SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MVLG_04097T0 from Microbotryum violaceum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVLG_04097T0
Domain Number 1 Region: 851-1041
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000458
Family Tropomyosin 0.0088
Further Details:      
 
Domain Number 2 Region: 1057-1243
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000719
Family Tropomyosin 0.0076
Further Details:      
 
Weak hits

Sequence:  MVLG_04097T0
Domain Number - Region: 661-739
Classification Level Classification E-value
Superfamily Tropomyosin 0.0199
Family Tropomyosin 0.0058
Further Details:      
 
Domain Number - Region: 335-562
Classification Level Classification E-value
Superfamily Tropomyosin 0.0317
Family Tropomyosin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MVLG_04097T0
Sequence length 1583
Comment pep:novel supercontig:GCA_000166175.1:supercont1.43:16381:21396:-1 gene:MVLG_04097 transcript:MVLG_04097T0 description:"hypothetical protein"
Sequence
MPFAQLKRFQAAKSGSVPKPTPTRTRTSSSPEEDVQSPTLSPSLNLYRTLSPTNTNLSPP
SSAASIFASPPHPVVAAPPSATQSRTFTPPNPFGLPPTVRERQTLNPLRSPPRLFSPPLR
PLDDTIPQPHPSSSSTITSPNIVPPSPIHSQSNQLYNSIQIESTALASKEERDLIYSSPK
SIPIPIPIPILIPDEERIDGLQVENQRLLRRVQELETYVGEQGKRDEEEEERIRWQNRLE
VERKKGERKRNKMNKRELEVYRRSKASVEQALSTRDQEVLGLRAELEELASSYQSKLVTL
ENTLEQAKARSKNLQSQLDDLDASHSGTRQDSSRELEQAITLATKAQADLIDRTQELEQL
SHELSETTTRLVDSEQQRTSLQTELTELSKTTSEQLTSLREELTRTKTHSTSLEQTISSF
EIKLSALSSHRDELQFENSNLQTSLDESRRKVSVATNEKFNIDEESFSLRQELSDCKLEL
DRLGESAEEADCLREELDGLQDQLAELVEDGEKAQQELGEANEMIRKLEKEREVGLLRVG
ELEEVVQGLRKREVERLEGDLGVEVRMEELEERYRVKVEECGVLEKEIEDIKARYAQLEA
THGEATQRVRDDLDRTVEELKAKHERLTKELESQHEQILTSTRQEHASALEAFESAKQSR
TNDDQSRLSSLEQELVDVKAHAAQLVSQGGQALADLERRTSELSLMQSERDAATHRAEVA
ETRFSELRSELEEARSQLVASSAVAAPPSTISTIDFPLGSDSSEREQLLLIKITQLEADV
LEARRASDQSVQNIASQIGTINKLRREHTELVSQCTAESKRVTELRKMIEKKDFDSSRMG
QDIVRLRTELASAKADTEASNRARRTIEQTLNVTRATNAGLERQVGEARALQVAAEASVK
PLQETVEMYEIELDQKQDRIGELEDEVAMYVKRVNELEFSMNAVAKKAASSESKASDLVE
VLENERTSHARALSEMVNSLTGLRTELDHARSSLESTTVGTSEADGLRARIGELESSLHS
TENELAASQRELDSTQRDLNRLQESNNTGIELANANLSESLPTSAQEEMDLLSAELEKSR
EQLRRVEDENRELKKGLEEARRELVDAKGEVKGARKELLDVSELCSTLEERAKELETSLE
VLKGSNETQIATISTLETELGSLRTSLSDREASLLSLRTELSSATESSGIVVRERDVALN
AAVRRASKSERELKSLIASGDERLGELDTLRMLVGSLQEELASLRSGKEGTSGQVASLTD
ELERNVGEVESLRRLLEREKEATSDVRRALADLKEALGRAEADLETRNTELVGLRMRVGK
TEGEGEAKGAASGGEYDLDALQQQAELNLSTARAQIRSLEHRLFEEEDARYELEKTNGDL
KLQIQGMTEMIEDDAVRIRELEALLGANDLHEHDPPPHLDSPELEEPHSSLTRGPRAGSH
RRVPSLLTPVEETSELSSSPLSPSNAVLPLPSHQPPFNAPVSPPLVSVSTPILDGTMSPT
SSKRHVRQASLSLLKSRLETELGPDAVLPDDPFDPTATTPTGPSSSDTLLANSTTSLRTS
TNRAVLQDNLVWCACCQGDLFVV
Download sequence
Identical sequences U5HA62
MVLG_04097T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]