SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MVLG_03461T0 from Microbotryum violaceum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVLG_03461T0
Domain Number 1 Region: 106-517
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 3.92e-127
Family ArgJ-like 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MVLG_03461T0
Sequence length 520
Comment pep:novel supercontig:GCA_000166175.1:supercont1.33:47307:50292:1 gene:MVLG_03461 transcript:MVLG_03461T0 description:"arginine biosynthesis ArgJ"
Sequence
MQCRPTSGPPLGRLPRRAHRATRSTLRPEHPPETPTQTLTAAMPPASTTARFGTRLLSTS
ALRTAVTASSSSSSPPAASAASSSSSSAPQSKAQRFAFDPTAAKFPLGFVATGLHCGVKK
DPSRLDLGVIISDRPCSAAGTFTRNAFVAAPVVVSKEVLAKGRGIARGLVVNSGCANAVT
GSQGLKDARAMSDQLDSFLCESNSSSATGTLVMSTGVIGQLLPIKKILSGITSSTATLGS
THSAWLDAAKAFMTTDTFPKLRTRSFELGGKEVRMVGIDKGAGMIHPNMGPPHATLLGMI
ATDAAVTPASLQDALTYAVDRSFNSISVDGDMSTNDTIVVLANGASGSVEISEKATPDEY
IKFRDQLTDFAAELAQLVVRDGEGAEKFVKITVKGSPTYEAAHKIASTISTSALVKCALH
GEDANWGRILCAVGYSNPGFDIDPTKVTVSFVPVPVDGSAELKLLVNGEPEHVDEARASE
ILKSEDLAIQVDLGLGDESATYWTCDFSHEYISINADYRS
Download sequence
Identical sequences U5H895
MVLG_03461T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]