SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MVLG_05925T0 from Microbotryum violaceum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVLG_05925T0
Domain Number 1 Region: 19-223
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-22
Family Capz beta-1 subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 632-726
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000749
Family UBX domain 0.032
Further Details:      
 
Domain Number 3 Region: 406-494
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000716
Family Thioltransferase 0.046
Further Details:      
 
Weak hits

Sequence:  MVLG_05925T0
Domain Number - Region: 478-551
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0549
Family Bactericidal permeability-increasing protein, BPI 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MVLG_05925T0
Sequence length 752
Comment pep:novel supercontig:GCA_000166175.1:supercont1.91:19873:23290:-1 gene:MVLG_05925 transcript:MVLG_05925T0 description:"hypothetical protein"
Sequence
MNETQQHPPSEHDLVRLATDLSEMASSSGMLGPLQFNLDTLQDDQGQPFLTSKFNQQGTS
HRSPWTNHYIPPIPRSSVSVALSGRTRALEVALNQSVSELRDQLWPGGISSVYLREAEAA
ESTHGVALIKKAILSAGRVTAFDSIHEFSISHLPHAPSACYTLNSTIEVHKDKIGGSTSN
SSRSELPVEGPSTSSQHSSHARNVTQLIEQQEKQLRETLQDIHRSIAPPQASTTADDDYQ
RHAYPPAPNDAEDDYGGSESRHLLDEFGIDETMPPTSGRAAAQNGPFTRWLRRFLQLPLR
ILAIPIGLLGIAFGVVARLLRIRPGQTSLGPRNPFARDARSLQRMDPVGSAERFVRSIEE
MTGAVRWSRRLGDAQGSSSSVVGTSSGGSSSLERRRSGSNSSARKALPDFWIGSYESALK
KAKDDFQVLMVVLTCDEHEGDELFKRRVLTDPELLNALAREKILVWGGDVRDVDAYQASK
ALQFFRLPFVAFVALQPHSSNPTLPGSASISSPKLSVVTRLEGSPSSTLSASSLLAHLTN
VVLPRVNPFLARLKAQHATRLEERRLRQEQDRAFAMSAQKDEERVLRKRAEESQRQRDVE
ERKRKEEVALRIREGSTKWRAWKRGQLQVEGEREGVRIGVRLGDGRRVVRSFAKDAKVED
VYAYAECSFETDDGERREAPPEDYEHIYEFQLAAPFPRYVLEVDGDAGQRTLEQIPWLEK
NVSLIVEGLEQRRISLGKSEASDDEEIEEDDE
Download sequence
Identical sequences U5HFP9
MVLG_05925T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]