SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MVLG_06219T0 from Microbotryum violaceum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVLG_06219T0
Domain Number 1 Region: 41-313,373-416
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.57e-69
Family IF2B-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MVLG_06219T0
Sequence length 421
Comment pep:novel supercontig:GCA_000166175.1:supercont1.105:38877:41861:1 gene:MVLG_06219 transcript:MVLG_06219T0 description:"hypothetical protein"
Sequence
MGSPRSPRTPSSPLAAGSDGPYSFTSSTSTPLAGSCSSLPTLHESTTLPPREPMDVVTYY
ADLLASDDSLSMPIAAIETLAQLISQSDTSTTTTELFSLLDQASTRLAQASFNPISLTCG
TSLFLRFLTLQRPSPDTSFQEFKAELVARAREFVHESGRCRQLISSGMNEFVRDGANILI
HSYSRVVVQALLHAAQQQKNCFQVYVTESRPFGLGLKTQAILSRAGIPCIVVLDSSVAYI
MPKCDLVIVGAEAVCESGGLVNFIGGYQVAVVAKAMGKPLYALAESFKFTRLFPLSQYDL
PTSLPNPPLTFPDLTNTSSSIPDARESTTTTTTASDSTLDPSSPSPFSEATSSSTPPPPT
PSRPMINSAIPQALEMTDQMIRNNPTLDYTTPDLITLIISDLGCLTPSGVSDALLSIFGG
T
Download sequence
Identical sequences U5HGL4
MVLG_06219T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]