP_003417980.1.21602 WP_003417980.1.21615 WP_003417980.1.21638 WP_003417980.1.21639 WP_003417980.1.21655 WP_003417980.1.21658 WP_003417980.1.2168 WP_003417980.1.2174 WP_003417980.1.21741 WP_003417980.1.21742 WP_003417980.1.21777 WP_003417980.1.21786 WP_003417980.1.21795 WP_003417980.1.218 WP_003417980.1.21826 WP_003417980.1.21829 WP_003417980.1.21840 WP_003417980.1.21843 WP_003417980.1.21872 WP_003417980.1.21873 WP_003417980.1.2188 WP_003417980.1.21882 WP_003417980.1.21906 WP_003417980.1.21912 WP_003417980.1.2194 WP_003417980.1.21941 WP_003417980.1.21956 WP_003417980.1.21958 WP_003417980.1.21960 WP_003417980.1.21971 WP_003417980.1.21973 WP_003417980.1.21983 WP_003417980.1.22003 WP_003417980.1.22013 WP_003417980.1.22025 WP_003417980.1.22036 WP_003417980.1.22075 WP_003417980.1.22092 WP_003417980.1.2212 WP_003417980.1.22127 WP_003417980.1.22140 WP_003417980.1.22233 WP_003417980.1.22255 WP_003417980.1.22277 WP_003417980.1.22305 WP_003417980.1.22348 WP_003417980.1.22356 WP_003417980.1.22366 WP_003417980.1.2238 WP_003417980.1.22380 WP_003417980.1.22437 WP_003417980.1.22438 WP_003417980.1.22445 WP_003417980.1.22511 WP_003417980.1.22524 WP_003417980.1.2253 WP_003417980.1.22585 WP_003417980.1.22589 WP_003417980.1.22606 WP_003417980.1.22608 WP_003417980.1.22609 WP_003417980.1.22618 WP_003417980.1.2262 WP_003417980.1.22624 WP_003417980.1.22629 WP_003417980.1.22647 WP_003417980.1.22664 WP_003417980.1.22665 WP_003417980.1.22670 WP_003417980.1.22674 WP_003417980.1.22680 WP_003417980.1.22725 WP_003417980.1.22733 WP_003417980.1.22737 WP_003417980.1.2275 WP_003417980.1.22754 WP_003417980.1.22797 WP_003417980.1.22800 WP_003417980.1.22804 WP_003417980.1.22829 WP_003417980.1.22840 WP_003417980.1.22844 WP_003417980.1.22963 WP_003417980.1.22970 WP_003417980.1.22996 WP_003417980.1.22997 WP_003417980.1.22999 WP_003417980.1.23015 WP_003417980.1.23032 WP_003417980.1.231 WP_003417980.1.23101 WP_003417980.1.2312 WP_003417980.1.23140 WP_003417980.1.23153 WP_003417980.1.23171 WP_003417980.1.23199 WP_003417980.1.2320 WP_003417980.1.23204 WP_003417980.1.23216 WP_003417980.1.23229 WP_003417980.1.23233 WP_003417980.1.2326 WP_003417980.1.23261 WP_003417980.1.23272 WP_003417980.1.23289 WP_003417980.1.2329 WP_003417980.1.23308 WP_003417980.1.23316 WP_003417980.1.23321 WP_003417980.1.23325 WP_003417980.1.2339 WP_003417980.1.23406 WP_003417980.1.23438 WP_003417980.1.23445 WP_003417980.1.23447 WP_003417980.1.23452 WP_003417980.1.23461 WP_003417980.1.2349 WP_003417980.1.23496 WP_003417980.1.23497 WP_003417980.1.23506 WP_003417980.1.23530 WP_003417980.1.23539 WP_003417980.1.23546 WP_003417980.1.23551 WP_003417980.1.23573 WP_003417980.1.23583 WP_003417980.1.23588 WP_003417980.1.23628 WP_003417980.1.23677 WP_003417980.1.23683 WP_003417980.1.23692 WP_003417980.1.23694 WP_003417980.1.23699 WP_003417980.1.2371 WP_003417980.1.23803 WP_003417980.1.23807 WP_003417980.1.23825 WP_003417980.1.23832 WP_003417980.1.2384 WP_003417980.1.23843 WP_003417980.1.23863 WP_003417980.1.2387 WP_003417980.1.23894 WP_003417980.1.23993 WP_003417980.1.2400 WP_003417980.1.24007 WP_003417980.1.24008 WP_003417980.1.24046 WP_003417980.1.24057 WP_003417980.1.24062 WP_003417980.1.24113 WP_003417980.1.24119 WP_003417980.1.24140 WP_003417980.1.24176 WP_003417980.1.24190 WP_003417980.1.24202 WP_003417980.1.24244 WP_003417980.1.24261 WP_003417980.1.24284 WP_003417980.1.24294 WP_003417980.1.24357 WP_003417980.1.24396 WP_003417980.1.24414 WP_003417980.1.24423 WP_003417980.1.2443 WP_003417980.1.24446 WP_003417980.1.24461 WP_003417980.1.24500 WP_003417980.1.24507 WP_003417980.1.24529 WP_003417980.1.24599 WP_003417980.1.24638 WP_003417980.1.24648 WP_003417980.1.2466 WP_003417980.1.24767 WP_003417980.1.24824 WP_003417980.1.24831 WP_003417980.1.24840 WP_003417980.1.24848 WP_003417980.1.2487 WP_003417980.1.24893 WP_003417980.1.24907 WP_003417980.1.24933 WP_003417980.1.24956 WP_003417980.1.24958 WP_003417980.1.24985 WP_003417980.1.2499 WP_003417980.1.25004 WP_003417980.1.2505 WP_003417980.1.25051 WP_003417980.1.2507 WP_003417980.1.25096 WP_003417980.1.25103 WP_003417980.1.25129 WP_003417980.1.25171 WP_003417980.1.25184 WP_003417980.1.25247 WP_003417980.1.25252 WP_003417980.1.25278 WP_003417980.1.25283 WP_003417980.1.25309 WP_003417980.1.25313 WP_003417980.1.25338 WP_003417980.1.25342 WP_003417980.1.25343 WP_003417980.1.25367 WP_003417980.1.25393 WP_003417980.1.25406 WP_003417980.1.25435 WP_003417980.1.25437 WP_003417980.1.25445 WP_003417980.1.25455 WP_003417980.1.25473 WP_003417980.1.25504 WP_003417980.1.25513 WP_003417980.1.25542 WP_003417980.1.25579 WP_003417980.1.25594 WP_003417980.1.25606 WP_003417980.1.25645 WP_003417980.1.2566 WP_003417980.1.25673 WP_003417980.1.25674 WP_003417980.1.25693 WP_003417980.1.25699 WP_003417980.1.25727 WP_003417980.1.25736 WP_003417980.1.25738 WP_003417980.1.25756 WP_003417980.1.25759 WP_003417980.1.2580 WP_003417980.1.25813 WP_003417980.1.25854 WP_003417980.1.25874 WP_003417980.1.25885 WP_003417980.1.25892 WP_003417980.1.25906 WP_003417980.1.25914 WP_003417980.1.25916 WP_003417980.1.2594 WP_003417980.1.25954 WP_003417980.1.25965 WP_003417980.1.26032 WP_003417980.1.26038 WP_003417980.1.26072 WP_003417980.1.26089 WP_003417980.1.26097 WP_003417980.1.26098 WP_003417980.1.26108 WP_003417980.1.26109 WP_003417980.1.26118 WP_003417980.1.26126 WP_003417980.1.2614 WP_003417980.1.26168 WP_003417980.1.26182 WP_003417980.1.26190 WP_003417980.1.2620 WP_003417980.1.26234 WP_003417980.1.26243 WP_003417980.1.26267 WP_003417980.1.26292 WP_003417980.1.26310 WP_003417980.1.26328 WP_003417980.1.26349 WP_003417980.1.26366 WP_003417980.1.26374 WP_003417980.1.26407 WP_003417980.1.26412 WP_003417980.1.26454 WP_003417980.1.26464 WP_003417980.1.2653 WP_003417980.1.26560 WP_003417980.1.26571 WP_003417980.1.2659 WP_003417980.1.26597 WP_003417980.1.26603 WP_003417980.1.26629 WP_003417980.1.26651 WP_003417980.1.26702 WP_003417980.1.26707 WP_003417980.1.26710 WP_003417980.1.26719 WP_003417980.1.26737 WP_003417980.1.26738 WP_003417980.1.26745 WP_003417980.1.26756 WP_003417980.1.2676 WP_003417980.1.2677 WP_003417980.1.26779 WP_003417980.1.26780 WP_003417980.1.26854 WP_003417980.1.26868 WP_003417980.1.26876 WP_003417980.1.26888 WP_003417980.1.26914 WP_003417980.1.26945 WP_003417980.1.26959 WP_003417980.1.26969 WP_003417980.1.26984 WP_003417980.1.26992 WP_003417980.1.27017 WP_003417980.1.27045 WP_003417980.1.27074 WP_003417980.1.27075 WP_003417980.1.27128 WP_003417980.1.27130 WP_003417980.1.27139 WP_003417980.1.27152 WP_003417980.1.27164 WP_003417980.1.27193 WP_003417980.1.27235 WP_003417980.1.27254 WP_003417980.1.27278 WP_003417980.1.27343 WP_003417980.1.27352 WP_003417980.1.27369 WP_003417980.1.27391 WP_003417980.1.27398 WP_003417980.1.27402 WP_003417980.1.27410 WP_003417980.1.27411 WP_003417980.1.27449 WP_003417980.1.27460 WP_003417980.1.27463 WP_003417980.1.2749 WP_003417980.1.27492 WP_003417980.1.27528 WP_003417980.1.27541 WP_003417980.1.27576 WP_003417980.1.27582 WP_003417980.1.27596 WP_003417980.1.27607 WP_003417980.1.2766 WP_003417980.1.277 WP_003417980.1.27724 WP_003417980.1.27730 WP_003417980.1.27736 WP_003417980.1.27743 WP_003417980.1.27750 WP_003417980.1.27771 WP_003417980.1.27779 WP_003417980.1.27795 WP_003417980.1.27803 WP_003417980.1.27819 WP_003417980.1.27835 WP_003417980.1.27915 WP_003417980.1.27935 WP_003417980.1.27962 WP_003417980.1.28092 WP_003417980.1.28106 WP_003417980.1.28131 WP_003417980.1.28142 WP_003417980.1.28159 WP_003417980.1.2816 WP_003417980.1.28161 WP_003417980.1.28192 WP_003417980.1.28202 WP_003417980.1.28241 WP_003417980.1.28242 WP_003417980.1.28251 WP_003417980.1.28255 WP_003417980.1.28269 WP_003417980.1.28293 WP_003417980.1.28331 WP_003417980.1.28367 WP_003417980.1.28391 WP_003417980.1.2842 WP_003417980.1.28448 WP_003417980.1.2847 WP_003417980.1.28471 WP_003417980.1.28473 WP_003417980.1.28493 WP_003417980.1.28497 WP_003417980.1.28530 WP_003417980.1.28545 WP_003417980.1.28561 WP_003417980.1.28567 WP_003417980.1.28585 WP_003417980.1.286 WP_003417980.1.28617 WP_003417980.1.28634 WP_003417980.1.28642 WP_003417980.1.28671 WP_003417980.1.28682 WP_003417980.1.28698 WP_003417980.1.28703 WP_003417980.1.28739 WP_003417980.1.28781 WP_003417980.1.28787 WP_003417980.1.28827 WP_003417980.1.28839 WP_003417980.1.28847 WP_003417980.1.28850 WP_003417980.1.28851 WP_003417980.1.28865 WP_003417980.1.28897 WP_003417980.1.28914 WP_003417980.1.28935 WP_003417980.1.28936 WP_003417980.1.28939 WP_003417980.1.28943 WP_003417980.1.28952 WP_003417980.1.28975 WP_003417980.1.2899 WP_003417980.1.28993 WP_003417980.1.29000 WP_003417980.1.2901 WP_003417980.1.29028 WP_003417980.1.29033 WP_003417980.1.29058 WP_003417980.1.29115 WP_003417980.1.2916 WP_003417980.1.29217 WP_003417980.1.29223 WP_003417980.1.29234 WP_003417980.1.29264 WP_003417980.1.29275 WP_003417980.1.29306 WP_003417980.1.29339 WP_003417980.1.29348 WP_003417980.1.29364 WP_003417980.1.29367 WP_003417980.1.2938 WP_003417980.1.29426 WP_003417980.1.2944 WP_003417980.1.29449 WP_003417980.1.29450 WP_003417980.1.29452 WP_003417980.1.2949 WP_003417980.1.29510 WP_003417980.1.29515 WP_003417980.1.29525 WP_003417980.1.2953 WP_003417980.1.29559 WP_003417980.1.29587 WP_003417980.1.2959 WP_003417980.1.29592 WP_003417980.1.29599 WP_003417980.1.29611 WP_003417980.1.29632 WP_003417980.1.29649 WP_003417980.1.2965 WP_003417980.1.29659 WP_003417980.1.2969 WP_003417980.1.29696 WP_003417980.1.29698 WP_003417980.1.29718 WP_003417980.1.29745 WP_003417980.1.29747 WP_003417980.1.29769 WP_003417980.1.29825 WP_003417980.1.29830 WP_003417980.1.29847 WP_003417980.1.29861 WP_003417980.1.29869 WP_003417980.1.29883 WP_003417980.1.29890 WP_003417980.1.299 WP_003417980.1.29931 WP_003417980.1.29960 WP_003417980.1.30014 WP_003417980.1.3004 WP_003417980.1.30040 WP_003417980.1.30043 WP_003417980.1.30074 WP_003417980.1.30097 WP_003417980.1.30101 WP_003417980.1.30106 WP_003417980.1.30126 WP_003417980.1.30131 WP_003417980.1.30138 WP_003417980.1.30139 WP_003417980.1.30145 WP_003417980.1.30211 WP_003417980.1.30224 WP_003417980.1.30235 WP_003417980.1.30237 WP_003417980.1.3027 WP_003417980.1.30279 WP_003417980.1.30282 WP_003417980.1.30283 WP_003417980.1.30288 WP_003417980.1.30291 WP_003417980.1.30363 WP_003417980.1.30374 WP_003417980.1.30404 WP_003417980.1.3043 WP_003417980.1.30433 WP_003417980.1.30438 WP_003417980.1.30462 WP_003417980.1.30464 WP_003417980.1.30468 WP_003417980.1.30500 WP_003417980.1.3057 WP_003417980.1.30574 WP_003417980.1.30628 WP_003417980.1.30641 WP_003417980.1.30642 WP_003417980.1.30661 WP_003417980.1.30669 WP_003417980.1.30683 WP_003417980.1.30699 WP_003417980.1.30709 WP_003417980.1.30713 WP_003417980.1.30716 WP_003417980.1.30719 WP_003417980.1.30730 WP_003417980.1.30732 WP_003417980.1.30736 WP_003417980.1.30760 WP_003417980.1.30791 WP_003417980.1.308 WP_003417980.1.30807 WP_003417980.1.30818 WP_003417980.1.30824 WP_003417980.1.30848 WP_003417980.1.30877 WP_003417980.1.30888 WP_003417980.1.30901 WP_003417980.1.30903 WP_003417980.1.30912 WP_003417980.1.30913 WP_003417980.1.30914 WP_003417980.1.30919 WP_003417980.1.30977 WP_003417980.1.3100 WP_003417980.1.31002 WP_003417980.1.3101 WP_003417980.1.31034 WP_003417980.1.31047 WP_003417980.1.31070 WP_003417980.1.31074 WP_003417980.1.31102 WP_003417980.1.31127 WP_003417980.1.31184 WP_003417980.1.31199 WP_003417980.1.31226 WP_003417980.1.31230 WP_003417980.1.31233 WP_003417980.1.31263 WP_003417980.1.31264 WP_003417980.1.31270 WP_003417980.1.31287 WP_003417980.1.31290 WP_003417980.1.31304 WP_003417980.1.31346 WP_003417980.1.31348 WP_003417980.1.31354 WP_003417980.1.31390 WP_003417980.1.31414 WP_003417980.1.31417 WP_003417980.1.31428 WP_003417980.1.3143 WP_003417980.1.31458 WP_003417980.1.31483 WP_003417980.1.3149 WP_003417980.1.31498 WP_003417980.1.31507 WP_003417980.1.31537 WP_003417980.1.31548 WP_003417980.1.31569 WP_003417980.1.31573 WP_003417980.1.316 WP_003417980.1.31629 WP_003417980.1.31666 WP_003417980.1.31693 WP_003417980.1.31703 WP_003417980.1.31744 WP_003417980.1.31745 WP_003417980.1.31770 WP_003417980.1.31776 WP_003417980.1.31783 WP_003417980.1.318 WP_003417980.1.3184 WP_003417980.1.31840 WP_003417980.1.31880 WP_003417980.1.31911 WP_003417980.1.31930 WP_003417980.1.31932 WP_003417980.1.31955 WP_003417980.1.31985 WP_003417980.1.31991 WP_003417980.1.31995 WP_003417980.1.32004 WP_003417980.1.32039 WP_003417980.1.3204 WP_003417980.1.32045 WP_003417980.1.32071 WP_003417980.1.32098 WP_003417980.1.32132 WP_003417980.1.32157 WP_003417980.1.32164 WP_003417980.1.32179 WP_003417980.1.32198 WP_003417980.1.32297 WP_003417980.1.32317 WP_003417980.1.32383 WP_003417980.1.32400 WP_003417980.1.32403 WP_003417980.1.32416 WP_003417980.1.32421 WP_003417980.1.32433 WP_003417980.1.32461 WP_003417980.1.32482 WP_003417980.1.32503 WP_003417980.1.32556 WP_003417980.1.32562 WP_003417980.1.32569 WP_003417980.1.32592 WP_003417980.1.32620 WP_003417980.1.32647 WP_003417980.1.32653 WP_003417980.1.32654 WP_003417980.1.3268 WP_003417980.1.32695 WP_003417980.1.32706 WP_003417980.1.32716 WP_003417980.1.32738 WP_003417980.1.32752 WP_003417980.1.32780 WP_003417980.1.32781 WP_003417980.1.32793 WP_003417980.1.32799 WP_003417980.1.32822 WP_003417980.1.32833 WP_003417980.1.32862 WP_003417980.1.32880 WP_003417980.1.32897 WP_003417980.1.32909 WP_003417980.1.32935 WP_003417980.1.32974 WP_003417980.1.33007 WP_003417980.1.3302 WP_003417980.1.33028 WP_003417980.1.33035 WP_003417980.1.33044 WP_003417980.1.33054 WP_003417980.1.33082 WP_003417980.1.33141 WP_003417980.1.33148 WP_003417980.1.33155 WP_003417980.1.33168 WP_003417980.1.3321 WP_003417980.1.33215 WP_003417980.1.3325 WP_003417980.1.3327 WP_003417980.1.33278 WP_003417980.1.33288 WP_003417980.1.33305 WP_003417980.1.3331 WP_003417980.1.33319 WP_003417980.1.3333 WP_003417980.1.33393 WP_003417980.1.33403 WP_003417980.1.33452 WP_003417980.1.33467 WP_003417980.1.33477 WP_003417980.1.3349 WP_003417980.1.33519 WP_003417980.1.33542 WP_003417980.1.33601 WP_003417980.1.33602 WP_003417980.1.33633 WP_003417980.1.33646 WP_003417980.1.33673 WP_003417980.1.3369 WP_003417980.1.33705 WP_003417980.1.33762 WP_003417980.1.33783 WP_003417980.1.33789 WP_003417980.1.3383 WP_003417980.1.33832 WP_003417980.1.33839 WP_003417980.1.33848 WP_003417980.1.3387 WP_003417980.1.33886 WP_003417980.1.33895 WP_003417980.1.33906 WP_003417980.1.33912 WP_003417980.1.33954 WP_003417980.1.3399 WP_003417980.1.34042 WP_003417980.1.3405 WP_003417980.1.34056 WP_003417980.1.34065 WP_003417980.1.3408 WP_003417980.1.34090 WP_003417980.1.34109 WP_003417980.1.34111 WP_003417980.1.34131 WP_003417980.1.34152 WP_003417980.1.34153 WP_003417980.1.34163 WP_003417980.1.34181 WP_003417980.1.34197 WP_003417980.1.34198 WP_003417980.1.34215 WP_003417980.1.34219 WP_003417980.1.34255 WP_003417980.1.34260 WP_003417980.1.34275 WP_003417980.1.343 WP_003417980.1.34347 WP_003417980.1.34358 WP_003417980.1.34392 WP_003417980.1.344 WP_003417980.1.34428 WP_003417980.1.34435 WP_003417980.1.34446 WP_003417980.1.34499 WP_003417980.1.34505 WP_003417980.1.34516 WP_003417980.1.34529 WP_003417980.1.34551 WP_003417980.1.34563 WP_003417980.1.34576 WP_003417980.1.34581 WP_003417980.1.34588 WP_003417980.1.34596 WP_003417980.1.34599 WP_003417980.1.34639 WP_003417980.1.34673 WP_003417980.1.34724 WP_003417980.1.34740 WP_003417980.1.34755 WP_003417980.1.34777 WP_003417980.1.34783 WP_003417980.1.34841 WP_003417980.1.34908 WP_003417980.1.34919 WP_003417980.1.3492 WP_003417980.1.34933 WP_003417980.1.34945 WP_003417980.1.34946 WP_003417980.1.34954 WP_003417980.1.34960 WP_003417980.1.34961 WP_003417980.1.34963 WP_003417980.1.34965 WP_003417980.1.34968 WP_003417980.1.35023 WP_003417980.1.35069 WP_003417980.1.35072 WP_003417980.1.35078 WP_003417980.1.35100 WP_003417980.1.35146 WP_003417980.1.35156 WP_003417980.1.35160 WP_003417980.1.35162 WP_003417980.1.35173 WP_003417980.1.35176 WP_003417980.1.3520 WP_003417980.1.35213 WP_003417980.1.35221 WP_003417980.1.35246 WP_003417980.1.35278 WP_003417980.1.35301 WP_003417980.1.35311 WP_003417980.1.35312 WP_003417980.1.35317 WP_003417980.1.35319 WP_003417980.1.35347 WP_003417980.1.35363 WP_003417980.1.35382 WP_003417980.1.35385 WP_003417980.1.35396 WP_003417980.1.35426 WP_003417980.1.35439 WP_003417980.1.35455 WP_003417980.1.3548 WP_003417980.1.35484 WP_003417980.1.35492 WP_003417980.1.3553 WP_003417980.1.35553 WP_003417980.1.35555 WP_003417980.1.35561 WP_003417980.1.35602 WP_003417980.1.35610 WP_003417980.1.35635 WP_003417980.1.35657 WP_003417980.1.35680 WP_003417980.1.35687 WP_003417980.1.35689 WP_003417980.1.35707 WP_003417980.1.35732 WP_003417980.1.35754 WP_003417980.1.35767 WP_003417980.1.35770 WP_003417980.1.35771 WP_003417980.1.35780 WP_003417980.1.35805 WP_003417980.1.35811 WP_003417980.1.35821 WP_003417980.1.3584 WP_003417980.1.35848 WP_003417980.1.35864 WP_003417980.1.35874 WP_003417980.1.35876 WP_003417980.1.35897 WP_003417980.1.35899 WP_003417980.1.3593 WP_003417980.1.35954 WP_003417980.1.36005 WP_003417980.1.36014 WP_003417980.1.36023 WP_003417980.1.36051 WP_003417980.1.36053 WP_003417980.1.36075 WP_003417980.1.36089 WP_003417980.1.36097 WP_003417980.1.36098 WP_003417980.1.36116 WP_003417980.1.36145 WP_003417980.1.36156 WP_003417980.1.36205 WP_003417980.1.36228 WP_003417980.1.36246 WP_003417980.1.36252 WP_003417980.1.36260 WP_003417980.1.36270 WP_003417980.1.36271 WP_003417980.1.36303 WP_003417980.1.36309 WP_003417980.1.36315 WP_003417980.1.36319 WP_003417980.1.36321 WP_003417980.1.36326 WP_003417980.1.3634 WP_003417980.1.36356 WP_003417980.1.36357 WP_003417980.1.3636 WP_003417980.1.36385 WP_003417980.1.36399 WP_003417980.1.36436 WP_003417980.1.36465 WP_003417980.1.36469 WP_003417980.1.36473 WP_003417980.1.36485 WP_003417980.1.36508 WP_003417980.1.36540 WP_003417980.1.36561 WP_003417980.1.36571 WP_003417980.1.36573 WP_003417980.1.36578 WP_003417980.1.36585 WP_003417980.1.36597 WP_003417980.1.36614 WP_003417980.1.36657 WP_003417980.1.36674 WP_003417980.1.36720 WP_003417980.1.36727 WP_003417980.1.36733 WP_003417980.1.36785 WP_003417980.1.36810 WP_003417980.1.36844 WP_003417980.1.36862 WP_003417980.1.36893 WP_003417980.1.36901 WP_003417980.1.36921 WP_003417980.1.36935 WP_003417980.1.3695 WP_003417980.1.36951 WP_003417980.1.36968 WP_003417980.1.3700 WP_003417980.1.37004 WP_003417980.1.37012 WP_003417980.1.37071 WP_003417980.1.37088 WP_003417980.1.37131 WP_003417980.1.37157 WP_003417980.1.37175 WP_003417980.1.37188 WP_003417980.1.37213 WP_003417980.1.37229 WP_003417980.1.3724 WP_003417980.1.37277 WP_003417980.1.37305 WP_003417980.1.37330 WP_003417980.1.37389 WP_003417980.1.37400 WP_003417980.1.37440 WP_003417980.1.37459 WP_003417980.1.37468 WP_003417980.1.37475 WP_003417980.1.37484 WP_003417980.1.37601 WP_003417980.1.37612 WP_003417980.1.37632 WP_003417980.1.37643 WP_003417980.1.37655 WP_003417980.1.37660 WP_003417980.1.37674 WP_003417980.1.37700 WP_003417980.1.37701 WP_003417980.1.37709 WP_003417980.1.37711 WP_003417980.1.37721 WP_003417980.1.37722 WP_003417980.1.37747 WP_003417980.1.37765 WP_003417980.1.37772 WP_003417980.1.37804 WP_003417980.1.37809 WP_003417980.1.37859 WP_003417980.1.37877 WP_003417980.1.37912 WP_003417980.1.37913 WP_003417980.1.37943 WP_003417980.1.37950 WP_003417980.1.37973 WP_003417980.1.37975 WP_003417980.1.37983 WP_003417980.1.38 WP_003417980.1.38002 WP_003417980.1.3802 WP_003417980.1.38039 WP_003417980.1.38040 WP_003417980.1.38067 WP_003417980.1.38068 WP_003417980.1.38135 WP_003417980.1.38138 WP_003417980.1.38144 WP_003417980.1.38158 WP_003417980.1.38159 WP_003417980.1.38210 WP_003417980.1.38233 WP_003417980.1.38240 WP_003417980.1.38299 WP_003417980.1.38332 WP_003417980.1.38347 WP_003417980.1.38354 WP_003417980.1.38380 WP_003417980.1.38384 WP_003417980.1.38389 WP_003417980.1.38398 WP_003417980.1.38402 WP_003417980.1.38418 WP_003417980.1.38421 WP_003417980.1.38466 WP_003417980.1.38477 WP_003417980.1.38483 WP_003417980.1.385 WP_003417980.1.38530 WP_003417980.1.38535 WP_003417980.1.38594 WP_003417980.1.38611 WP_003417980.1.38638 WP_003417980.1.38639 WP_003417980.1.38646 WP_003417980.1.38648 WP_003417980.1.38659 WP_003417980.1.38660 WP_003417980.1.38666 WP_003417980.1.38671 WP_003417980.1.38672 WP_003417980.1.38677 WP_003417980.1.38750 WP_003417980.1.38772 WP_003417980.1.38812 WP_003417980.1.38821 WP_003417980.1.38844 WP_003417980.1.38863 WP_003417980.1.38873 WP_003417980.1.3889 WP_003417980.1.38894 WP_003417980.1.38909 WP_003417980.1.38939 WP_003417980.1.38974 WP_003417980.1.38975 WP_003417980.1.38991 WP_003417980.1.39025 WP_003417980.1.39070 WP_003417980.1.39072 WP_003417980.1.39095 WP_003417980.1.39106 WP_003417980.1.39165 WP_003417980.1.39174 WP_003417980.1.39176 WP_003417980.1.39178 WP_003417980.1.39190 WP_003417980.1.39201 WP_003417980.1.39207 WP_003417980.1.39211 WP_003417980.1.39236 WP_003417980.1.39239 WP_003417980.1.39252 WP_003417980.1.39288 WP_003417980.1.39295 WP_003417980.1.39306 WP_003417980.1.39359 WP_003417980.1.39364 WP_003417980.1.39400 WP_003417980.1.39447 WP_003417980.1.39450 WP_003417980.1.39455 WP_003417980.1.3949 WP_003417980.1.39521 WP_003417980.1.39560 WP_003417980.1.39592 WP_003417980.1.39593 WP_003417980.1.396 WP_003417980.1.3960 WP_003417980.1.39616 WP_003417980.1.39654 WP_003417980.1.39657 WP_003417980.1.39661 WP_003417980.1.39674 WP_003417980.1.39678 WP_003417980.1.3968 WP_003417980.1.39694 WP_003417980.1.3971 WP_003417980.1.39718 WP_003417980.1.39728 WP_003417980.1.39739 WP_003417980.1.39748 WP_003417980.1.39751 WP_003417980.1.39759 WP_003417980.1.39801 WP_003417980.1.39804 WP_003417980.1.39848 WP_003417980.1.39877 WP_003417980.1.39925 WP_003417980.1.3994 WP_003417980.1.39959 WP_003417980.1.3996 WP_003417980.1.39960 WP_003417980.1.3997 WP_003417980.1.39980 WP_003417980.1.40000 WP_003417980.1.40028 WP_003417980.1.40029 WP_003417980.1.4003 WP_003417980.1.40094 WP_003417980.1.40096 WP_003417980.1.40150 WP_003417980.1.40156 WP_003417980.1.40174 WP_003417980.1.40186 WP_003417980.1.40276 WP_003417980.1.40277 WP_003417980.1.40323 WP_003417980.1.40336 WP_003417980.1.40353 WP_003417980.1.4036 WP_003417980.1.40372 WP_003417980.1.40402 WP_003417980.1.40413 WP_003417980.1.40440 WP_003417980.1.40446 WP_003417980.1.40451 WP_003417980.1.40455 WP_003417980.1.40523 WP_003417980.1.40543 WP_003417980.1.40641 WP_003417980.1.40646 WP_003417980.1.40651 WP_003417980.1.40653 WP_003417980.1.4067 WP_003417980.1.40705 WP_003417980.1.40723 WP_003417980.1.40731 WP_003417980.1.40735 WP_003417980.1.40795 WP_003417980.1.40799 WP_003417980.1.40876 WP_003417980.1.40881 WP_003417980.1.40922 WP_003417980.1.40948 WP_003417980.1.4095 WP_003417980.1.40956 WP_003417980.1.40957 WP_003417980.1.40964 WP_003417980.1.4097 WP_003417980.1.410 WP_003417980.1.41000 WP_003417980.1.41055 WP_003417980.1.41108 WP_003417980.1.41123 WP_003417980.1.41177 WP_003417980.1.41202 WP_003417980.1.41219 WP_003417980.1.41231 WP_003417980.1.41249 WP_003417980.1.4127 WP_003417980.1.41296 WP_003417980.1.41355 WP_003417980.1.41376 WP_003417980.1.41430 WP_003417980.1.41447 WP_003417980.1.41469 WP_003417980.1.41504 WP_003417980.1.41553 WP_003417980.1.41564 WP_003417980.1.41583 WP_003417980.1.41616 WP_003417980.1.41632 WP_003417980.1.41635 WP_003417980.1.41636 WP_003417980.1.41648 WP_003417980.1.41660 WP_003417980.1.41685 WP_003417980.1.41695 WP_003417980.1.41704 WP_003417980.1.4171 WP_003417980.1.41719 WP_003417980.1.41733 WP_003417980.1.41744 WP_003417980.1.41774 WP_003417980.1.41791 WP_003417980.1.41803 WP_003417980.1.41820 WP_003417980.1.41828 WP_003417980.1.41829 WP_003417980.1.41860 WP_003417980.1.41921 WP_003417980.1.41933 WP_003417980.1.41944 WP_003417980.1.42043 WP_003417980.1.42075 WP_003417980.1.42078 WP_003417980.1.42094 WP_003417980.1.42112 WP_003417980.1.4212 WP_003417980.1.42122 WP_003417980.1.42134 WP_003417980.1.42183 WP_003417980.1.42188 WP_003417980.1.42201 WP_003417980.1.42202 WP_003417980.1.42208 WP_003417980.1.42247 WP_003417980.1.42255 WP_003417980.1.42273 WP_003417980.1.42278 WP_003417980.1.42304 WP_003417980.1.42309 WP_003417980.1.42370 WP_003417980.1.42385 WP_003417980.1.42400 WP_003417980.1.42409 WP_003417980.1.42414 WP_003417980.1.42417 WP_003417980.1.42430 WP_003417980.1.42461 WP_003417980.1.42465 WP_003417980.1.42467 WP_003417980.1.42473 WP_003417980.1.42474 WP_003417980.1.4248 WP_003417980.1.42494 WP_003417980.1.42519 WP_003417980.1.42524 WP_003417980.1.42534 WP_003417980.1.4255 WP_003417980.1.42562 WP_003417980.1.42568 WP_003417980.1.42570 WP_003417980.1.42618 WP_003417980.1.42660 WP_003417980.1.42695 WP_003417980.1.42704 WP_003417980.1.42705 WP_003417980.1.42722 WP_003417980.1.42777 WP_003417980.1.42782 WP_003417980.1.42835 WP_003417980.1.42842 WP_003417980.1.42905 WP_003417980.1.42916 WP_003417980.1.42930 WP_003417980.1.42971 WP_003417980.1.43005 WP_003417980.1.43009 WP_003417980.1.43053 WP_003417980.1.43082 WP_003417980.1.43087 WP_003417980.1.43098 WP_003417980.1.43208 WP_003417980.1.43236 WP_003417980.1.43246 WP_003417980.1.43255 WP_003417980.1.43266 WP_003417980.1.43269 WP_003417980.1.43273 WP_003417980.1.43296 WP_003417980.1.43306 WP_003417980.1.4335 WP_003417980.1.43368 WP_003417980.1.43395 WP_003417980.1.43457 WP_003417980.1.43462 WP_003417980.1.43475 WP_003417980.1.43478 WP_003417980.1.43484 WP_003417980.1.43557 WP_003417980.1.43578 WP_003417980.1.43588 WP_003417980.1.43643 WP_003417980.1.43664 WP_003417980.1.43684 WP_003417980.1.43686 WP_003417980.1.43716 WP_003417980.1.4377 WP_003417980.1.43781 WP_003417980.1.43794 WP_003417980.1.43815 WP_003417980.1.43846 WP_003417980.1.43861 WP_003417980.1.43863 WP_003417980.1.43866 WP_003417980.1.43872 WP_003417980.1.43885 WP_003417980.1.43897 WP_003417980.1.4390 WP_003417980.1.43902 WP_003417980.1.43921 WP_003417980.1.43936 WP_003417980.1.43937 WP_003417980.1.43960 WP_003417980.1.43965 WP_003417980.1.4399 WP_003417980.1.43993 WP_003417980.1.43996 WP_003417980.1.44 WP_003417980.1.44001 WP_003417980.1.44008 WP_003417980.1.44016 WP_003417980.1.44033 WP_003417980.1.44037 WP_003417980.1.44041 WP_003417980.1.44070 WP_003417980.1.44071 WP_003417980.1.44076 WP_003417980.1.44104 WP_003417980.1.44111 WP_003417980.1.44124 WP_003417980.1.44169 WP_003417980.1.44219 WP_003417980.1.44237 WP_003417980.1.44277 WP_003417980.1.44279 WP_003417980.1.44336 WP_003417980.1.44355 WP_003417980.1.44358 WP_003417980.1.4438 WP_003417980.1.44390 WP_003417980.1.44392 WP_003417980.1.4441 WP_003417980.1.44415 WP_003417980.1.44466 WP_003417980.1.44492 WP_003417980.1.44494 WP_003417980.1.44500 WP_003417980.1.44519 WP_003417980.1.44526 WP_003417980.1.44532 WP_003417980.1.44534 WP_003417980.1.44562 WP_003417980.1.44589 WP_003417980.1.44597 WP_003417980.1.44602 WP_003417980.1.44615 WP_003417980.1.4464 WP_003417980.1.44651 WP_003417980.1.44659 WP_003417980.1.44665 WP_003417980.1.44694 WP_003417980.1.44700 WP_003417980.1.44735 WP_003417980.1.44740 WP_003417980.1.44757 WP_003417980.1.4476 WP_003417980.1.44761 WP_003417980.1.44767 WP_003417980.1.44776 WP_003417980.1.44779 WP_003417980.1.44786 WP_003417980.1.44808 WP_003417980.1.44864 WP_003417980.1.44901 WP_003417980.1.44908 WP_003417980.1.44913 WP_003417980.1.4492 WP_003417980.1.44939 WP_003417980.1.44979 WP_003417980.1.44981 WP_003417980.1.45002 WP_003417980.1.45011 WP_003417980.1.4504 WP_003417980.1.45062 WP_003417980.1.45066 WP_003417980.1.45081 WP_003417980.1.45113 WP_003417980.1.45129 WP_003417980.1.45135 WP_003417980.1.45147 WP_003417980.1.45168 WP_003417980.1.4517 WP_003417980.1.45181 WP_003417980.1.45185 WP_003417980.1.45192 WP_003417980.1.45200 WP_003417980.1.45205 WP_003417980.1.45211 WP_003417980.1.45249 WP_003417980.1.4526 WP_003417980.1.45286 WP_003417980.1.45326 WP_003417980.1.45347 WP_003417980.1.45374 WP_003417980.1.45390 WP_003417980.1.454 WP_003417980.1.45407 WP_003417980.1.45451 WP_003417980.1.45453 WP_003417980.1.45460 WP_003417980.1.45463 WP_003417980.1.45470 WP_003417980.1.45474 WP_003417980.1.45491 WP_003417980.1.45510 WP_003417980.1.45563 WP_003417980.1.45584 WP_003417980.1.45590 WP_003417980.1.45619 WP_003417980.1.45626 WP_003417980.1.45631 WP_003417980.1.45666 WP_003417980.1.45697 WP_003417980.1.4571 WP_003417980.1.45731 WP_003417980.1.45743 WP_003417980.1.45765 WP_003417980.1.45776 WP_003417980.1.45783 WP_003417980.1.45805 WP_003417980.1.45815 WP_003417980.1.45849 WP_003417980.1.45867 WP_003417980.1.45884 WP_003417980.1.4590 WP_003417980.1.45923 WP_003417980.1.45926 WP_003417980.1.45963 WP_003417980.1.45989 WP_003417980.1.45992 WP_003417980.1.46025 WP_003417980.1.46083 WP_003417980.1.46090 WP_003417980.1.46092 WP_003417980.1.46100 WP_003417980.1.46101 WP_003417980.1.46103 WP_003417980.1.46107 WP_003417980.1.46127 WP_003417980.1.46128 WP_003417980.1.46129 WP_003417980.1.46141 WP_003417980.1.46150 WP_003417980.1.46201 WP_003417980.1.46226 WP_003417980.1.4624 WP_003417980.1.46253 WP_003417980.1.46268 WP_003417980.1.46285 WP_003417980.1.46300 WP_003417980.1.46313 WP_003417980.1.46336 WP_003417980.1.46365 WP_003417980.1.46370 WP_003417980.1.46381 WP_003417980.1.46402 WP_003417980.1.46411 WP_003417980.1.4644 WP_003417980.1.46442 WP_003417980.1.46453 WP_003417980.1.46478 WP_003417980.1.46492 WP_003417980.1.46521 WP_003417980.1.4653 WP_003417980.1.46532 WP_003417980.1.46539 WP_003417980.1.46568 WP_003417980.1.46585 WP_003417980.1.46609 WP_003417980.1.46613 WP_003417980.1.46625 WP_003417980.1.46642 WP_003417980.1.46647 WP_003417980.1.46724 WP_003417980.1.46758 WP_003417980.1.46773 WP_003417980.1.46777 WP_003417980.1.46786 WP_003417980.1.46792 WP_003417980.1.46847 WP_003417980.1.46851 WP_003417980.1.4687 WP_003417980.1.46897 WP_003417980.1.46936 WP_003417980.1.46980 WP_003417980.1.47011 WP_003417980.1.47012 WP_003417980.1.47066 WP_003417980.1.47077 WP_003417980.1.47083 WP_003417980.1.47106 WP_003417980.1.47142 WP_003417980.1.47147 WP_003417980.1.47166 WP_003417980.1.47178 WP_003417980.1.47179 WP_003417980.1.47194 WP_003417980.1.47207 WP_003417980.1.47210 WP_003417980.1.47262 WP_003417980.1.47402 WP_003417980.1.47502 WP_003417980.1.4751 WP_003417980.1.47511 WP_003417980.1.47537 WP_003417980.1.47540 WP_003417980.1.47568 WP_003417980.1.47572 WP_003417980.1.47588 WP_003417980.1.47636 WP_003417980.1.4764 WP_003417980.1.47653 WP_003417980.1.47679 WP_003417980.1.47681 WP_003417980.1.47690 WP_003417980.1.4771 WP_003417980.1.47717 WP_003417980.1.47743 WP_003417980.1.47754 WP_003417980.1.47773 WP_003417980.1.47776 WP_003417980.1.47780 WP_003417980.1.47805 WP_003417980.1.47832 WP_003417980.1.47847 WP_003417980.1.47858 WP_003417980.1.47861 WP_003417980.1.47868 WP_003417980.1.47893 WP_003417980.1.47899 WP_003417980.1.479 WP_003417980.1.47912 WP_003417980.1.47913 WP_003417980.1.47926 WP_003417980.1.4794 WP_003417980.1.47943 WP_003417980.1.47944 WP_003417980.1.47959 WP_003417980.1.47974 WP_003417980.1.47993 WP_003417980.1.48004 WP_003417980.1.48039 WP_003417980.1.48050 WP_003417980.1.48084 WP_003417980.1.48097 WP_003417980.1.48101 WP_003417980.1.48109 WP_003417980.1.4813 WP_003417980.1.48130 WP_003417980.1.48135 WP_003417980.1.48143 WP_003417980.1.48152 WP_003417980.1.48155 WP_003417980.1.48170 WP_003417980.1.48173 WP_003417980.1.48177 WP_003417980.1.48185 WP_003417980.1.48204 WP_003417980.1.48219 WP_003417980.1.4823 WP_003417980.1.48240 WP_003417980.1.48256 WP_003417980.1.48264 WP_003417980.1.48287 WP_003417980.1.48330 WP_003417980.1.48333 WP_003417980.1.48348 WP_003417980.1.48354 WP_003417980.1.48372 WP_003417980.1.48383 WP_003417980.1.48388 WP_003417980.1.48419 WP_003417980.1.48443 WP_003417980.1.48450 WP_003417980.1.48462 WP_003417980.1.48543 WP_003417980.1.48550 WP_003417980.1.48605 WP_003417980.1.4863 WP_003417980.1.48648 WP_003417980.1.48658 WP_003417980.1.48666 WP_003417980.1.48687 WP_003417980.1.48779 WP_003417980.1.4878 WP_003417980.1.48798 WP_003417980.1.48802 WP_003417980.1.48826 WP_003417980.1.48831 WP_003417980.1.48843 WP_003417980.1.48857 WP_003417980.1.4890 WP_003417980.1.48946 WP_003417980.1.48979 WP_003417980.1.49017 WP_003417980.1.49048 WP_003417980.1.49059 WP_003417980.1.4906 WP_003417980.1.4907 WP_003417980.1.49103 WP_003417980.1.49110 WP_003417980.1.49111 WP_003417980.1.49112 WP_003417980.1.4919 WP_003417980.1.49251 WP_003417980.1.49254 WP_003417980.1.49263 WP_003417980.1.49291 WP_003417980.1.49296 WP_003417980.1.49335 WP_003417980.1.49337 WP_003417980.1.49419 WP_003417980.1.49426 WP_003417980.1.49437 WP_003417980.1.49439 WP_003417980.1.49474 WP_003417980.1.49506 WP_003417980.1.49523 WP_003417980.1.49526 WP_003417980.1.49532 WP_003417980.1.49588 WP_003417980.1.4959 WP_003417980.1.49678 WP_003417980.1.49687 WP_003417980.1.49699 WP_003417980.1.49709 WP_003417980.1.4971 WP_003417980.1.4972 WP_003417980.1.49736 WP_003417980.1.49746 WP_003417980.1.49764 WP_003417980.1.49773 WP_003417980.1.49796 WP_003417980.1.49814 WP_003417980.1.49816 WP_003417980.1.49839 WP_003417980.1.49857 WP_003417980.1.49878 WP_003417980.1.49880 WP_003417980.1.49944 WP_003417980.1.4999 WP_003417980.1.49990 WP_003417980.1.50068 WP_003417980.1.50077 WP_003417980.1.5008 WP_003417980.1.50081 WP_003417980.1.50122 WP_003417980.1.50126 WP_003417980.1.50149 WP_003417980.1.50162 WP_003417980.1.5018 WP_003417980.1.50194 WP_003417980.1.50218 WP_003417980.1.50235 WP_003417980.1.50249 WP_003417980.1.50265 WP_003417980.1.50271 WP_003417980.1.50324 WP_003417980.1.50347 WP_003417980.1.50372 WP_003417980.1.50398 WP_003417980.1.50407 WP_003417980.1.50444 WP_003417980.1.50466 WP_003417980.1.50472 WP_003417980.1.5048 WP_003417980.1.50498 WP_003417980.1.5050 WP_003417980.1.50540 WP_003417980.1.50554 WP_003417980.1.50601 WP_003417980.1.50610 WP_003417980.1.50632 WP_003417980.1.50633 WP_003417980.1.50655 WP_003417980.1.50659 WP_003417980.1.50683 WP_003417980.1.50689 WP_003417980.1.50692 WP_003417980.1.50714 WP_003417980.1.50729 WP_003417980.1.50756 WP_003417980.1.50784 WP_003417980.1.50794 WP_003417980.1.50841 WP_003417980.1.50868 WP_003417980.1.50877 WP_003417980.1.5096 WP_003417980.1.50981 WP_003417980.1.50987 WP_003417980.1.51003 WP_003417980.1.51009 WP_003417980.1.51037 WP_003417980.1.51074 WP_003417980.1.51082 WP_003417980.1.51101 WP_003417980.1.51116 WP_003417980.1.51149 WP_003417980.1.51156 WP_003417980.1.51157 WP_003417980.1.51213 WP_003417980.1.51232 WP_003417980.1.51239 WP_003417980.1.51247 WP_003417980.1.51266 WP_003417980.1.51279 WP_003417980.1.51291 WP_003417980.1.51294 WP_003417980.1.51301 WP_003417980.1.51329 WP_003417980.1.51391 WP_003417980.1.51422 WP_003417980.1.51445 WP_003417980.1.51455 WP_003417980.1.51466 WP_003417980.1.51468 WP_003417980.1.51478 WP_003417980.1.51497 WP_003417980.1.51520 WP_003417980.1.51593 WP_003417980.1.51628 WP_003417980.1.5164 WP_003417980.1.51647 WP_003417980.1.51660 WP_003417980.1.51696 WP_003417980.1.51721 WP_003417980.1.51788 WP_003417980.1.51795 WP_003417980.1.51801 WP_003417980.1.51817 WP_003417980.1.51819 WP_003417980.1.51854 WP_003417980.1.51923 WP_003417980.1.51942 WP_003417980.1.51948 WP_003417980.1.51963 WP_003417980.1.51969 WP_003417980.1.52000 WP_003417980.1.52001 WP_003417980.1.52003 WP_003417980.1.52036 WP_003417980.1.52038 WP_003417980.1.52046 WP_003417980.1.52059 WP_003417980.1.52069 WP_003417980.1.52082 WP_003417980.1.52102 WP_003417980.1.52106 WP_003417980.1.52166 WP_003417980.1.52168 WP_003417980.1.52173 WP_003417980.1.52178 WP_003417980.1.52206 WP_003417980.1.52216 WP_003417980.1.52238 WP_003417980.1.52241 WP_003417980.1.52280 WP_003417980.1.52385 WP_003417980.1.52390 WP_003417980.1.524 WP_003417980.1.52460 WP_003417980.1.52485 WP_003417980.1.52486 WP_003417980.1.52495 WP_003417980.1.52504 WP_003417980.1.52522 WP_003417980.1.52531 WP_003417980.1.52533 WP_003417980.1.52545 WP_003417980.1.52553 WP_003417980.1.52563 WP_003417980.1.52564 WP_003417980.1.52574 WP_003417980.1.52641 WP_003417980.1.52673 WP_003417980.1.52674 WP_003417980.1.52708 WP_003417980.1.52713 WP_003417980.1.52761 WP_003417980.1.52778 WP_003417980.1.52791 WP_003417980.1.52797 WP_003417980.1.52818 WP_003417980.1.52872 WP_003417980.1.52873 WP_003417980.1.52891 WP_003417980.1.52892 WP_003417980.1.52909 WP_003417980.1.52970 WP_003417980.1.52998 WP_003417980.1.53053 WP_003417980.1.53056 WP_003417980.1.5306 WP_003417980.1.53088 WP_003417980.1.5309 WP_003417980.1.531 WP_003417980.1.53117 WP_003417980.1.53118 WP_003417980.1.53142 WP_003417980.1.53143 WP_003417980.1.53157 WP_003417980.1.53167 WP_003417980.1.53200 WP_003417980.1.53204 WP_003417980.1.53213 WP_003417980.1.53217 WP_003417980.1.53226 WP_003417980.1.53229 WP_003417980.1.53230 WP_003417980.1.53254 WP_003417980.1.53257 WP_003417980.1.5327 WP_003417980.1.53276 WP_003417980.1.53278 WP_003417980.1.533 WP_003417980.1.53302 WP_003417980.1.53306 WP_003417980.1.5334 WP_003417980.1.5335 WP_003417980.1.53353 WP_003417980.1.53381 WP_003417980.1.53413 WP_003417980.1.53458 WP_003417980.1.53460 WP_003417980.1.53480 WP_003417980.1.53517 WP_003417980.1.53522 WP_003417980.1.53525 WP_003417980.1.53526 WP_003417980.1.53553 WP_003417980.1.53606 WP_003417980.1.53609 WP_003417980.1.53628 WP_003417980.1.53643 WP_003417980.1.53667 WP_003417980.1.53679 WP_003417980.1.53715 WP_003417980.1.53730 WP_003417980.1.53742 WP_003417980.1.53743 WP_003417980.1.53754 WP_003417980.1.53775 WP_003417980.1.53787 WP_003417980.1.53803 WP_003417980.1.53818 WP_003417980.1.53853 WP_003417980.1.53865 WP_003417980.1.53888 WP_003417980.1.53900 WP_003417980.1.53914 WP_003417980.1.53952 WP_003417980.1.5398 WP_003417980.1.5408 WP_003417980.1.54093 WP_003417980.1.54099 WP_003417980.1.54112 WP_003417980.1.54125 WP_003417980.1.54141 WP_003417980.1.54162 WP_003417980.1.54179 WP_003417980.1.54206 WP_003417980.1.54218 WP_003417980.1.54225 WP_003417980.1.54227 WP_003417980.1.54232 WP_003417980.1.54241 WP_003417980.1.54245 WP_003417980.1.54247 WP_003417980.1.54275 WP_003417980.1.54280 WP_003417980.1.5429 WP_003417980.1.54294 WP_003417980.1.54314 WP_003417980.1.54347 WP_003417980.1.54351 WP_003417980.1.54370 WP_003417980.1.54428 WP_003417980.1.54449 WP_003417980.1.54494 WP_003417980.1.54502 WP_003417980.1.54514 WP_003417980.1.54519 WP_003417980.1.5452 WP_003417980.1.54531 WP_003417980.1.54537 WP_003417980.1.54553 WP_003417980.1.54555 WP_003417980.1.54575 WP_003417980.1.54633 WP_003417980.1.54686 WP_003417980.1.54687 WP_003417980.1.54705 WP_003417980.1.54730 WP_003417980.1.54732 WP_003417980.1.5475 WP_003417980.1.54797 WP_003417980.1.54807 WP_003417980.1.54836 WP_003417980.1.54838 WP_003417980.1.54860 WP_003417980.1.54888 WP_003417980.1.54897 WP_003417980.1.54905 WP_003417980.1.54909 WP_003417980.1.54937 WP_003417980.1.54939 WP_003417980.1.54944 WP_003417980.1.54945 WP_003417980.1.54953 WP_003417980.1.54964 WP_003417980.1.55015 WP_003417980.1.55022 WP_003417980.1.55023 WP_003417980.1.55051 WP_003417980.1.55072 WP_003417980.1.55088 WP_003417980.1.55106 WP_003417980.1.55126 WP_003417980.1.55128 WP_003417980.1.55140 WP_003417980.1.55150 WP_003417980.1.55210 WP_003417980.1.55227 WP_003417980.1.55248 WP_003417980.1.55257 WP_003417980.1.55258 WP_003417980.1.55267 WP_003417980.1.55279 WP_003417980.1.55307 WP_003417980.1.55326 WP_003417980.1.55328 WP_003417980.1.5533 WP_003417980.1.55345 WP_003417980.1.55396 WP_003417980.1.55398 WP_003417980.1.55441 WP_003417980.1.55459 WP_003417980.1.55501 WP_003417980.1.55504 WP_003417980.1.55578 WP_003417980.1.55626 WP_003417980.1.55641 WP_003417980.1.5569 WP_003417980.1.55723 WP_003417980.1.55735 WP_003417980.1.5574 WP_003417980.1.55772 WP_003417980.1.55802 WP_003417980.1.55819 WP_003417980.1.55821 WP_003417980.1.5583 WP_003417980.1.55849 WP_003417980.1.55856 WP_003417980.1.55860 WP_003417980.1.55882 WP_003417980.1.55883 WP_003417980.1.55894 WP_003417980.1.55902 WP_003417980.1.55908 WP_003417980.1.55909 WP_003417980.1.5591 WP_003417980.1.55961 WP_003417980.1.55977 WP_003417980.1.55983 WP_003417980.1.56028 WP_003417980.1.56057 WP_003417980.1.56060 WP_003417980.1.56107 WP_003417980.1.56132 WP_003417980.1.56163 WP_003417980.1.56167 WP_003417980.1.56178 WP_003417980.1.56287 WP_003417980.1.56292 WP_003417980.1.56327 WP_003417980.1.56341 WP_003417980.1.56359 WP_003417980.1.56365 WP_003417980.1.56394 WP_003417980.1.56443 WP_003417980.1.56473 WP_003417980.1.56478 WP_003417980.1.56500 WP_003417980.1.56517 WP_003417980.1.56534 WP_003417980.1.56577 WP_003417980.1.56593 WP_003417980.1.56625 WP_003417980.1.56637 WP_003417980.1.56670 WP_003417980.1.56697 WP_003417980.1.567 WP_003417980.1.56701 WP_003417980.1.56709 WP_003417980.1.56729 WP_003417980.1.56743 WP_003417980.1.56755 WP_003417980.1.56764 WP_003417980.1.56769 WP_003417980.1.56770 WP_003417980.1.56795 WP_003417980.1.5681 WP_003417980.1.56827 WP_003417980.1.56839 WP_003417980.1.56863 WP_003417980.1.56868 WP_003417980.1.56869 WP_003417980.1.56915 WP_003417980.1.56926 WP_003417980.1.56961 WP_003417980.1.56971 WP_003417980.1.56972 WP_003417980.1.57023 WP_003417980.1.57035 WP_003417980.1.57077 WP_003417980.1.57087 WP_003417980.1.57094 WP_003417980.1.57134 WP_003417980.1.57151 WP_003417980.1.57169 WP_003417980.1.57208 WP_003417980.1.57212 WP_003417980.1.57230 WP_003417980.1.5724 WP_003417980.1.5725 WP_003417980.1.5727 WP_003417980.1.57273 WP_003417980.1.573 WP_003417980.1.57314 WP_003417980.1.57326 WP_003417980.1.57328 WP_003417980.1.57331 WP_003417980.1.57340 WP_003417980.1.57351 WP_003417980.1.57352 WP_003417980.1.57380 WP_003417980.1.57430 WP_003417980.1.5744 WP_003417980.1.57440 WP_003417980.1.5745 WP_003417980.1.57461 WP_003417980.1.57469 WP_003417980.1.57489 WP_003417980.1.575 WP_003417980.1.57509 WP_003417980.1.57519 WP_003417980.1.57525 WP_003417980.1.57551 WP_003417980.1.57596 WP_003417980.1.57604 WP_003417980.1.57616 WP_003417980.1.57617 WP_003417980.1.57619 WP_003417980.1.57627 WP_003417980.1.57642 WP_003417980.1.57658 WP_003417980.1.57667 WP_003417980.1.57675 WP_003417980.1.57689 WP_003417980.1.57708 WP_003417980.1.57794 WP_003417980.1.57821 WP_003417980.1.57825 WP_003417980.1.57843 WP_003417980.1.57906 WP_003417980.1.57924 WP_003417980.1.57926 WP_003417980.1.57930 WP_003417980.1.57957 WP_003417980.1.57960 WP_003417980.1.57964 WP_003417980.1.57991 WP_003417980.1.58000 WP_003417980.1.58086 WP_003417980.1.58101 WP_003417980.1.58103 WP_003417980.1.58108 WP_003417980.1.5811 WP_003417980.1.58121 WP_003417980.1.58145 WP_003417980.1.58164 WP_003417980.1.58174 WP_003417980.1.582 WP_003417980.1.58202 WP_003417980.1.58209 WP_003417980.1.58215 WP_003417980.1.5824 WP_003417980.1.58250 WP_003417980.1.58259 WP_003417980.1.58283 WP_003417980.1.5830 WP_003417980.1.58303 WP_003417980.1.58311 WP_003417980.1.58330 WP_003417980.1.58359 WP_003417980.1.58386 WP_003417980.1.58393 WP_003417980.1.58431 WP_003417980.1.5844 WP_003417980.1.58457 WP_003417980.1.58488 WP_003417980.1.58518 WP_003417980.1.58534 WP_003417980.1.58559 WP_003417980.1.58567 WP_003417980.1.58573 WP_003417980.1.58602 WP_003417980.1.58612 WP_003417980.1.58619 WP_003417980.1.58630 WP_003417980.1.5865 WP_003417980.1.58671 WP_003417980.1.58690 WP_003417980.1.58702 WP_003417980.1.58743 WP_003417980.1.58754 WP_003417980.1.5879 WP_003417980.1.5881 WP_003417980.1.58824 WP_003417980.1.58848 WP_003417980.1.58857 WP_003417980.1.58891 WP_003417980.1.58892 WP_003417980.1.5890 WP_003417980.1.58904 WP_003417980.1.58921 WP_003417980.1.58930 WP_003417980.1.58939 WP_003417980.1.58941 WP_003417980.1.58953 WP_003417980.1.58961 WP_003417980.1.5898 WP_003417980.1.59025 WP_003417980.1.59029 WP_003417980.1.59037 WP_003417980.1.59044 WP_003417980.1.59085 WP_003417980.1.59088 WP_003417980.1.59112 WP_003417980.1.59130 WP_003417980.1.5914 WP_003417980.1.59147 WP_003417980.1.59166 WP_003417980.1.59205 WP_003417980.1.59209 WP_003417980.1.59237 WP_003417980.1.59240 WP_003417980.1.59253 WP_003417980.1.59254 WP_003417980.1.59262 WP_003417980.1.59270 WP_003417980.1.5928 WP_003417980.1.59304 WP_003417980.1.59305 WP_003417980.1.59309 WP_003417980.1.59326 WP_003417980.1.59328 WP_003417980.1.59333 WP_003417980.1.59338 WP_003417980.1.59388 WP_003417980.1.59487 WP_003417980.1.59537 WP_003417980.1.59561 WP_003417980.1.59677 WP_003417980.1.59722 WP_003417980.1.59727 WP_003417980.1.59732 WP_003417980.1.59738 WP_003417980.1.59750 WP_003417980.1.59757 WP_003417980.1.59761 WP_003417980.1.59808 WP_003417980.1.59850 WP_003417980.1.59856 WP_003417980.1.59860 WP_003417980.1.59861 WP_003417980.1.5987 WP_003417980.1.59878 WP_003417980.1.59888 WP_003417980.1.59952 WP_003417980.1.5996 WP_003417980.1.59961 WP_003417980.1.59974 WP_003417980.1.6000 WP_003417980.1.60007 WP_003417980.1.60016 WP_003417980.1.6003 WP_003417980.1.60047 WP_003417980.1.6007 WP_003417980.1.60091 WP_003417980.1.60121 WP_003417980.1.60125 WP_003417980.1.60135 WP_003417980.1.60139 WP_003417980.1.60152 WP_003417980.1.60171 WP_003417980.1.60197 WP_003417980.1.6020 WP_003417980.1.60205 WP_003417980.1.60207 WP_003417980.1.60215 WP_003417980.1.60217 WP_003417980.1.60267 WP_003417980.1.60288 WP_003417980.1.60291 WP_003417980.1.60301 WP_003417980.1.60305 WP_003417980.1.60312 WP_003417980.1.60313 WP_003417980.1.60314 WP_003417980.1.60367 WP_003417980.1.60376 WP_003417980.1.60403 WP_003417980.1.60421 WP_003417980.1.60451 WP_003417980.1.60460 WP_003417980.1.60479 WP_003417980.1.60487 WP_003417980.1.60512 WP_003417980.1.60573 WP_003417980.1.60583 WP_003417980.1.60632 WP_003417980.1.60657 WP_003417980.1.60687 WP_003417980.1.60689 WP_003417980.1.60727 WP_003417980.1.60738 WP_003417980.1.60763 WP_003417980.1.6077 WP_003417980.1.60791 WP_003417980.1.60834 WP_003417980.1.60870 WP_003417980.1.60878 WP_003417980.1.60879 WP_003417980.1.60913 WP_003417980.1.60978 WP_003417980.1.61000 WP_003417980.1.61001 WP_003417980.1.61012 WP_003417980.1.61014 WP_003417980.1.61015 WP_003417980.1.61037 WP_003417980.1.61052 WP_003417980.1.61065 WP_003417980.1.61100 WP_003417980.1.61101 WP_003417980.1.61138 WP_003417980.1.61142 WP_003417980.1.61198 WP_003417980.1.612 WP_003417980.1.61234 WP_003417980.1.61256 WP_003417980.1.61281 WP_003417980.1.61314 WP_003417980.1.61321 WP_003417980.1.61326 WP_003417980.1.61328 WP_003417980.1.61368 WP_003417980.1.61391 WP_003417980.1.61406 WP_003417980.1.61409 WP_003417980.1.61420 WP_003417980.1.61422 WP_003417980.1.61425 WP_003417980.1.61428 WP_003417980.1.61469 WP_003417980.1.61494 WP_003417980.1.61522 WP_003417980.1.61552 WP_003417980.1.61557 WP_003417980.1.61567 WP_003417980.1.61571 WP_003417980.1.61573 WP_003417980.1.61584 WP_003417980.1.61586 WP_003417980.1.6159 WP_003417980.1.61592 WP_003417980.1.6160 WP_003417980.1.61614 WP_003417980.1.6163 WP_003417980.1.61655 WP_003417980.1.61665 WP_003417980.1.61669 WP_003417980.1.61682 WP_003417980.1.61692 WP_003417980.1.61719 WP_003417980.1.61728 WP_003417980.1.61750 WP_003417980.1.61754 WP_003417980.1.61755 WP_003417980.1.61757 WP_003417980.1.61778 WP_003417980.1.6179 WP_003417980.1.61793 WP_003417980.1.61816 WP_003417980.1.61842 WP_003417980.1.61850 WP_003417980.1.61862 WP_003417980.1.61865 WP_003417980.1.61868 WP_003417980.1.61911 WP_003417980.1.61925 WP_003417980.1.61941 WP_003417980.1.61953 WP_003417980.1.61986 WP_003417980.1.61987 WP_003417980.1.61998 WP_003417980.1.62021 WP_003417980.1.62087 WP_003417980.1.62089 WP_003417980.1.62101 WP_003417980.1.62104 WP_003417980.1.6211 WP_003417980.1.62132 WP_003417980.1.62162 WP_003417980.1.62225 WP_003417980.1.62230 WP_003417980.1.62238 WP_003417980.1.62249 WP_003417980.1.62270 WP_003417980.1.62281 WP_003417980.1.62307 WP_003417980.1.6231 WP_003417980.1.62359 WP_003417980.1.62360 WP_003417980.1.62371 WP_003417980.1.62379 WP_003417980.1.62395 WP_003417980.1.62408 WP_003417980.1.62449 WP_003417980.1.62468 WP_003417980.1.6248 WP_003417980.1.62508 WP_003417980.1.62565 WP_003417980.1.62594 WP_003417980.1.62606 WP_003417980.1.62616 WP_003417980.1.62666 WP_003417980.1.62687 WP_003417980.1.62715 WP_003417980.1.62730 WP_003417980.1.62738 WP_003417980.1.62761 WP_003417980.1.62766 WP_003417980.1.62786 WP_003417980.1.62813 WP_003417980.1.62839 WP_003417980.1.62841 WP_003417980.1.62909 WP_003417980.1.62936 WP_003417980.1.6294 WP_003417980.1.6295 WP_003417980.1.62962 WP_003417980.1.63007 WP_003417980.1.63019 WP_003417980.1.63032 WP_003417980.1.63037 WP_003417980.1.63064 WP_003417980.1.63066 WP_003417980.1.63072 WP_003417980.1.6308 WP_003417980.1.63081 WP_003417980.1.63096 WP_003417980.1.63106 WP_003417980.1.6314 WP_003417980.1.63144 WP_003417980.1.63154 WP_003417980.1.63160 WP_003417980.1.63161 WP_003417980.1.63175 WP_003417980.1.63194 WP_003417980.1.6322 WP_003417980.1.63222 WP_003417980.1.6328 WP_003417980.1.63291 WP_003417980.1.63312 WP_003417980.1.63317 WP_003417980.1.63331 WP_003417980.1.63373 WP_003417980.1.63384 WP_003417980.1.63403 WP_003417980.1.63424 WP_003417980.1.63428 WP_003417980.1.6345 WP_003417980.1.63464 WP_003417980.1.63483 WP_003417980.1.63502 WP_003417980.1.63504 WP_003417980.1.63522 WP_003417980.1.63530 WP_003417980.1.63538 WP_003417980.1.63564 WP_003417980.1.63567 WP_003417980.1.63596 WP_003417980.1.63600 WP_003417980.1.63623 WP_003417980.1.63624 WP_003417980.1.63625 WP_003417980.1.63627 WP_003417980.1.63654 WP_003417980.1.63662 WP_003417980.1.63711 WP_003417980.1.63734 WP_003417980.1.63807 WP_003417980.1.63819 WP_003417980.1.63844 WP_003417980.1.63888 WP_003417980.1.63913 WP_003417980.1.63915 WP_003417980.1.63918 WP_003417980.1.63961 WP_003417980.1.63970 WP_003417980.1.64000 WP_003417980.1.64027 WP_003417980.1.64058 WP_003417980.1.64065 WP_003417980.1.6407 WP_003417980.1.64082 WP_003417980.1.64091 WP_003417980.1.64102 WP_003417980.1.64104 WP_003417980.1.64119 WP_003417980.1.64169 WP_003417980.1.64219 WP_003417980.1.6422 WP_003417980.1.64222 WP_003417980.1.64228 WP_003417980.1.64235 WP_003417980.1.64249 WP_003417980.1.6427 WP_003417980.1.64278 WP_003417980.1.64287 WP_003417980.1.64414 WP_003417980.1.64419 WP_003417980.1.6443 WP_003417980.1.64463 WP_003417980.1.64480 WP_003417980.1.64497 WP_003417980.1.64506 WP_003417980.1.64511 WP_003417980.1.64513 WP_003417980.1.64514 WP_003417980.1.64522 WP_003417980.1.64526 WP_003417980.1.64543 WP_003417980.1.6456 WP_003417980.1.64567 WP_003417980.1.64588 WP_003417980.1.64594 WP_003417980.1.64595 WP_003417980.1.64608 WP_003417980.1.64619 WP_003417980.1.64629 WP_003417980.1.6464 WP_003417980.1.64664 WP_003417980.1.64669 WP_003417980.1.64672 WP_003417980.1.64680 WP_003417980.1.64682 WP_003417980.1.64727 WP_003417980.1.64729 WP_003417980.1.64774 WP_003417980.1.64776 WP_003417980.1.64802 WP_003417980.1.64832 WP_003417980.1.6486 WP_003417980.1.64870 WP_003417980.1.64898 WP_003417980.1.64922 WP_003417980.1.64924 WP_003417980.1.6493 WP_003417980.1.64937 WP_003417980.1.64941 WP_003417980.1.64966 WP_003417980.1.64973 WP_003417980.1.65001 WP_003417980.1.65026 WP_003417980.1.65053 WP_003417980.1.65070 WP_003417980.1.65079 WP_003417980.1.65102 WP_003417980.1.65157 WP_003417980.1.65181 WP_003417980.1.65212 WP_003417980.1.65229 WP_003417980.1.6523 WP_003417980.1.65253 WP_003417980.1.65289 WP_003417980.1.65291 WP_003417980.1.65315 WP_003417980.1.65329 WP_003417980.1.65359 WP_003417980.1.6536 WP_003417980.1.65374 WP_003417980.1.65386 WP_003417980.1.65414 WP_003417980.1.65416 WP_003417980.1.65433 WP_003417980.1.65455 WP_003417980.1.65467 WP_003417980.1.65488 WP_003417980.1.65529 WP_003417980.1.65539 WP_003417980.1.65583 WP_003417980.1.65612 WP_003417980.1.65623 WP_003417980.1.65635 WP_003417980.1.65637 WP_003417980.1.65648 WP_003417980.1.65683 WP_003417980.1.65686 WP_003417980.1.65688 WP_003417980.1.65707 WP_003417980.1.65733 WP_003417980.1.65746 WP_003417980.1.65747 WP_003417980.1.65759 WP_003417980.1.65816 WP_003417980.1.65830 WP_003417980.1.65858 WP_003417980.1.65862 WP_003417980.1.65869 WP_003417980.1.65893 WP_003417980.1.65929 WP_003417980.1.65932 WP_003417980.1.65958 WP_003417980.1.65974 WP_003417980.1.66004 WP_003417980.1.66013 WP_003417980.1.6606 WP_003417980.1.66089 WP_003417980.1.66149 WP_003417980.1.66151 WP_003417980.1.66229 WP_003417980.1.66276 WP_003417980.1.66293 WP_003417980.1.66297 WP_003417980.1.66323 WP_003417980.1.66325 WP_003417980.1.6633 WP_003417980.1.66334 WP_003417980.1.66355 WP_003417980.1.66367 WP_003417980.1.66394 WP_003417980.1.66396 WP_003417980.1.66451 WP_003417980.1.66455 WP_003417980.1.66457 WP_003417980.1.66460 WP_003417980.1.66464 WP_003417980.1.66466 WP_003417980.1.66487 WP_003417980.1.66504 WP_003417980.1.66544 WP_003417980.1.66580 WP_003417980.1.66582 WP_003417980.1.66612 WP_003417980.1.66615 WP_003417980.1.66617 WP_003417980.1.66635 WP_003417980.1.66656 WP_003417980.1.66663 WP_003417980.1.66675 WP_003417980.1.66715 WP_003417980.1.66718 WP_003417980.1.66762 WP_003417980.1.66776 WP_003417980.1.66808 WP_003417980.1.66817 WP_003417980.1.66819 WP_003417980.1.66826 WP_003417980.1.66830 WP_003417980.1.66842 WP_003417980.1.66868 WP_003417980.1.66878 WP_003417980.1.66880 WP_003417980.1.66893 WP_003417980.1.66961 WP_003417980.1.67005 WP_003417980.1.6704 WP_003417980.1.67044 WP_003417980.1.67061 WP_003417980.1.67089 WP_003417980.1.67098 WP_003417980.1.67146 WP_003417980.1.67170 WP_003417980.1.67197 WP_003417980.1.67198 WP_003417980.1.6720 WP_003417980.1.67207 WP_003417980.1.67218 WP_003417980.1.67220 WP_003417980.1.67225 WP_003417980.1.67231 WP_003417980.1.6724 WP_003417980.1.67257 WP_003417980.1.67298 WP_003417980.1.67307 WP_003417980.1.67324 WP_003417980.1.67332 WP_003417980.1.67346 WP_003417980.1.67354 WP_003417980.1.67360 WP_003417980.1.67381 WP_003417980.1.67396 WP_003417980.1.67417 WP_003417980.1.67422 WP_003417980.1.67453 WP_003417980.1.67459 WP_003417980.1.6746 WP_003417980.1.67473 WP_003417980.1.67481 WP_003417980.1.67482 WP_003417980.1.67496 WP_003417980.1.67499 WP_003417980.1.67516 WP_003417980.1.67523 WP_003417980.1.67536 WP_003417980.1.67575 WP_003417980.1.67587 WP_003417980.1.67598 WP_003417980.1.67600 WP_003417980.1.67602 WP_003417980.1.67630 WP_003417980.1.67679 WP_003417980.1.67692 WP_003417980.1.67744 WP_003417980.1.6775 WP_003417980.1.67750 WP_003417980.1.6777 WP_003417980.1.67809 WP_003417980.1.67816 WP_003417980.1.67844 WP_003417980.1.67848 WP_003417980.1.67870 WP_003417980.1.67888 WP_003417980.1.67915 WP_003417980.1.67945 WP_003417980.1.67949 WP_003417980.1.67980 WP_003417980.1.67982 WP_003417980.1.68022 WP_003417980.1.68029 WP_003417980.1.68037 WP_003417980.1.68038 WP_003417980.1.68045 WP_003417980.1.68057 WP_003417980.1.68083 WP_003417980.1.68088 WP_003417980.1.68106 WP_003417980.1.68110 WP_003417980.1.68153 WP_003417980.1.68169 WP_003417980.1.68193 WP_003417980.1.68212 WP_003417980.1.68227 WP_003417980.1.68243 WP_003417980.1.68297 WP_003417980.1.68309 WP_003417980.1.68325 WP_003417980.1.68329 WP_003417980.1.68340 WP_003417980.1.68384 WP_003417980.1.68388 WP_003417980.1.68429 WP_003417980.1.6843 WP_003417980.1.68433 WP_003417980.1.68444 WP_003417980.1.68465 WP_003417980.1.68484 WP_003417980.1.68518 WP_003417980.1.68569 WP_003417980.1.68576 WP_003417980.1.68580 WP_003417980.1.68586 WP_003417980.1.68623 WP_003417980.1.68637 WP_003417980.1.68646 WP_003417980.1.68667 WP_003417980.1.68669 WP_003417980.1.68672 WP_003417980.1.68684 WP_003417980.1.68704 WP_003417980.1.68708 WP_003417980.1.6872 WP_003417980.1.68730 WP_003417980.1.68734 WP_003417980.1.68748 WP_003417980.1.68754 WP_003417980.1.6876 WP_003417980.1.68763 WP_003417980.1.68766 WP_003417980.1.68774 WP_003417980.1.68796 WP_003417980.1.68824 WP_003417980.1.68832 WP_003417980.1.68833 WP_003417980.1.68841 WP_003417980.1.68859 WP_003417980.1.68876 WP_003417980.1.68906 WP_003417980.1.68916 WP_003417980.1.68923 WP_003417980.1.68945 WP_003417980.1.6896 WP_003417980.1.68981 WP_003417980.1.68984 WP_003417980.1.68997 WP_003417980.1.69008 WP_003417980.1.69076 WP_003417980.1.69079 WP_003417980.1.6908 WP_003417980.1.69082 WP_003417980.1.69181 WP_003417980.1.69208 WP_003417980.1.69231 WP_003417980.1.69256 WP_003417980.1.69311 WP_003417980.1.69315 WP_003417980.1.69322 WP_003417980.1.69342 WP_003417980.1.6935 WP_003417980.1.6936 WP_003417980.1.69369 WP_003417980.1.69374 WP_003417980.1.69398 WP_003417980.1.69401 WP_003417980.1.69426 WP_003417980.1.69427 WP_003417980.1.69429 WP_003417980.1.6949 WP_003417980.1.6951 WP_003417980.1.69511 WP_003417980.1.69526 WP_003417980.1.69528 WP_003417980.1.69547 WP_003417980.1.69573 WP_003417980.1.69581 WP_003417980.1.6960 WP_003417980.1.69617 WP_003417980.1.69634 WP_003417980.1.69647 WP_003417980.1.69659 WP_003417980.1.69673 WP_003417980.1.69682 WP_003417980.1.69684 WP_003417980.1.69686 WP_003417980.1.69707 WP_003417980.1.69709 WP_003417980.1.69723 WP_003417980.1.69736 WP_003417980.1.69778 WP_003417980.1.69800 WP_003417980.1.69802 WP_003417980.1.69845 WP_003417980.1.69870 WP_003417980.1.69873 WP_003417980.1.69898 WP_003417980.1.69913 WP_003417980.1.69931 WP_003417980.1.69938 WP_003417980.1.69955 WP_003417980.1.69957 WP_003417980.1.69981 WP_003417980.1.69990 WP_003417980.1.70 WP_003417980.1.70000 WP_003417980.1.70017 WP_003417980.1.70032 WP_003417980.1.70055 WP_003417980.1.70062 WP_003417980.1.70072 WP_003417980.1.70131 WP_003417980.1.70132 WP_003417980.1.7022 WP_003417980.1.70227 WP_003417980.1.70255 WP_003417980.1.70271 WP_003417980.1.70274 WP_003417980.1.7029 WP_003417980.1.70325 WP_003417980.1.70328 WP_003417980.1.70356 WP_003417980.1.70364 WP_003417980.1.70368 WP_003417980.1.70369 WP_003417980.1.70418 WP_003417980.1.70422 WP_003417980.1.70435 WP_003417980.1.70444 WP_003417980.1.70463 WP_003417980.1.70471 WP_003417980.1.70480 WP_003417980.1.70494 WP_003417980.1.70498 WP_003417980.1.70505 WP_003417980.1.70525 WP_003417980.1.70573 WP_003417980.1.70577 WP_003417980.1.70610 WP_003417980.1.70615 WP_003417980.1.70618 WP_003417980.1.70622 WP_003417980.1.70668 WP_003417980.1.70699 WP_003417980.1.70704 WP_003417980.1.70729 WP_003417980.1.70757 WP_003417980.1.70782 WP_003417980.1.70796 WP_003417980.1.70830 WP_003417980.1.70834 WP_003417980.1.7084 WP_003417980.1.70840 WP_003417980.1.70864 WP_003417980.1.70871 WP_003417980.1.70915 WP_003417980.1.70958 WP_003417980.1.70964 WP_003417980.1.70976 WP_003417980.1.71015 WP_003417980.1.71026 WP_003417980.1.71063 WP_003417980.1.71076 WP_003417980.1.71083 WP_003417980.1.7111 WP_003417980.1.71118 WP_003417980.1.71128 WP_003417980.1.7113 WP_003417980.1.71187 WP_003417980.1.71191 WP_003417980.1.71255 WP_003417980.1.71258 WP_003417980.1.71259 WP_003417980.1.71289 WP_003417980.1.71326 WP_003417980.1.71329 WP_003417980.1.71331 WP_003417980.1.71344 WP_003417980.1.71390 WP_003417980.1.71399 WP_003417980.1.71414 WP_003417980.1.71440 WP_003417980.1.71457 WP_003417980.1.7146 WP_003417980.1.71464 WP_003417980.1.71490 WP_003417980.1.71492 WP_003417980.1.71509 WP_003417980.1.71516 WP_003417980.1.71517 WP_003417980.1.71527 WP_003417980.1.71532 WP_003417980.1.71545 WP_003417980.1.71546 WP_003417980.1.71569 WP_003417980.1.71604 WP_003417980.1.71621 WP_003417980.1.71630 WP_003417980.1.71638 WP_003417980.1.71654 WP_003417980.1.71664 WP_003417980.1.71665 WP_003417980.1.71683 WP_003417980.1.71701 WP_003417980.1.71718 WP_003417980.1.71731 WP_003417980.1.71778 WP_003417980.1.71781 WP_003417980.1.71803 WP_003417980.1.71820 WP_003417980.1.71847 WP_003417980.1.7185 WP_003417980.1.71851 WP_003417980.1.71871 WP_003417980.1.71909 WP_003417980.1.71957 WP_003417980.1.71970 WP_003417980.1.72047 WP_003417980.1.72061 WP_003417980.1.72062 WP_003417980.1.72072 WP_003417980.1.72111 WP_003417980.1.72122 WP_003417980.1.72128 WP_003417980.1.72143 WP_003417980.1.7216 WP_003417980.1.72168 WP_003417980.1.72179 WP_003417980.1.72209 WP_003417980.1.72218 WP_003417980.1.72219 WP_003417980.1.72227 WP_003417980.1.7224 WP_003417980.1.72268 WP_003417980.1.72332 WP_003417980.1.72380 WP_003417980.1.72401 WP_003417980.1.72405 WP_003417980.1.72420 WP_003417980.1.72441 WP_003417980.1.72451 WP_003417980.1.72452 WP_003417980.1.72457 WP_003417980.1.72459 WP_003417980.1.72460 WP_003417980.1.72466 WP_003417980.1.72487 WP_003417980.1.72488 WP_003417980.1.72492 WP_003417980.1.72506 WP_003417980.1.72543 WP_003417980.1.7256 WP_003417980.1.72576 WP_003417980.1.72578 WP_003417980.1.72585 WP_003417980.1.72591 WP_003417980.1.72592 WP_003417980.1.72640 WP_003417980.1.72661 WP_003417980.1.72684 WP_003417980.1.72739 WP_003417980.1.72744 WP_003417980.1.72755 WP_003417980.1.72759 WP_003417980.1.72784 WP_003417980.1.72792 WP_003417980.1.72826 WP_003417980.1.72831 WP_003417980.1.72852 WP_003417980.1.72853 WP_003417980.1.72879 WP_003417980.1.72880 WP_003417980.1.72938 WP_003417980.1.72954 WP_003417980.1.72957 WP_003417980.1.72959 WP_003417980.1.7298 WP_003417980.1.72982 WP_003417980.1.72988 WP_003417980.1.72993 WP_003417980.1.73006 WP_003417980.1.73013 WP_003417980.1.73025 WP_003417980.1.73028 WP_003417980.1.73042 WP_003417980.1.73045 WP_003417980.1.73092 WP_003417980.1.73118 WP_003417980.1.7312 WP_003417980.1.73127 WP_003417980.1.73134 WP_003417980.1.73150 WP_003417980.1.73154 WP_003417980.1.73163 WP_003417980.1.73182 WP_003417980.1.73205 WP_003417980.1.7321 WP_003417980.1.73310 WP_003417980.1.73365 WP_003417980.1.73391 WP_003417980.1.73404 WP_003417980.1.73424 WP_003417980.1.73436 WP_003417980.1.73445 WP_003417980.1.73453 WP_003417980.1.73465 WP_003417980.1.73466 WP_003417980.1.73470 WP_003417980.1.73471 WP_003417980.1.73478 WP_003417980.1.73482 WP_003417980.1.73507 WP_003417980.1.73532 WP_003417980.1.73550 WP_003417980.1.73564 WP_003417980.1.73623 WP_003417980.1.73629 WP_003417980.1.73644 WP_003417980.1.7366 WP_003417980.1.73661 WP_003417980.1.7368 WP_003417980.1.73688 WP_003417980.1.73723 WP_003417980.1.73744 WP_003417980.1.73750 WP_003417980.1.73760 WP_003417980.1.73774 WP_003417980.1.7379 WP_003417980.1.73813 WP_003417980.1.73840 WP_003417980.1.73876 WP_003417980.1.7389 WP_003417980.1.74016 WP_003417980.1.74039 WP_003417980.1.74083 WP_003417980.1.74101 WP_003417980.1.74107 WP_003417980.1.74120 WP_003417980.1.74129 WP_003417980.1.74144 WP_003417980.1.7417 WP_003417980.1.74190 WP_003417980.1.74210 WP_003417980.1.7423 WP_003417980.1.74259 WP_003417980.1.74262 WP_003417980.1.74269 WP_003417980.1.74282 WP_003417980.1.74291 WP_003417980.1.74296 WP_003417980.1.74304 WP_003417980.1.7432 WP_003417980.1.74347 WP_003417980.1.7436 WP_003417980.1.74378 WP_003417980.1.74382 WP_003417980.1.74395 WP_003417980.1.74400 WP_003417980.1.74401 WP_003417980.1.74432 WP_003417980.1.74442 WP_003417980.1.74477 WP_003417980.1.74487 WP_003417980.1.74499 WP_003417980.1.74504 WP_003417980.1.74511 WP_003417980.1.74523 WP_003417980.1.74525 WP_003417980.1.74551 WP_003417980.1.74555 WP_003417980.1.74628 WP_003417980.1.74641 WP_003417980.1.74653 WP_003417980.1.74660 WP_003417980.1.74683 WP_003417980.1.7469 WP_003417980.1.74725 WP_003417980.1.74760 WP_003417980.1.74786 WP_003417980.1.74809 WP_003417980.1.74820 WP_003417980.1.74870 WP_003417980.1.74881 WP_003417980.1.74888 WP_003417980.1.74952 WP_003417980.1.7496 WP_003417980.1.74988 WP_003417980.1.75043 WP_003417980.1.75045 WP_003417980.1.75055 WP_003417980.1.75078 WP_003417980.1.75081 WP_003417980.1.75120 WP_003417980.1.75163 WP_003417980.1.75200 WP_003417980.1.75202 WP_003417980.1.75234 WP_003417980.1.75239 WP_003417980.1.75250 WP_003417980.1.75263 WP_003417980.1.75281 WP_003417980.1.75342 WP_003417980.1.7535 WP_003417980.1.75376 WP_003417980.1.75391 WP_003417980.1.75395 WP_003417980.1.75441 WP_003417980.1.75510 WP_003417980.1.75581 WP_003417980.1.75598 WP_003417980.1.75635 WP_003417980.1.75665 WP_003417980.1.75671 WP_003417980.1.75741 WP_003417980.1.75749 WP_003417980.1.75772 WP_003417980.1.75774 WP_003417980.1.75811 WP_003417980.1.75833 WP_003417980.1.7585 WP_003417980.1.75864 WP_003417980.1.75868 WP_003417980.1.75878 WP_003417980.1.75927 WP_003417980.1.75946 WP_003417980.1.75968 WP_003417980.1.75974 WP_003417980.1.76016 WP_003417980.1.76032 WP_003417980.1.76037 WP_003417980.1.7604 WP_003417980.1.76045 WP_003417980.1.76052 WP_003417980.1.76058 WP_003417980.1.76064 WP_003417980.1.76110 WP_003417980.1.76126 WP_003417980.1.76133 WP_003417980.1.76138 WP_003417980.1.76157 WP_003417980.1.76172 WP_003417980.1.76177 WP_003417980.1.76183 WP_003417980.1.76209 WP_003417980.1.76239 WP_003417980.1.76272 WP_003417980.1.76277 WP_003417980.1.76281 WP_003417980.1.76291 WP_003417980.1.76360 WP_003417980.1.76379 WP_003417980.1.76403 WP_003417980.1.76413 WP_003417980.1.76414 WP_003417980.1.76427 WP_003417980.1.76436 WP_003417980.1.76442 WP_003417980.1.76443 WP_003417980.1.76456 WP_003417980.1.76533 WP_003417980.1.76616 WP_003417980.1.76625 WP_003417980.1.76629 WP_003417980.1.76635 WP_003417980.1.76638 WP_003417980.1.76640 WP_003417980.1.76644 WP_003417980.1.76677 WP_003417980.1.76678 WP_003417980.1.76679 WP_003417980.1.76734 WP_003417980.1.76744 WP_003417980.1.76750 WP_003417980.1.76754 WP_003417980.1.76757 WP_003417980.1.76781 WP_003417980.1.76818 WP_003417980.1.76824 WP_003417980.1.76835 WP_003417980.1.76873 WP_003417980.1.76888 WP_003417980.1.76900 WP_003417980.1.7691 WP_003417980.1.76947 WP_003417980.1.76954 WP_003417980.1.76955 WP_003417980.1.76963 WP_003417980.1.76976 WP_003417980.1.770 WP_003417980.1.77000 WP_003417980.1.77008 WP_003417980.1.77021 WP_003417980.1.77056 WP_003417980.1.77065 WP_003417980.1.77075 WP_003417980.1.77093 WP_003417980.1.77107 WP_003417980.1.77115 WP_003417980.1.77118 WP_003417980.1.77125 WP_003417980.1.77141 WP_003417980.1.77142 WP_003417980.1.77166 WP_003417980.1.77250 WP_003417980.1.77260 WP_003417980.1.77266 WP_003417980.1.77280 WP_003417980.1.77285 WP_003417980.1.77312 WP_003417980.1.77348 WP_003417980.1.77351 WP_003417980.1.77352 WP_003417980.1.77361 WP_003417980.1.774 WP_003417980.1.7740 WP_003417980.1.77404 WP_003417980.1.77425 WP_003417980.1.77463 WP_003417980.1.77474 WP_003417980.1.7748 WP_003417980.1.77484 WP_003417980.1.77491 WP_003417980.1.77499 WP_003417980.1.77510 WP_003417980.1.77530 WP_003417980.1.77554 WP_003417980.1.77559 WP_003417980.1.77605 WP_003417980.1.7762 WP_003417980.1.77627 WP_003417980.1.77649 WP_003417980.1.77654 WP_003417980.1.7766 WP_003417980.1.77667 WP_003417980.1.77704 WP_003417980.1.77706 WP_003417980.1.77774 WP_003417980.1.7778 WP_003417980.1.77790 WP_003417980.1.77809 WP_003417980.1.77820 WP_003417980.1.77843 WP_003417980.1.77855 WP_003417980.1.77865 WP_003417980.1.77868 WP_003417980.1.77879 WP_003417980.1.77890 WP_003417980.1.77909 WP_003417980.1.77911 WP_003417980.1.77931 WP_003417980.1.77984 WP_003417980.1.78020 WP_003417980.1.78024 WP_003417980.1.78075 WP_003417980.1.78086 WP_003417980.1.7809 WP_003417980.1.78098 WP_003417980.1.78105 WP_003417980.1.78113 WP_003417980.1.78136 WP_003417980.1.78162 WP_003417980.1.7817 WP_003417980.1.78200 WP_003417980.1.78216 WP_003417980.1.78238 WP_003417980.1.78322 WP_003417980.1.78338 WP_003417980.1.7836 WP_003417980.1.78360 WP_003417980.1.78386 WP_003417980.1.78429 WP_003417980.1.78435 WP_003417980.1.7844 WP_003417980.1.78459 WP_003417980.1.78488 WP_003417980.1.7849 WP_003417980.1.78499 WP_003417980.1.785 WP_003417980.1.78516 WP_003417980.1.78524 WP_003417980.1.78526 WP_003417980.1.78538 WP_003417980.1.78544 WP_003417980.1.78545 WP_003417980.1.78547 WP_003417980.1.78574 WP_003417980.1.78580 WP_003417980.1.7860 WP_003417980.1.78620 WP_003417980.1.78646 WP_003417980.1.78648 WP_003417980.1.78649 WP_003417980.1.78655 WP_003417980.1.78657 WP_003417980.1.78659 WP_003417980.1.7869 WP_003417980.1.78692 WP_003417980.1.78760 WP_003417980.1.78766 WP_003417980.1.78776 WP_003417980.1.78778 WP_003417980.1.78784 WP_003417980.1.78788 WP_003417980.1.78790 WP_003417980.1.78793 WP_003417980.1.78848 WP_003417980.1.78860 WP_003417980.1.7887 WP_003417980.1.78884 WP_003417980.1.78932 WP_003417980.1.78969 WP_003417980.1.78977 WP_003417980.1.78980 WP_003417980.1.79005 WP_003417980.1.79016 WP_003417980.1.79033 WP_003417980.1.79064 WP_003417980.1.79066 WP_003417980.1.79068 WP_003417980.1.79095 WP_003417980.1.79112 WP_003417980.1.79122 WP_003417980.1.79145 WP_003417980.1.79152 WP_003417980.1.79163 WP_003417980.1.79198 WP_003417980.1.79213 WP_003417980.1.79218 WP_003417980.1.79268 WP_003417980.1.79273 WP_003417980.1.79278 WP_003417980.1.79290 WP_003417980.1.79319 WP_003417980.1.79325 WP_003417980.1.79326 WP_003417980.1.7933 WP_003417980.1.79330 WP_003417980.1.79339 WP_003417980.1.79399 WP_003417980.1.79413 WP_003417980.1.79422 WP_003417980.1.79445 WP_003417980.1.79447 WP_003417980.1.79455 WP_003417980.1.79471 WP_003417980.1.79480 WP_003417980.1.79482 WP_003417980.1.79488 WP_003417980.1.79500 WP_003417980.1.79502 WP_003417980.1.79508 WP_003417980.1.79514 WP_003417980.1.79561 WP_003417980.1.79565 WP_003417980.1.79578 WP_003417980.1.79588 WP_003417980.1.79598 WP_003417980.1.79615 WP_003417980.1.79684 WP_003417980.1.79698 WP_003417980.1.797 WP_003417980.1.79744 WP_003417980.1.79784 WP_003417980.1.79802 WP_003417980.1.79806 WP_003417980.1.79819 WP_003417980.1.79826 WP_003417980.1.79828 WP_003417980.1.79851 WP_003417980.1.79853 WP_003417980.1.79863 WP_003417980.1.79881 WP_003417980.1.79885 WP_003417980.1.79898 WP_003417980.1.7990 WP_003417980.1.79900 WP_003417980.1.79913 WP_003417980.1.79918 WP_003417980.1.79947 WP_003417980.1.79948 WP_003417980.1.7995 WP_003417980.1.7997 WP_003417980.1.80004 WP_003417980.1.80015 WP_003417980.1.80022 WP_003417980.1.80030 WP_003417980.1.80054 WP_003417980.1.80084 WP_003417980.1.80099 WP_003417980.1.80129 WP_003417980.1.80177 WP_003417980.1.80234 WP_003417980.1.8026 WP_003417980.1.80275 WP_003417980.1.8029 WP_003417980.1.80299 WP_003417980.1.80300 WP_003417980.1.80304 WP_003417980.1.80326 WP_003417980.1.80351 WP_003417980.1.8037 WP_003417980.1.80370 WP_003417980.1.80387 WP_003417980.1.80399 WP_003417980.1.8044 WP_003417980.1.80451 WP_003417980.1.80458 WP_003417980.1.80461 WP_003417980.1.80490 WP_003417980.1.80503 WP_003417980.1.80507 WP_003417980.1.80552 WP_003417980.1.80576 WP_003417980.1.80599 WP_003417980.1.8060 WP_003417980.1.80624 WP_003417980.1.80636 WP_003417980.1.80673 WP_003417980.1.80711 WP_003417980.1.80714 WP_003417980.1.80743 WP_003417980.1.80784 WP_003417980.1.80815 WP_003417980.1.80853 WP_003417980.1.80918 WP_003417980.1.8093 WP_003417980.1.80967 WP_003417980.1.8097 WP_003417980.1.80988 WP_003417980.1.81007 WP_003417980.1.81013 WP_003417980.1.8105 WP_003417980.1.81059 WP_003417980.1.81063 WP_003417980.1.81066 WP_003417980.1.81075 WP_003417980.1.81091 WP_003417980.1.81119 WP_003417980.1.81125 WP_003417980.1.81136 WP_003417980.1.8114 WP_003417980.1.81189 WP_003417980.1.81192 WP_003417980.1.812 WP_003417980.1.81230 WP_003417980.1.81249 WP_003417980.1.81250 WP_003417980.1.81264 WP_003417980.1.8128 WP_003417980.1.81287 WP_003417980.1.81297 WP_003417980.1.8138 WP_003417980.1.81407 WP_003417980.1.8143 WP_003417980.1.81439 WP_003417980.1.81465 WP_003417980.1.81529 WP_003417980.1.81538 WP_003417980.1.81541 WP_003417980.1.81560 WP_003417980.1.81561 WP_003417980.1.81567 WP_003417980.1.81583 WP_003417980.1.81686 WP_003417980.1.81712 WP_003417980.1.81720 WP_003417980.1.81731 WP_003417980.1.81774 WP_003417980.1.81788 WP_003417980.1.81809 WP_003417980.1.81820 WP_003417980.1.81850 WP_003417980.1.81883 WP_003417980.1.81891 WP_003417980.1.81911 WP_003417980.1.81918 WP_003417980.1.82011 WP_003417980.1.82048 WP_003417980.1.82069 WP_003417980.1.82071 WP_003417980.1.82108 WP_003417980.1.82136 WP_003417980.1.82142 WP_003417980.1.8215 WP_003417980.1.82158 WP_003417980.1.8217 WP_003417980.1.82209 WP_003417980.1.82210 WP_003417980.1.82228 WP_003417980.1.82236 WP_003417980.1.82251 WP_003417980.1.82271 WP_003417980.1.82305 WP_003417980.1.82307 WP_003417980.1.82309 WP_003417980.1.82317 WP_003417980.1.8232 WP_003417980.1.82346 WP_003417980.1.82374 WP_003417980.1.82385 WP_003417980.1.82429 WP_003417980.1.82460 WP_003417980.1.82462 WP_003417980.1.82483 WP_003417980.1.82531 WP_003417980.1.82546 WP_003417980.1.82547 WP_003417980.1.82549 WP_003417980.1.82577 WP_003417980.1.82592 WP_003417980.1.82597 WP_003417980.1.82598 WP_003417980.1.82625 WP_003417980.1.82642 WP_003417980.1.82651 WP_003417980.1.82653 WP_003417980.1.82681 WP_003417980.1.82685 WP_003417980.1.8271 WP_003417980.1.82712 WP_003417980.1.82743 WP_003417980.1.82757 WP_003417980.1.82774 WP_003417980.1.82803 WP_003417980.1.82836 WP_003417980.1.82860 WP_003417980.1.82871 WP_003417980.1.82892 WP_003417980.1.82935 WP_003417980.1.82957 WP_003417980.1.82981 WP_003417980.1.82983 WP_003417980.1.83004 WP_003417980.1.83009 WP_003417980.1.83044 WP_003417980.1.83065 WP_003417980.1.83074 WP_003417980.1.83146 WP_003417980.1.83149 WP_003417980.1.83159 WP_003417980.1.8317 WP_003417980.1.83173 WP_003417980.1.83181 WP_003417980.1.83182 WP_003417980.1.83191 WP_003417980.1.83197 WP_003417980.1.83212 WP_003417980.1.8326 WP_003417980.1.83262 WP_003417980.1.83268 WP_003417980.1.83273 WP_003417980.1.83309 WP_003417980.1.83332 WP_003417980.1.83334 WP_003417980.1.83341 WP_003417980.1.83349 WP_003417980.1.8335 WP_003417980.1.83353 WP_003417980.1.83367 WP_003417980.1.83380 WP_003417980.1.83381 WP_003417980.1.83389 WP_003417980.1.83408 WP_003417980.1.83409 WP_003417980.1.83435 WP_003417980.1.83470 WP_003417980.1.83524 WP_003417980.1.83526 WP_003417980.1.8358 WP_003417980.1.83589 WP_003417980.1.83601 WP_003417980.1.83611 WP_003417980.1.83648 WP_003417980.1.83656 WP_003417980.1.83667 WP_003417980.1.83689 WP_003417980.1.83704 WP_003417980.1.83705 WP_003417980.1.83766 WP_003417980.1.83793 WP_003417980.1.83794 WP_003417980.1.83802 WP_003417980.1.83805 WP_003417980.1.83839 WP_003417980.1.83842 WP_003417980.1.83850 WP_003417980.1.83861 WP_003417980.1.83884 WP_003417980.1.83920 WP_003417980.1.83929 WP_003417980.1.83930 WP_003417980.1.83975 WP_003417980.1.83991 WP_003417980.1.8400 WP_003417980.1.84027 WP_003417980.1.8404 WP_003417980.1.84057 WP_003417980.1.84070 WP_003417980.1.8409 WP_003417980.1.84112 WP_003417980.1.84146 WP_003417980.1.8415 WP_003417980.1.84176 WP_003417980.1.84186 WP_003417980.1.84192 WP_003417980.1.84228 WP_003417980.1.8424 WP_003417980.1.84244 WP_003417980.1.84259 WP_003417980.1.8426 WP_003417980.1.84277 WP_003417980.1.84287 WP_003417980.1.8434 WP_003417980.1.84388 WP_003417980.1.84408 WP_003417980.1.84409 WP_003417980.1.84438 WP_003417980.1.84460 WP_003417980.1.84488 WP_003417980.1.84504 WP_003417980.1.84525 WP_003417980.1.84620 WP_003417980.1.84623 WP_003417980.1.84641 WP_003417980.1.84655 WP_003417980.1.84666 WP_003417980.1.84670 WP_003417980.1.84739 WP_003417980.1.84748 WP_003417980.1.84766 WP_003417980.1.84772 WP_003417980.1.848 WP_003417980.1.84812 WP_003417980.1.84836 WP_003417980.1.84839 WP_003417980.1.84846 WP_003417980.1.84873 WP_003417980.1.84911 WP_003417980.1.84938 WP_003417980.1.84968 WP_003417980.1.84973 WP_003417980.1.84981 WP_003417980.1.84985 WP_003417980.1.8503 WP_003417980.1.85038 WP_003417980.1.85041 WP_003417980.1.85043 WP_003417980.1.8505 WP_003417980.1.85074 WP_003417980.1.8509 WP_003417980.1.8512 WP_003417980.1.85148 WP_003417980.1.8518 WP_003417980.1.8522 WP_003417980.1.85242 WP_003417980.1.85276 WP_003417980.1.85281 WP_003417980.1.85284 WP_003417980.1.85314 WP_003417980.1.85319 WP_003417980.1.85330 WP_003417980.1.85341 WP_003417980.1.85346 WP_003417980.1.8535 WP_003417980.1.85363 WP_003417980.1.85371 WP_003417980.1.85377 WP_003417980.1.85387 WP_003417980.1.85399 WP_003417980.1.85458 WP_003417980.1.8546 WP_003417980.1.85464 WP_003417980.1.85478 WP_003417980.1.85480 WP_003417980.1.85488 WP_003417980.1.85495 WP_003417980.1.85551 WP_003417980.1.85557 WP_003417980.1.85577 WP_003417980.1.85597 WP_003417980.1.85610 WP_003417980.1.8563 WP_003417980.1.85648 WP_003417980.1.85679 WP_003417980.1.85704 WP_003417980.1.85717 WP_003417980.1.85727 WP_003417980.1.85737 WP_003417980.1.85763 WP_003417980.1.85808 WP_003417980.1.85819 WP_003417980.1.85820 WP_003417980.1.85823 WP_003417980.1.85832 WP_003417980.1.8586 WP_003417980.1.85872 WP_003417980.1.85894 WP_003417980.1.85909 WP_003417980.1.85913 WP_003417980.1.85953 WP_003417980.1.85986 WP_003417980.1.86000 WP_003417980.1.86024 WP_003417980.1.86025 WP_003417980.1.86032 WP_003417980.1.86048 WP_003417980.1.86052 WP_003417980.1.86067 WP_003417980.1.86103 WP_003417980.1.86122 WP_003417980.1.86124 WP_003417980.1.86160 WP_003417980.1.86164 WP_003417980.1.86168 WP_003417980.1.86190 WP_003417980.1.86204 WP_003417980.1.86208 WP_003417980.1.86235 WP_003417980.1.86249 WP_003417980.1.86260 WP_003417980.1.86290 WP_003417980.1.863 WP_003417980.1.86327 WP_003417980.1.86334 WP_003417980.1.86337 WP_003417980.1.86368 WP_003417980.1.86377 WP_003417980.1.86425 WP_003417980.1.86459 WP_003417980.1.8649 WP_003417980.1.86499 WP_003417980.1.86520 WP_003417980.1.86561 WP_003417980.1.86568 WP_003417980.1.86575 WP_003417980.1.86584 WP_003417980.1.86605 WP_003417980.1.86626 WP_003417980.1.86648 WP_003417980.1.8666 WP_003417980.1.86684 WP_003417980.1.86696 WP_003417980.1.86705 WP_003417980.1.86718 WP_003417980.1.86725 WP_003417980.1.86757 WP_003417980.1.86766 WP_003417980.1.86801 WP_003417980.1.86814 WP_003417980.1.86820 WP_003417980.1.86825 WP_003417980.1.86834 WP_003417980.1.8685 WP_003417980.1.86851 WP_003417980.1.86855 WP_003417980.1.86867 WP_003417980.1.86877 WP_003417980.1.86883 WP_003417980.1.8689 WP_003417980.1.86892 WP_003417980.1.86933 WP_003417980.1.86941 WP_003417980.1.86950 WP_003417980.1.86962 WP_003417980.1.86963 WP_003417980.1.86979 WP_003417980.1.8700 WP_003417980.1.87002 WP_003417980.1.87031 WP_003417980.1.87116 WP_003417980.1.87117 WP_003417980.1.8714 WP_003417980.1.87162 WP_003417980.1.87178 WP_003417980.1.87191 WP_003417980.1.87201 WP_003417980.1.87209 WP_003417980.1.87240 WP_003417980.1.87266 WP_003417980.1.87273 WP_003417980.1.87275 WP_003417980.1.8733 WP_003417980.1.87345 WP_003417980.1.8737 WP_003417980.1.87401 WP_003417980.1.87404 WP_003417980.1.87406 WP_003417980.1.87409 WP_003417980.1.87444 WP_003417980.1.87446 WP_003417980.1.87459 WP_003417980.1.87472 WP_003417980.1.87489 WP_003417980.1.87494 WP_003417980.1.87496 WP_003417980.1.87582 WP_003417980.1.87588 WP_003417980.1.87617 WP_003417980.1.87619 WP_003417980.1.87620 WP_003417980.1.87634 WP_003417980.1.87643 WP_003417980.1.8765 WP_003417980.1.87650 WP_003417980.1.87654 WP_003417980.1.87658 WP_003417980.1.87665 WP_003417980.1.87676 WP_003417980.1.87677 WP_003417980.1.87684 WP_003417980.1.87692 WP_003417980.1.87707 WP_003417980.1.87732 WP_003417980.1.87784 WP_003417980.1.87796 WP_003417980.1.87809 WP_003417980.1.87817 WP_003417980.1.87827 WP_003417980.1.87831 WP_003417980.1.87835 WP_003417980.1.87837 WP_003417980.1.87866 WP_003417980.1.8789 WP_003417980.1.87911 WP_003417980.1.87924 WP_003417980.1.87951 WP_003417980.1.87955 WP_003417980.1.87956 WP_003417980.1.87991 WP_003417980.1.88 WP_003417980.1.88002 WP_003417980.1.88037 WP_003417980.1.88039 WP_003417980.1.88072 WP_003417980.1.88077 WP_003417980.1.88121 WP_003417980.1.88180 WP_003417980.1.88191 WP_003417980.1.88205 WP_003417980.1.88217 WP_003417980.1.88219 WP_003417980.1.88245 WP_003417980.1.88253 WP_003417980.1.88294 WP_003417980.1.88315 WP_003417980.1.88316 WP_003417980.1.88320 WP_003417980.1.88338 WP_003417980.1.8840 WP_003417980.1.88437 WP_003417980.1.88453 WP_003417980.1.88469 WP_003417980.1.88489 WP_003417980.1.88507 WP_003417980.1.88521 WP_003417980.1.88530 WP_003417980.1.88537 WP_003417980.1.88541 WP_003417980.1.88592 WP_003417980.1.88616 WP_003417980.1.88618 WP_003417980.1.8862 WP_003417980.1.88625 WP_003417980.1.88632 WP_003417980.1.88634 WP_003417980.1.88649 WP_003417980.1.8870 WP_003417980.1.88737 WP_003417980.1.88756 WP_003417980.1.888 WP_003417980.1.88824 WP_003417980.1.88886 WP_003417980.1.88965 WP_003417980.1.88985 WP_003417980.1.8902 WP_003417980.1.89025 WP_003417980.1.89041 WP_003417980.1.89046 WP_003417980.1.89082 WP_003417980.1.89162 WP_003417980.1.89168 WP_003417980.1.8917 WP_003417980.1.89193 WP_003417980.1.89205 WP_003417980.1.89207 WP_003417980.1.89225 WP_003417980.1.8925 WP_003417980.1.89277 WP_003417980.1.89286 WP_003417980.1.89293 WP_003417980.1.89320 WP_003417980.1.8935 WP_003417980.1.89371 WP_003417980.1.89378 WP_003417980.1.89392 WP_003417980.1.89406 WP_003417980.1.8943 WP_003417980.1.89451 WP_003417980.1.89453 WP_003417980.1.89473 WP_003417980.1.89483 WP_003417980.1.895 WP_003417980.1.89513 WP_003417980.1.89517 WP_003417980.1.89522 WP_003417980.1.8954 WP_003417980.1.89543 WP_003417980.1.8957 WP_003417980.1.89572 WP_003417980.1.89589 WP_003417980.1.89607 WP_003417980.1.89613 WP_003417980.1.89625 WP_003417980.1.89648 WP_003417980.1.8967 WP_003417980.1.89670 WP_003417980.1.89676 WP_003417980.1.89729 WP_003417980.1.89739 WP_003417980.1.89762 WP_003417980.1.8977 WP_003417980.1.89802 WP_003417980.1.89808 WP_003417980.1.8982 WP_003417980.1.89829 WP_003417980.1.89831 WP_003417980.1.89844 WP_003417980.1.89849 WP_003417980.1.8989 WP_003417980.1.89901 WP_003417980.1.89903 WP_003417980.1.89909 WP_003417980.1.89922 WP_003417980.1.89926 WP_003417980.1.89963 WP_003417980.1.89971 WP_003417980.1.8998 WP_003417980.1.89987 WP_003417980.1.900 WP_003417980.1.90048 WP_003417980.1.9007 WP_003417980.1.90080 WP_003417980.1.90130 WP_003417980.1.90134 WP_003417980.1.90137 WP_003417980.1.90157 WP_003417980.1.90184 WP_003417980.1.90199 WP_003417980.1.90231 WP_003417980.1.90245 WP_003417980.1.90308 WP_003417980.1.90322 WP_003417980.1.90328 WP_003417980.1.90372 WP_003417980.1.90439 WP_003417980.1.90481 WP_003417980.1.90499 WP_003417980.1.9050 WP_003417980.1.90527 WP_003417980.1.90550 WP_003417980.1.90560 WP_003417980.1.90612 WP_003417980.1.90640 WP_003417980.1.90672 WP_003417980.1.90687 WP_003417980.1.90691 WP_003417980.1.90711 WP_003417980.1.90722 WP_003417980.1.90744 WP_003417980.1.9075 WP_003417980.1.90756 WP_003417980.1.90767 WP_003417980.1.90771 WP_003417980.1.90785 WP_003417980.1.90788 WP_003417980.1.90800 WP_003417980.1.90810 WP_003417980.1.90816 WP_003417980.1.90819 WP_003417980.1.9082 WP_003417980.1.90831 WP_003417980.1.90884 WP_003417980.1.90899 WP_003417980.1.90906 WP_003417980.1.90958 WP_003417980.1.90976 WP_003417980.1.90977 WP_003417980.1.90987 WP_003417980.1.9102 WP_003417980.1.91026 WP_003417980.1.91032 WP_003417980.1.91043 WP_003417980.1.91053 WP_003417980.1.91082 WP_003417980.1.91106 WP_003417980.1.91112 WP_003417980.1.91144 WP_003417980.1.91151 WP_003417980.1.91157 WP_003417980.1.91167 WP_003417980.1.91169 WP_003417980.1.91192 WP_003417980.1.91201 WP_003417980.1.91207 WP_003417980.1.91208 WP_003417980.1.91211 WP_003417980.1.91214 WP_003417980.1.91230 WP_003417980.1.91244 WP_003417980.1.91251 WP_003417980.1.91260 WP_003417980.1.91265 WP_003417980.1.9128 WP_003417980.1.91294 WP_003417980.1.91303 WP_003417980.1.91322 WP_003417980.1.91352 WP_003417980.1.91386 WP_003417980.1.9139 WP_003417980.1.91398 WP_003417980.1.91411 WP_003417980.1.91430 WP_003417980.1.91436 WP_003417980.1.91483 WP_003417980.1.91496 WP_003417980.1.91507 WP_003417980.1.91576 WP_003417980.1.91589 WP_003417980.1.91694 WP_003417980.1.91695 WP_003417980.1.91713 WP_003417980.1.91716 WP_003417980.1.91717 WP_003417980.1.91728 WP_003417980.1.91743 WP_003417980.1.91759 WP_003417980.1.91784 WP_003417980.1.91785 WP_003417980.1.91786 WP_003417980.1.91802 WP_003417980.1.91822 WP_003417980.1.91828 WP_003417980.1.9189 WP_003417980.1.91896 WP_003417980.1.9190 WP_003417980.1.91915 WP_003417980.1.91931 WP_003417980.1.91937 WP_003417980.1.91944 WP_003417980.1.91953 WP_003417980.1.91957 WP_003417980.1.91976 WP_003417980.1.91978 WP_003417980.1.92083 WP_003417980.1.92127 WP_003417980.1.92144 WP_003417980.1.92150 WP_003417980.1.92153 WP_003417980.1.92190 WP_003417980.1.92192 WP_003417980.1.92200 WP_003417980.1.92220 WP_003417980.1.92221 WP_003417980.1.92222 WP_003417980.1.92273 WP_003417980.1.92289 WP_003417980.1.9229 WP_003417980.1.92294 WP_003417980.1.92300 WP_003417980.1.92317 WP_003417980.1.92334 WP_003417980.1.92338 WP_003417980.1.92345 WP_003417980.1.92364 WP_003417980.1.92416 WP_003417980.1.92428 WP_003417980.1.92447 WP_003417980.1.92456 WP_003417980.1.92467 WP_003417980.1.92471 WP_003417980.1.92490 WP_003417980.1.92508 WP_003417980.1.9251 WP_003417980.1.92511 WP_003417980.1.92523 WP_003417980.1.92527 WP_003417980.1.92536 WP_003417980.1.92592 WP_003417980.1.92597 WP_003417980.1.92603 WP_003417980.1.92606 WP_003417980.1.92610 WP_003417980.1.92613 WP_003417980.1.9263 WP_003417980.1.9265 WP_003417980.1.92650 WP_003417980.1.92677 WP_003417980.1.92685 WP_003417980.1.92689 WP_003417980.1.92690 WP_003417980.1.92706 WP_003417980.1.92714 WP_003417980.1.92736 WP_003417980.1.9274 WP_003417980.1.92752 WP_003417980.1.92760 WP_003417980.1.92777 WP_003417980.1.92803 WP_003417980.1.92856 WP_003417980.1.92881 WP_003417980.1.92892 WP_003417980.1.92907 WP_003417980.1.92908 WP_003417980.1.9291 WP_003417980.1.92917 WP_003417980.1.92996 WP_003417980.1.93006 WP_003417980.1.93008 WP_003417980.1.93009 WP_003417980.1.93015 WP_003417980.1.93043 WP_003417980.1.9307 WP_003417980.1.93083 WP_003417980.1.93097 WP_003417980.1.93137 WP_003417980.1.93192 WP_003417980.1.93199 WP_003417980.1.93203 WP_003417980.1.93212 WP_003417980.1.93234 WP_003417980.1.93245 WP_003417980.1.93257 WP_003417980.1.93265 WP_003417980.1.93297 WP_003417980.1.93320 WP_003417980.1.93328 WP_003417980.1.93337 WP_003417980.1.93343 WP_003417980.1.93349 WP_003417980.1.93363 WP_003417980.1.93377 WP_003417980.1.9338 WP_003417980.1.93407 WP_003417980.1.93417 WP_003417980.1.93419 WP_003417980.1.93426 WP_003417980.1.9344 WP_003417980.1.93443 WP_003417980.1.93447 WP_003417980.1.93470 WP_003417980.1.93483 WP_003417980.1.93487 WP_003417980.1.93495 WP_003417980.1.93499 WP_003417980.1.93516 WP_003417980.1.93536 WP_003417980.1.93544 WP_003417980.1.93555 WP_003417980.1.93560 WP_003417980.1.93564 WP_003417980.1.9357 WP_003417980.1.93573 WP_003417980.1.93576 WP_003417980.1.93588 WP_003417980.1.9363 WP_003417980.1.93645 WP_003417980.1.93649 WP_003417980.1.93659 WP_003417980.1.93677 WP_003417980.1.9368 WP_003417980.1.93689 WP_003417980.1.93693 WP_003417980.1.93698 WP_003417980.1.93706 WP_003417980.1.9371 WP_003417980.1.93792 WP_003417980.1.93823 WP_003417980.1.93871 WP_003417980.1.9388 WP_003417980.1.93894 WP_003417980.1.93903 WP_003417980.1.93907 WP_003417980.1.93913 WP_003417980.1.93946 WP_003417980.1.93950 WP_003417980.1.93953 WP_003417980.1.93954 WP_003417980.1.93988 WP_003417980.1.9407 WP_003417980.1.94143 WP_003417980.1.94154 WP_003417980.1.94184 WP_003417980.1.94204 WP_003417980.1.94205 WP_003417980.1.94226 WP_003417980.1.94231 WP_003417980.1.94256 WP_003417980.1.94261 WP_003417980.1.94281 WP_003417980.1.94292 WP_003417980.1.94297 WP_003417980.1.9431 WP_003417980.1.94326 WP_003417980.1.94339 WP_003417980.1.94392 WP_003417980.1.94416 WP_003417980.1.94421 WP_003417980.1.94456 WP_003417980.1.94470 WP_003417980.1.94480 WP_003417980.1.94511 WP_003417980.1.94512 WP_003417980.1.94525 WP_003417980.1.94528 WP_003417980.1.946 WP_003417980.1.94602 WP_003417980.1.94623 WP_003417980.1.94629 WP_003417980.1.9465 WP_003417980.1.94673 WP_003417980.1.94714 WP_003417980.1.94730 WP_003417980.1.94736 WP_003417980.1.94776 WP_003417980.1.9478 WP_003417980.1.94834 WP_003417980.1.94852 WP_003417980.1.94872 WP_003417980.1.9488 WP_003417980.1.94902 WP_003417980.1.94916 WP_003417980.1.94979 WP_003417980.1.94994 WP_003417980.1.94996 WP_003417980.1.94998 WP_003417980.1.95010 WP_003417980.1.95015 WP_003417980.1.95034 WP_003417980.1.95068 WP_003417980.1.95081 WP_003417980.1.95082 WP_003417980.1.9509 WP_003417980.1.95096 WP_003417980.1.95112 WP_003417980.1.95138 WP_003417980.1.9514 WP_003417980.1.95179 WP_003417980.1.95188 WP_003417980.1.95190 WP_003417980.1.95234 WP_003417980.1.95241 WP_003417980.1.95245 WP_003417980.1.95257 WP_003417980.1.95279 WP_003417980.1.9531 WP_003417980.1.95335 WP_003417980.1.95344 WP_003417980.1.9535 WP_003417980.1.95370 WP_003417980.1.95392 WP_003417980.1.95416 WP_003417980.1.95417 WP_003417980.1.95454 WP_003417980.1.95455 WP_003417980.1.95491 WP_003417980.1.95497 WP_003417980.1.95508 WP_003417980.1.95509 WP_003417980.1.95529 WP_003417980.1.95556 WP_003417980.1.95557 WP_003417980.1.95565 WP_003417980.1.95578 WP_003417980.1.95580 WP_003417980.1.95585 WP_003417980.1.95643 WP_003417980.1.95679 WP_003417980.1.95685 WP_003417980.1.957 WP_003417980.1.95724 WP_003417980.1.95727 WP_003417980.1.95730 WP_003417980.1.95735 WP_003417980.1.95758 WP_003417980.1.95772 WP_003417980.1.95797 WP_003417980.1.95839 WP_003417980.1.9590 WP_003417980.1.95902 WP_003417980.1.95908 WP_003417980.1.95924 WP_003417980.1.95926 WP_003417980.1.95953 WP_003417980.1.95958 WP_003417980.1.95964 WP_003417980.1.95973 WP_003417980.1.96006 WP_003417980.1.9602 WP_003417980.1.96036 WP_003417980.1.96062 WP_003417980.1.96065 WP_003417980.1.96098 WP_003417980.1.96146 WP_003417980.1.96171 WP_003417980.1.96182 WP_003417980.1.96230 WP_003417980.1.96235 WP_003417980.1.96242 WP_003417980.1.96245 WP_003417980.1.96254 WP_003417980.1.96259 WP_003417980.1.96286 WP_003417980.1.96313 WP_003417980.1.96318 WP_003417980.1.96345 WP_003417980.1.96360 WP_003417980.1.96373 WP_003417980.1.96456 WP_003417980.1.96486 WP_003417980.1.96560 WP_003417980.1.96569 WP_003417980.1.96573 WP_003417980.1.96576 WP_003417980.1.96611 WP_003417980.1.96621 WP_003417980.1.9667 WP_003417980.1.96681 WP_003417980.1.96726 WP_003417980.1.96733 WP_003417980.1.96742 WP_003417980.1.96754 WP_003417980.1.9678 WP_003417980.1.96832 WP_003417980.1.9685 WP_003417980.1.97008 WP_003417980.1.97009 WP_003417980.1.97056 WP_003417980.1.97084 WP_003417980.1.97087 WP_003417980.1.97094 WP_003417980.1.97096 WP_003417980.1.97099 WP_003417980.1.97108 WP_003417980.1.97113 WP_003417980.1.97122 WP_003417980.1.97129 WP_003417980.1.97136 WP_003417980.1.9716 WP_003417980.1.97176 WP_003417980.1.97222 WP_003417980.1.97223 WP_003417980.1.97237 WP_003417980.1.97242 WP_003417980.1.97270 WP_003417980.1.97283 WP_003417980.1.97296 WP_003417980.1.97321 WP_003417980.1.97325 WP_003417980.1.97330 WP_003417980.1.97366 WP_003417980.1.97376 WP_003417980.1.97380 WP_003417980.1.9739 WP_003417980.1.97462 WP_003417980.1.97517 WP_003417980.1.97535 WP_003417980.1.97540 WP_003417980.1.97545 WP_003417980.1.97546 WP_003417980.1.97550 WP_003417980.1.97568 WP_003417980.1.97577 WP_003417980.1.97584 WP_003417980.1.9759 WP_003417980.1.97591 WP_003417980.1.97596 WP_003417980.1.97609 WP_003417980.1.97618 WP_003417980.1.9763 WP_003417980.1.97669 WP_003417980.1.97673 WP_003417980.1.97700 WP_003417980.1.97701 WP_003417980.1.9773 WP_003417980.1.97730 WP_003417980.1.97740 WP_003417980.1.97751 WP_003417980.1.97754 WP_003417980.1.97797 WP_003417980.1.9782 WP_003417980.1.9784 WP_003417980.1.97888 WP_003417980.1.9790 WP_003417980.1.9795 WP_003417980.1.97951 WP_003417980.1.97958 WP_003417980.1.97966 WP_003417980.1.97977 WP_003417980.1.97979 WP_003417980.1.97995 WP_003417980.1.98018 WP_003417980.1.98034 WP_003417980.1.98052 WP_003417980.1.98071 WP_003417980.1.98072 WP_003417980.1.98114 WP_003417980.1.98128 WP_003417980.1.98181 WP_003417980.1.98188 WP_003417980.1.98189 WP_003417980.1.98213 WP_003417980.1.98225 WP_003417980.1.98291 WP_003417980.1.98335 WP_003417980.1.98350 WP_003417980.1.98395 WP_003417980.1.98412 WP_003417980.1.98441 WP_003417980.1.98443 WP_003417980.1.98462 WP_003417980.1.9848 WP_003417980.1.98482 WP_003417980.1.98486 WP_003417980.1.98488 WP_003417980.1.98503 WP_003417980.1.98516 WP_003417980.1.98524 WP_003417980.1.98536 WP_003417980.1.98541 WP_003417980.1.98566 WP_003417980.1.98576 WP_003417980.1.98590 WP_003417980.1.98594 WP_003417980.1.98599 WP_003417980.1.98629 WP_003417980.1.98645 WP_003417980.1.98646 WP_003417980.1.98649 WP_003417980.1.98656 WP_003417980.1.9867 WP_003417980.1.98674 WP_003417980.1.98697 WP_003417980.1.98701 WP_003417980.1.98739 WP_003417980.1.98749 WP_003417980.1.98765 WP_003417980.1.98770 WP_003417980.1.98777 WP_003417980.1.98778 WP_003417980.1.98802 WP_003417980.1.98838 WP_003417980.1.98850 WP_003417980.1.98906 WP_003417980.1.98935 WP_003417980.1.98948 WP_003417980.1.98953 WP_003417980.1.98984 WP_003417980.1.99000 WP_003417980.1.99023 WP_003417980.1.99030 WP_003417980.1.99037 WP_003417980.1.99055 WP_003417980.1.99062 WP_003417980.1.99086 WP_003417980.1.99115 WP_003417980.1.99117 WP_003417980.1.99161 WP_003417980.1.99176 WP_003417980.1.99205 WP_003417980.1.99211 WP_003417980.1.99216 WP_003417980.1.99222 WP_003417980.1.99251 WP_003417980.1.99269 WP_003417980.1.99294 WP_003417980.1.99312 WP_003417980.1.99315 WP_003417980.1.99316 WP_003417980.1.99322 WP_003417980.1.99328 WP_003417980.1.99365 WP_003417980.1.99368 WP_003417980.1.99379 WP_003417980.1.99396 WP_003417980.1.99402 WP_003417980.1.99404 WP_003417980.1.99419 WP_003417980.1.99438 WP_003417980.1.99460 WP_003417980.1.99468 WP_003417980.1.99473 WP_003417980.1.99513 WP_003417980.1.99529 WP_003417980.1.99548 WP_003417980.1.99572 WP_003417980.1.99575 WP_003417980.1.99578 WP_003417980.1.99605 WP_003417980.1.99609 WP_003417980.1.99617 WP_003417980.1.99635 WP_003417980.1.99650 WP_003417980.1.99672 WP_003417980.1.99701 WP_003417980.1.99711 WP_003417980.1.99716 WP_003417980.1.99740 WP_003417980.1.99745 WP_003417980.1.99749 WP_003417980.1.9976 WP_003417980.1.99798 WP_003417980.1.99817 WP_003417980.1.99847 WP_003417980.1.99852 WP_003417980.1.99886 WP_003417980.1.99897 WP_003417980.1.99899 WP_003417980.1.99915 WP_003417980.1.9993 WP_003417980.1.99991 gi|339633409|ref|YP_004725051.1| gi|392433889|ref|YP_006474933.1| gi|121639329|ref|YP_979553.1| 233413.Mb3438c 336982.TBFG_13439 410289.BCG_3474c 419947.MRA_3444 478434.TBMG_03455 561275.JTY_3474 83331.MT3512 83332.Rv3404c gi|525675850|ref|YP_008227498.1| gi|15610540|ref|NP_217921.1| gi|253800451|ref|YP_003033452.1| gi|506927994|ref|YP_008008444.1| gi|224991826|ref|YP_002646515.1| gi|506927994|ref|YP_008008444.1| gi|383309136|ref|YP_005361947.1| gi|148824612|ref|YP_001289366.1| gi|433628542|ref|YP_007262171.1| gi|449065517|ref|YP_007432600.1| gi|386000197|ref|YP_005918496.1| gi|471339462|ref|YP_007612175.1| gi|148663268|ref|YP_001284791.1| gi|15610540|ref|NP_217921.1| gi|494697791|ref|YP_007963294.1| gi|479316399|ref|YP_007856451.1| gi|494693846|ref|YP_007959389.1| gi|479057382|ref|YP_007353188.1| gi|392388011|ref|YP_005309640.1| gi|31794585|ref|NP_857078.1| gi|375297678|ref|YP_005101945.1| gi|494701859|ref|YP_007967341.1| gi|197739006|ref|YP_002160321.1| gi|385992637|ref|YP_005910935.1| gi|378773190|ref|YP_005172923.1| gi|15842999|ref|NP_338036.1| gi|340628382|ref|YP_004746834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]