SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MVLG_01935T0 from Microbotryum violaceum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVLG_01935T0
Domain Number 1 Region: 537-565,612-669
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000235
Family Anti-sigma factor antagonist SpoIIaa 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MVLG_01935T0
Sequence length 772
Comment pep:novel supercontig:GCA_000166175.1:supercont1.13:165938:169168:-1 gene:MVLG_01935 transcript:MVLG_01935T0 description:"hypothetical protein"
Sequence
MATIIELPQQKTFKEKAFAWLGHDPIITETASTRDALASASSDLPGAAAHYVNRLFPFTK
WILNYNLGWLTGDLIAGLTVGMVVVPQSMSYAKIATLPPQIGLYSSFVGVMIYWLFSTSK
DVTIGPVAVMSLEVSKVIKHVQNSPTGKQYSATEIASTLALICGIIVLGIGGLRLGWIVE
FISAPAVSGFMTGSAISIIAGQLAGLMGYSNKFDTRASTYKVIINSFKYLPSTKRDAAYG
LSGLFFLYSVRAVCNHYERTGRTYTIRRTAFFVGTLRTALTIIFLTLFAWVHLRHQKPAN
YDISILKTVPSGFQNMQVPRFRTGLISELGPLLPVSTIILLLEHIAISKSFGRVNNYKID
PNQELIAIGITNVFTPFFGGYPATGSFSRTAIKSKAGVRTPLAGVITGIVVIIAIYGLTG
AFYWIPNAGLSAVIIHAVGDLIASPPQVYSFWLVSPLEAIIFFGSVIITVFTTIEIGIYA
SVAASAALLLYRIAKPRGTFLGRVRIHSEDNNITREVFVPLNKDGVHNPYVKVEAPPPGI
IVYRVEESFLYPNASRYVDHIADYAKETTRSAIDYDSLSLSQRPWNDPGPLRFSKKKTLV
PGQLSATDANAAKPLLRAIVIDCSGISNIDSTSVQNLVDLRRVLERYSGQEVEFHFASIL
SPWIKRALLAGGFGRGRGSQPLEIAAVVPAGTEAVIERYEKHFPSSPPNGRIPSDDSSSA
NSKVPDIEEAGGSLDQRLGEHLTPTGPLVSALTNRFHLDLAAAVAAAAGREW
Download sequence
Identical sequences U5H3M4
MVLG_01935T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]