SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378769864|ref|YP_005169597.1| from Mycobacterium bovis BCG str. Mexico

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378769864|ref|YP_005169597.1|
Domain Number 1 Region: 14-189
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.54e-47
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000109
Further Details:      
 
Domain Number 2 Region: 371-561
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.27e-43
Family Pyruvate oxidase and decarboxylase PP module 0.00000252
Further Details:      
 
Domain Number 3 Region: 167-366
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.86e-39
Family Pyruvate oxidase and decarboxylase, middle domain 0.00000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378769864|ref|YP_005169597.1|
Sequence length 582
Comment putative oxalyl-CoA decarboxylase [Mycobacterium bovis BCG str. Mexico]
Sequence
MTTRSASPCTVLTDGCHLVVDALKANDVDTIYGVVGIPITDLARAAQASGIRYIGFRHEA
SAGNAAAAAGFLTARPGVCLTTSGPGFLNGLPALANATTNCFPMIQISGSSSRPMVDLQR
GDYQDLDQLNAARPFVKAAYRIGQVQDIGRGVARAIRTATSGRPGGVYLDIPGDVLGQAV
EASAASGAIWRPVDPAPRLLPAPEAIDRALDVLAQAQRPLLVLGKGAAYAQADNVIREFV
EHTGIPFLPMSMAKGLLPDSHPQSAAAARSLAMARADVVLLVGARLNWLLGNGESPQWSA
DAKFIQVDIEASEFDSNRPIVAPLTGDIGSVMSALLEAAADRSSVASAAWTGELADRKAR
NSAKMRRRLADDHHPMRFYNALGAIRSVLQRNPDVYVVNEGANALDLARNIIDMHLPRHR
LDSGTWGVMGIGMGYAIAAAVETGRPVVAIEGDSAFGFSGMEFETICRYRLPVTVVILNN
GGVYRGDEATIFRSAAPVWRHDPAPTVLNAHARHELIAEAFGGKGYHVSTPTELESALTD
ALASNGPSLIDCELDPADGVESGHLAKLNTTSAATPAISGDG
Download sequence
Identical sequences A0A066S2Y0 A0A083WJ05 A0A0H3M0Q5 A0A120IV46 A0A120IZ93 A0A197J3E7 A0A1R3XUD1 A0A1S1B7Z4 F8LZN6 M8DBL3
WP_003400858.1.100000 WP_003400858.1.100069 WP_003400858.1.100208 WP_003400858.1.100216 WP_003400858.1.100255 WP_003400858.1.100308 WP_003400858.1.10037 WP_003400858.1.100383 WP_003400858.1.100395 WP_003400858.1.100460 WP_003400858.1.10064 WP_003400858.1.100697 WP_003400858.1.100703 WP_003400858.1.100716 WP_003400858.1.100722 WP_003400858.1.1008 WP_003400858.1.100866 WP_003400858.1.100889 WP_003400858.1.100984 WP_003400858.1.100998 WP_003400858.1.101146 WP_003400858.1.10116 WP_003400858.1.101209 WP_003400858.1.101350 WP_003400858.1.10144 WP_003400858.1.101442 WP_003400858.1.101553 WP_003400858.1.101573 WP_003400858.1.101576 WP_003400858.1.10159 WP_003400858.1.101592 WP_003400858.1.101607 WP_003400858.1.101687 WP_003400858.1.101698 WP_003400858.1.101743 WP_003400858.1.101764 WP_003400858.1.101797 WP_003400858.1.101802 WP_003400858.1.101899 WP_003400858.1.1019 WP_003400858.1.101996 WP_003400858.1.102017 WP_003400858.1.102053 WP_003400858.1.102063 WP_003400858.1.102119 WP_003400858.1.102121 WP_003400858.1.10262 WP_003400858.1.10277 WP_003400858.1.10350 WP_003400858.1.10396 WP_003400858.1.10414 WP_003400858.1.10421 WP_003400858.1.10430 WP_003400858.1.10523 WP_003400858.1.1057 WP_003400858.1.10643 WP_003400858.1.10756 WP_003400858.1.10825 WP_003400858.1.10879 WP_003400858.1.1095 WP_003400858.1.10956 WP_003400858.1.10980 WP_003400858.1.1100 WP_003400858.1.11040 WP_003400858.1.11141 WP_003400858.1.11175 WP_003400858.1.11222 WP_003400858.1.11373 WP_003400858.1.11390 WP_003400858.1.11587 WP_003400858.1.11826 WP_003400858.1.11898 WP_003400858.1.11972 WP_003400858.1.11984 WP_003400858.1.12049 WP_003400858.1.12116 WP_003400858.1.12187 WP_003400858.1.12190 WP_003400858.1.12294 WP_003400858.1.1231 WP_003400858.1.1236 WP_003400858.1.1255 WP_003400858.1.12550 WP_003400858.1.12563 WP_003400858.1.12692 WP_003400858.1.1271 WP_003400858.1.1279 WP_003400858.1.12801 WP_003400858.1.12957 WP_003400858.1.13043 WP_003400858.1.13090 WP_003400858.1.13183 WP_003400858.1.132 WP_003400858.1.13284 WP_003400858.1.13302 WP_003400858.1.13306 WP_003400858.1.13358 WP_003400858.1.13375 WP_003400858.1.13461 WP_003400858.1.13466 WP_003400858.1.13561 WP_003400858.1.13564 WP_003400858.1.13647 WP_003400858.1.13697 WP_003400858.1.13794 WP_003400858.1.13834 WP_003400858.1.13866 WP_003400858.1.13910 WP_003400858.1.13919 WP_003400858.1.13920 WP_003400858.1.14266 WP_003400858.1.14303 WP_003400858.1.14307 WP_003400858.1.14416 WP_003400858.1.14477 WP_003400858.1.14504 WP_003400858.1.14514 WP_003400858.1.1454 WP_003400858.1.14548 WP_003400858.1.1462 WP_003400858.1.14658 WP_003400858.1.14667 WP_003400858.1.14926 WP_003400858.1.14951 WP_003400858.1.15028 WP_003400858.1.15131 WP_003400858.1.15168 WP_003400858.1.15172 WP_003400858.1.15216 WP_003400858.1.15232 WP_003400858.1.15238 WP_003400858.1.1534 WP_003400858.1.15365 WP_003400858.1.15372 WP_003400858.1.15387 WP_003400858.1.15449 WP_003400858.1.15481 WP_003400858.1.15492 WP_003400858.1.15512 WP_003400858.1.15611 WP_003400858.1.15688 WP_003400858.1.15827 WP_003400858.1.15834 WP_003400858.1.15842 WP_003400858.1.15853 WP_003400858.1.15893 WP_003400858.1.15987 WP_003400858.1.15993 WP_003400858.1.16025 WP_003400858.1.16043 WP_003400858.1.16069 WP_003400858.1.16106 WP_003400858.1.16110 WP_003400858.1.16143 WP_003400858.1.16318 WP_003400858.1.16345 WP_003400858.1.164 WP_003400858.1.16421 WP_003400858.1.16426 WP_003400858.1.16480 WP_003400858.1.16549 WP_003400858.1.16560 WP_003400858.1.16598 WP_003400858.1.16619 WP_003400858.1.16637 WP_003400858.1.1669 WP_003400858.1.16707 WP_003400858.1.16743 WP_003400858.1.16837 WP_003400858.1.16852 WP_003400858.1.16950 WP_003400858.1.16973 WP_003400858.1.16977 WP_003400858.1.17005 WP_003400858.1.17010 WP_003400858.1.17015 WP_003400858.1.17019 WP_003400858.1.17039 WP_003400858.1.17052 WP_003400858.1.17094 WP_003400858.1.17167 WP_003400858.1.17288 WP_003400858.1.17304 WP_003400858.1.17314 WP_003400858.1.17412 WP_003400858.1.17505 WP_003400858.1.17527 WP_003400858.1.17535 WP_003400858.1.17540 WP_003400858.1.17558 WP_003400858.1.17599 WP_003400858.1.17655 WP_003400858.1.1768 WP_003400858.1.17687 WP_003400858.1.17700 WP_003400858.1.17710 WP_003400858.1.17798 WP_003400858.1.17868 WP_003400858.1.17878 WP_003400858.1.18009 WP_003400858.1.18013 WP_003400858.1.18170 WP_003400858.1.18206 WP_003400858.1.18216 WP_003400858.1.18411 WP_003400858.1.18476 WP_003400858.1.18580 WP_003400858.1.186 WP_003400858.1.18646 WP_003400858.1.18647 WP_003400858.1.18781 WP_003400858.1.18816 WP_003400858.1.18823 WP_003400858.1.18849 WP_003400858.1.18856 WP_003400858.1.1898 WP_003400858.1.19071 WP_003400858.1.19243 WP_003400858.1.19382 WP_003400858.1.19400 WP_003400858.1.19480 WP_003400858.1.19553 WP_003400858.1.19596 WP_003400858.1.19707 WP_003400858.1.19785 WP_003400858.1.19922 WP_003400858.1.19936 WP_003400858.1.19964 WP_003400858.1.20085 WP_003400858.1.20097 WP_003400858.1.20130 WP_003400858.1.20142 WP_003400858.1.20273 WP_003400858.1.20309 WP_003400858.1.20432 WP_003400858.1.20459 WP_003400858.1.20542 WP_003400858.1.20578 WP_003400858.1.20707 WP_003400858.1.20729 WP_003400858.1.20742 WP_003400858.1.20751 WP_003400858.1.20776 WP_003400858.1.20850 WP_003400858.1.20876 WP_003400858.1.20916 WP_003400858.1.20951 WP_003400858.1.21127 WP_003400858.1.212 WP_003400858.1.21218 WP_003400858.1.21219 WP_003400858.1.21231 WP_003400858.1.21234 WP_003400858.1.2126 WP_003400858.1.2131 WP_003400858.1.21365 WP_003400858.1.21403 WP_003400858.1.21468 WP_003400858.1.21498 WP_003400858.1.21513 WP_003400858.1.21565 WP_003400858.1.21602 WP_003400858.1.21639 WP_003400858.1.21742 WP_003400858.1.21777 WP_003400858.1.21826 WP_003400858.1.21873 WP_003400858.1.2194 WP_003400858.1.21956 WP_003400858.1.21973 WP_003400858.1.21983 WP_003400858.1.22013 WP_003400858.1.22233 WP_003400858.1.22277 WP_003400858.1.22305 WP_003400858.1.22356 WP_003400858.1.22366 WP_003400858.1.22380 WP_003400858.1.22438 WP_003400858.1.22445 WP_003400858.1.22490 WP_003400858.1.2253 WP_003400858.1.22589 WP_003400858.1.22609 WP_003400858.1.22624 WP_003400858.1.22665 WP_003400858.1.22680 WP_003400858.1.22754 WP_003400858.1.22797 WP_003400858.1.22804 WP_003400858.1.22840 WP_003400858.1.22970 WP_003400858.1.22996 WP_003400858.1.2312 WP_003400858.1.23140 WP_003400858.1.23204 WP_003400858.1.23229 WP_003400858.1.2326 WP_003400858.1.23325 WP_003400858.1.2349 WP_003400858.1.23496 WP_003400858.1.23497 WP_003400858.1.23539 WP_003400858.1.23583 WP_003400858.1.23588 WP_003400858.1.23694 WP_003400858.1.2371 WP_003400858.1.23825 WP_003400858.1.23843 WP_003400858.1.2387 WP_003400858.1.2400 WP_003400858.1.24062 WP_003400858.1.24128 WP_003400858.1.24176 WP_003400858.1.24190 WP_003400858.1.24244 WP_003400858.1.24261 WP_003400858.1.24294 WP_003400858.1.24357 WP_003400858.1.24461 WP_003400858.1.24529 WP_003400858.1.24629 WP_003400858.1.24767 WP_003400858.1.24907 WP_003400858.1.24933 WP_003400858.1.24956 WP_003400858.1.25004 WP_003400858.1.2505 WP_003400858.1.25096 WP_003400858.1.25184 WP_003400858.1.25367 WP_003400858.1.25393 WP_003400858.1.25455 WP_003400858.1.2566 WP_003400858.1.25673 WP_003400858.1.25693 WP_003400858.1.25727 WP_003400858.1.25738 WP_003400858.1.2580 WP_003400858.1.25853 WP_003400858.1.2594 WP_003400858.1.25954 WP_003400858.1.25965 WP_003400858.1.26038 WP_003400858.1.26097 WP_003400858.1.26108 WP_003400858.1.26118 WP_003400858.1.2614 WP_003400858.1.26265 WP_003400858.1.26292 WP_003400858.1.26328 WP_003400858.1.26412 WP_003400858.1.26560 WP_003400858.1.2659 WP_003400858.1.26597 WP_003400858.1.26702 WP_003400858.1.26710 WP_003400858.1.26737 WP_003400858.1.26779 WP_003400858.1.26798 WP_003400858.1.26876 WP_003400858.1.26914 WP_003400858.1.26945 WP_003400858.1.26992 WP_003400858.1.27004 WP_003400858.1.27074 WP_003400858.1.27254 WP_003400858.1.27278 WP_003400858.1.27343 WP_003400858.1.2766 WP_003400858.1.277 WP_003400858.1.27750 WP_003400858.1.27795 WP_003400858.1.28092 WP_003400858.1.28131 WP_003400858.1.28161 WP_003400858.1.28367 WP_003400858.1.2842 WP_003400858.1.2847 WP_003400858.1.28473 WP_003400858.1.28493 WP_003400858.1.28497 WP_003400858.1.28530 WP_003400858.1.28545 WP_003400858.1.28561 WP_003400858.1.28567 WP_003400858.1.286 WP_003400858.1.28682 WP_003400858.1.28698 WP_003400858.1.28758 WP_003400858.1.28787 WP_003400858.1.28827 WP_003400858.1.28839 WP_003400858.1.28847 WP_003400858.1.28865 WP_003400858.1.28897 WP_003400858.1.28936 WP_003400858.1.28943 WP_003400858.1.2899 WP_003400858.1.29000 WP_003400858.1.29033 WP_003400858.1.29058 WP_003400858.1.29078 WP_003400858.1.29102 WP_003400858.1.29115 WP_003400858.1.2916 WP_003400858.1.29223 WP_003400858.1.29306 WP_003400858.1.29364 WP_003400858.1.2938 WP_003400858.1.2944 WP_003400858.1.2949 WP_003400858.1.29559 WP_003400858.1.29696 WP_003400858.1.29742 WP_003400858.1.29830 WP_003400858.1.29890 WP_003400858.1.29931 WP_003400858.1.30043 WP_003400858.1.30211 WP_003400858.1.30235 WP_003400858.1.30237 WP_003400858.1.30438 WP_003400858.1.3057 WP_003400858.1.30642 WP_003400858.1.30709 WP_003400858.1.30713 WP_003400858.1.30716 WP_003400858.1.30719 WP_003400858.1.30732 WP_003400858.1.30745 WP_003400858.1.30807 WP_003400858.1.30818 WP_003400858.1.30848 WP_003400858.1.30903 WP_003400858.1.30977 WP_003400858.1.31002 WP_003400858.1.31074 WP_003400858.1.31263 WP_003400858.1.31264 WP_003400858.1.31290 WP_003400858.1.31390 WP_003400858.1.31414 WP_003400858.1.31417 WP_003400858.1.3143 WP_003400858.1.31483 WP_003400858.1.3149 WP_003400858.1.31666 WP_003400858.1.31703 WP_003400858.1.31770 WP_003400858.1.3184 WP_003400858.1.31930 WP_003400858.1.31932 WP_003400858.1.31985 WP_003400858.1.32098 WP_003400858.1.32297 WP_003400858.1.32400 WP_003400858.1.32433 WP_003400858.1.32556 WP_003400858.1.32569 WP_003400858.1.32620 WP_003400858.1.3268 WP_003400858.1.32822 WP_003400858.1.32897 WP_003400858.1.32974 WP_003400858.1.33082 WP_003400858.1.3325 WP_003400858.1.3327 WP_003400858.1.33477 WP_003400858.1.33789 WP_003400858.1.33895 WP_003400858.1.3408 WP_003400858.1.34111 WP_003400858.1.34163 WP_003400858.1.34358 WP_003400858.1.34392 WP_003400858.1.34428 WP_003400858.1.34499 WP_003400858.1.34581 WP_003400858.1.34596 WP_003400858.1.34724 WP_003400858.1.34740 WP_003400858.1.34777 WP_003400858.1.34841 WP_003400858.1.34919 WP_003400858.1.34961 WP_003400858.1.34965 WP_003400858.1.35100 WP_003400858.1.35173 WP_003400858.1.35176 WP_003400858.1.35221 WP_003400858.1.35382 WP_003400858.1.35397 WP_003400858.1.35455 WP_003400858.1.3548 WP_003400858.1.35553 WP_003400858.1.35602 WP_003400858.1.35635 WP_003400858.1.35657 WP_003400858.1.35680 WP_003400858.1.35732 WP_003400858.1.35754 WP_003400858.1.35811 WP_003400858.1.35848 WP_003400858.1.35899 WP_003400858.1.35923 WP_003400858.1.3593 WP_003400858.1.35954 WP_003400858.1.36014 WP_003400858.1.36051 WP_003400858.1.36075 WP_003400858.1.36097 WP_003400858.1.36098 WP_003400858.1.36205 WP_003400858.1.36246 WP_003400858.1.36319 WP_003400858.1.36356 WP_003400858.1.36385 WP_003400858.1.36399 WP_003400858.1.36540 WP_003400858.1.36571 WP_003400858.1.36578 WP_003400858.1.36657 WP_003400858.1.36733 WP_003400858.1.36844 WP_003400858.1.36851 WP_003400858.1.36893 WP_003400858.1.36901 WP_003400858.1.3700 WP_003400858.1.37175 WP_003400858.1.37229 WP_003400858.1.37389 WP_003400858.1.37400 WP_003400858.1.37459 WP_003400858.1.37475 WP_003400858.1.37484 WP_003400858.1.37660 WP_003400858.1.37721 WP_003400858.1.37722 WP_003400858.1.37747 WP_003400858.1.37973 WP_003400858.1.37975 WP_003400858.1.38 WP_003400858.1.38068 WP_003400858.1.38135 WP_003400858.1.38158 WP_003400858.1.38233 WP_003400858.1.38332 WP_003400858.1.38398 WP_003400858.1.38421 WP_003400858.1.38466 WP_003400858.1.385 WP_003400858.1.38530 WP_003400858.1.38535 WP_003400858.1.38539 WP_003400858.1.38594 WP_003400858.1.38660 WP_003400858.1.38772 WP_003400858.1.38821 WP_003400858.1.38865 WP_003400858.1.3889 WP_003400858.1.38974 WP_003400858.1.38991 WP_003400858.1.39174 WP_003400858.1.39178 WP_003400858.1.39190 WP_003400858.1.39236 WP_003400858.1.39295 WP_003400858.1.39306 WP_003400858.1.3949 WP_003400858.1.39521 WP_003400858.1.39654 WP_003400858.1.39728 WP_003400858.1.39739 WP_003400858.1.39759 WP_003400858.1.39804 WP_003400858.1.39848 WP_003400858.1.3994 WP_003400858.1.39959 WP_003400858.1.39960 WP_003400858.1.3997 WP_003400858.1.40150 WP_003400858.1.40186 WP_003400858.1.40323 WP_003400858.1.40336 WP_003400858.1.40413 WP_003400858.1.40455 WP_003400858.1.40523 WP_003400858.1.40543 WP_003400858.1.40646 WP_003400858.1.40723 WP_003400858.1.40852 WP_003400858.1.40876 WP_003400858.1.41108 WP_003400858.1.41202 WP_003400858.1.41231 WP_003400858.1.41447 WP_003400858.1.41469 WP_003400858.1.41504 WP_003400858.1.41564 WP_003400858.1.41583 WP_003400858.1.41616 WP_003400858.1.41635 WP_003400858.1.41744 WP_003400858.1.41791 WP_003400858.1.41829 WP_003400858.1.42043 WP_003400858.1.42075 WP_003400858.1.42134 WP_003400858.1.42201 WP_003400858.1.42409 WP_003400858.1.42417 WP_003400858.1.42430 WP_003400858.1.42467 WP_003400858.1.4248 WP_003400858.1.42494 WP_003400858.1.42524 WP_003400858.1.42704 WP_003400858.1.42705 WP_003400858.1.42842 WP_003400858.1.42905 WP_003400858.1.43005 WP_003400858.1.43009 WP_003400858.1.43053 WP_003400858.1.43208 WP_003400858.1.43273 WP_003400858.1.43296 WP_003400858.1.43306 WP_003400858.1.43457 WP_003400858.1.43475 WP_003400858.1.4377 WP_003400858.1.43815 WP_003400858.1.43861 WP_003400858.1.43872 WP_003400858.1.43897 WP_003400858.1.4390 WP_003400858.1.43921 WP_003400858.1.43960 WP_003400858.1.44 WP_003400858.1.44001 WP_003400858.1.44016 WP_003400858.1.44033 WP_003400858.1.44037 WP_003400858.1.44076 WP_003400858.1.44169 WP_003400858.1.44277 WP_003400858.1.44279 WP_003400858.1.44355 WP_003400858.1.44464 WP_003400858.1.44519 WP_003400858.1.44532 WP_003400858.1.4464 WP_003400858.1.44651 WP_003400858.1.44659 WP_003400858.1.44665 WP_003400858.1.44694 WP_003400858.1.4476 WP_003400858.1.44767 WP_003400858.1.44776 WP_003400858.1.44779 WP_003400858.1.44913 WP_003400858.1.44981 WP_003400858.1.45002 WP_003400858.1.45081 WP_003400858.1.45129 WP_003400858.1.45211 WP_003400858.1.4526 WP_003400858.1.45374 WP_003400858.1.45407 WP_003400858.1.45451 WP_003400858.1.45463 WP_003400858.1.45474 WP_003400858.1.45510 WP_003400858.1.45619 WP_003400858.1.45626 WP_003400858.1.45697 WP_003400858.1.4571 WP_003400858.1.45805 WP_003400858.1.45963 WP_003400858.1.45989 WP_003400858.1.46083 WP_003400858.1.46100 WP_003400858.1.46103 WP_003400858.1.46129 WP_003400858.1.46141 WP_003400858.1.4624 WP_003400858.1.46313 WP_003400858.1.46336 WP_003400858.1.46411 WP_003400858.1.46463 WP_003400858.1.46568 WP_003400858.1.46613 WP_003400858.1.46625 WP_003400858.1.46642 WP_003400858.1.46647 WP_003400858.1.46674 WP_003400858.1.46724 WP_003400858.1.46758 WP_003400858.1.46777 WP_003400858.1.46792 WP_003400858.1.46897 WP_003400858.1.46980 WP_003400858.1.47066 WP_003400858.1.47077 WP_003400858.1.47083 WP_003400858.1.47179 WP_003400858.1.47194 WP_003400858.1.47537 WP_003400858.1.47540 WP_003400858.1.47636 WP_003400858.1.47679 WP_003400858.1.47690 WP_003400858.1.47805 WP_003400858.1.47832 WP_003400858.1.47899 WP_003400858.1.47912 WP_003400858.1.47926 WP_003400858.1.47959 WP_003400858.1.47974 WP_003400858.1.47993 WP_003400858.1.48109 WP_003400858.1.48130 WP_003400858.1.48143 WP_003400858.1.48155 WP_003400858.1.48170 WP_003400858.1.48185 WP_003400858.1.48204 WP_003400858.1.48256 WP_003400858.1.48264 WP_003400858.1.48287 WP_003400858.1.48443 WP_003400858.1.48462 WP_003400858.1.48658 WP_003400858.1.48666 WP_003400858.1.48687 WP_003400858.1.48779 WP_003400858.1.48831 WP_003400858.1.48857 WP_003400858.1.4890 WP_003400858.1.48946 WP_003400858.1.49059 WP_003400858.1.49110 WP_003400858.1.49111 WP_003400858.1.49112 WP_003400858.1.4919 WP_003400858.1.49291 WP_003400858.1.49335 WP_003400858.1.49437 WP_003400858.1.49506 WP_003400858.1.49516 WP_003400858.1.4959 WP_003400858.1.49678 WP_003400858.1.49687 WP_003400858.1.49699 WP_003400858.1.49736 WP_003400858.1.49796 WP_003400858.1.49990 WP_003400858.1.50068 WP_003400858.1.50077 WP_003400858.1.5008 WP_003400858.1.50126 WP_003400858.1.50265 WP_003400858.1.5048 WP_003400858.1.50601 WP_003400858.1.50632 WP_003400858.1.50642 WP_003400858.1.50655 WP_003400858.1.50756 WP_003400858.1.50784 WP_003400858.1.50860 WP_003400858.1.50868 WP_003400858.1.51003 WP_003400858.1.51037 WP_003400858.1.51074 WP_003400858.1.51239 WP_003400858.1.51294 WP_003400858.1.51455 WP_003400858.1.51466 WP_003400858.1.51788 WP_003400858.1.51795 WP_003400858.1.52006 WP_003400858.1.52082 WP_003400858.1.52102 WP_003400858.1.52106 WP_003400858.1.52178 WP_003400858.1.52206 WP_003400858.1.52390 WP_003400858.1.524 WP_003400858.1.52460 WP_003400858.1.52495 WP_003400858.1.52533 WP_003400858.1.52545 WP_003400858.1.52574 WP_003400858.1.52641 WP_003400858.1.52708 WP_003400858.1.52872 WP_003400858.1.52891 WP_003400858.1.52892 WP_003400858.1.53053 WP_003400858.1.5309 WP_003400858.1.531 WP_003400858.1.53143 WP_003400858.1.53157 WP_003400858.1.53204 WP_003400858.1.53217 WP_003400858.1.53229 WP_003400858.1.53254 WP_003400858.1.53257 WP_003400858.1.533 WP_003400858.1.53353 WP_003400858.1.53480 WP_003400858.1.53517 WP_003400858.1.53606 WP_003400858.1.53730 WP_003400858.1.53775 WP_003400858.1.53803 WP_003400858.1.53822 WP_003400858.1.53888 WP_003400858.1.53900 WP_003400858.1.54125 WP_003400858.1.54162 WP_003400858.1.54179 WP_003400858.1.54245 WP_003400858.1.54347 WP_003400858.1.54351 WP_003400858.1.54502 WP_003400858.1.54531 WP_003400858.1.54537 WP_003400858.1.54553 WP_003400858.1.54633 WP_003400858.1.54705 WP_003400858.1.54732 WP_003400858.1.54836 WP_003400858.1.54888 WP_003400858.1.54905 WP_003400858.1.54909 WP_003400858.1.54937 WP_003400858.1.54953 WP_003400858.1.54964 WP_003400858.1.55023 WP_003400858.1.55128 WP_003400858.1.55210 WP_003400858.1.55227 WP_003400858.1.55257 WP_003400858.1.55307 WP_003400858.1.55328 WP_003400858.1.55504 WP_003400858.1.55578 WP_003400858.1.55626 WP_003400858.1.55723 WP_003400858.1.5574 WP_003400858.1.55807 WP_003400858.1.55819 WP_003400858.1.55860 WP_003400858.1.55909 WP_003400858.1.56178 WP_003400858.1.56292 WP_003400858.1.56341 WP_003400858.1.56365 WP_003400858.1.56478 WP_003400858.1.56534 WP_003400858.1.56577 WP_003400858.1.567 WP_003400858.1.56701 WP_003400858.1.56709 WP_003400858.1.56729 WP_003400858.1.56743 WP_003400858.1.56863 WP_003400858.1.56926 WP_003400858.1.57023 WP_003400858.1.57134 WP_003400858.1.5724 WP_003400858.1.57314 WP_003400858.1.57326 WP_003400858.1.57331 WP_003400858.1.57340 WP_003400858.1.57352 WP_003400858.1.57440 WP_003400858.1.57489 WP_003400858.1.575 WP_003400858.1.57519 WP_003400858.1.5758 WP_003400858.1.57616 WP_003400858.1.57627 WP_003400858.1.57825 WP_003400858.1.57991 WP_003400858.1.58000 WP_003400858.1.58101 WP_003400858.1.58103 WP_003400858.1.5811 WP_003400858.1.58145 WP_003400858.1.58174 WP_003400858.1.58209 WP_003400858.1.58215 WP_003400858.1.58330 WP_003400858.1.58386 WP_003400858.1.58393 WP_003400858.1.5844 WP_003400858.1.58457 WP_003400858.1.58559 WP_003400858.1.58612 WP_003400858.1.58619 WP_003400858.1.58630 WP_003400858.1.58824 WP_003400858.1.58930 WP_003400858.1.58961 WP_003400858.1.59166 WP_003400858.1.59205 WP_003400858.1.59237 WP_003400858.1.59270 WP_003400858.1.59305 WP_003400858.1.59309 WP_003400858.1.59316 WP_003400858.1.59333 WP_003400858.1.59388 WP_003400858.1.59487 WP_003400858.1.59561 WP_003400858.1.59722 WP_003400858.1.59727 WP_003400858.1.59732 WP_003400858.1.59750 WP_003400858.1.59761 WP_003400858.1.59952 WP_003400858.1.59974 WP_003400858.1.6000 WP_003400858.1.60125 WP_003400858.1.60171 WP_003400858.1.60197 WP_003400858.1.6020 WP_003400858.1.60207 WP_003400858.1.60367 WP_003400858.1.60376 WP_003400858.1.60403 WP_003400858.1.60413 WP_003400858.1.60573 WP_003400858.1.60870 WP_003400858.1.60978 WP_003400858.1.61000 WP_003400858.1.61014 WP_003400858.1.61015 WP_003400858.1.61037 WP_003400858.1.61138 WP_003400858.1.612 WP_003400858.1.61256 WP_003400858.1.61314 WP_003400858.1.61321 WP_003400858.1.61328 WP_003400858.1.61391 WP_003400858.1.61552 WP_003400858.1.61665 WP_003400858.1.61669 WP_003400858.1.61719 WP_003400858.1.61778 WP_003400858.1.6179 WP_003400858.1.61793 WP_003400858.1.61862 WP_003400858.1.61865 WP_003400858.1.61925 WP_003400858.1.61987 WP_003400858.1.62132 WP_003400858.1.62230 WP_003400858.1.62238 WP_003400858.1.62360 WP_003400858.1.6248 WP_003400858.1.62594 WP_003400858.1.62606 WP_003400858.1.62666 WP_003400858.1.62730 WP_003400858.1.62766 WP_003400858.1.62841 WP_003400858.1.62936 WP_003400858.1.6314 WP_003400858.1.63144 WP_003400858.1.63160 WP_003400858.1.63161 WP_003400858.1.63166 WP_003400858.1.63194 WP_003400858.1.63247 WP_003400858.1.63312 WP_003400858.1.63331 WP_003400858.1.6345 WP_003400858.1.63483 WP_003400858.1.63530 WP_003400858.1.63538 WP_003400858.1.63600 WP_003400858.1.63623 WP_003400858.1.63624 WP_003400858.1.63625 WP_003400858.1.63734 WP_003400858.1.63913 WP_003400858.1.63970 WP_003400858.1.64058 WP_003400858.1.64065 WP_003400858.1.64169 WP_003400858.1.64223 WP_003400858.1.64249 WP_003400858.1.64287 WP_003400858.1.64480 WP_003400858.1.64511 WP_003400858.1.64514 WP_003400858.1.64619 WP_003400858.1.64629 WP_003400858.1.64776 WP_003400858.1.64832 WP_003400858.1.64922 WP_003400858.1.64966 WP_003400858.1.65289 WP_003400858.1.65291 WP_003400858.1.65315 WP_003400858.1.65359 WP_003400858.1.65414 WP_003400858.1.65416 WP_003400858.1.65529 WP_003400858.1.65539 WP_003400858.1.65612 WP_003400858.1.65733 WP_003400858.1.65746 WP_003400858.1.65759 WP_003400858.1.65869 WP_003400858.1.65893 WP_003400858.1.65932 WP_003400858.1.65958 WP_003400858.1.66013 WP_003400858.1.6606 WP_003400858.1.66151 WP_003400858.1.66334 WP_003400858.1.66367 WP_003400858.1.66396 WP_003400858.1.66451 WP_003400858.1.66457 WP_003400858.1.66460 WP_003400858.1.66504 WP_003400858.1.66544 WP_003400858.1.66582 WP_003400858.1.66615 WP_003400858.1.66617 WP_003400858.1.66762 WP_003400858.1.66776 WP_003400858.1.66830 WP_003400858.1.66842 WP_003400858.1.66893 WP_003400858.1.67044 WP_003400858.1.67170 WP_003400858.1.67197 WP_003400858.1.67207 WP_003400858.1.67324 WP_003400858.1.67453 WP_003400858.1.67499 WP_003400858.1.67587 WP_003400858.1.67630 WP_003400858.1.67750 WP_003400858.1.67816 WP_003400858.1.67844 WP_003400858.1.67945 WP_003400858.1.67949 WP_003400858.1.68037 WP_003400858.1.68045 WP_003400858.1.68106 WP_003400858.1.68110 WP_003400858.1.68153 WP_003400858.1.68164 WP_003400858.1.68329 WP_003400858.1.68444 WP_003400858.1.68484 WP_003400858.1.68624 WP_003400858.1.68684 WP_003400858.1.6872 WP_003400858.1.68997 WP_003400858.1.69008 WP_003400858.1.69181 WP_003400858.1.6935 WP_003400858.1.69369 WP_003400858.1.69398 WP_003400858.1.69401 WP_003400858.1.69528 WP_003400858.1.69581 WP_003400858.1.69736 WP_003400858.1.69778 WP_003400858.1.69845 WP_003400858.1.69925 WP_003400858.1.70 WP_003400858.1.70017 WP_003400858.1.70055 WP_003400858.1.70255 WP_003400858.1.70271 WP_003400858.1.70364 WP_003400858.1.70444 WP_003400858.1.70471 WP_003400858.1.70699 WP_003400858.1.70757 WP_003400858.1.70834 WP_003400858.1.7084 WP_003400858.1.71015 WP_003400858.1.71026 WP_003400858.1.71083 WP_003400858.1.71128 WP_003400858.1.7113 WP_003400858.1.71191 WP_003400858.1.71255 WP_003400858.1.71414 WP_003400858.1.7146 WP_003400858.1.71464 WP_003400858.1.71621 WP_003400858.1.71665 WP_003400858.1.71701 WP_003400858.1.71731 WP_003400858.1.71778 WP_003400858.1.71820 WP_003400858.1.7185 WP_003400858.1.71851 WP_003400858.1.72062 WP_003400858.1.72128 WP_003400858.1.7216 WP_003400858.1.72168 WP_003400858.1.72179 WP_003400858.1.72218 WP_003400858.1.72219 WP_003400858.1.72268 WP_003400858.1.72401 WP_003400858.1.72441 WP_003400858.1.72452 WP_003400858.1.72460 WP_003400858.1.72488 WP_003400858.1.72492 WP_003400858.1.72576 WP_003400858.1.7266 WP_003400858.1.72661 WP_003400858.1.72684 WP_003400858.1.72853 WP_003400858.1.72973 WP_003400858.1.7298 WP_003400858.1.73006 WP_003400858.1.73013 WP_003400858.1.73025 WP_003400858.1.73045 WP_003400858.1.73134 WP_003400858.1.73150 WP_003400858.1.73154 WP_003400858.1.73182 WP_003400858.1.7321 WP_003400858.1.73365 WP_003400858.1.73436 WP_003400858.1.73453 WP_003400858.1.73470 WP_003400858.1.73629 WP_003400858.1.7366 WP_003400858.1.73661 WP_003400858.1.7368 WP_003400858.1.74101 WP_003400858.1.74129 WP_003400858.1.74210 WP_003400858.1.74304 WP_003400858.1.7432 WP_003400858.1.74347 WP_003400858.1.74382 WP_003400858.1.74442 WP_003400858.1.74477 WP_003400858.1.74487 WP_003400858.1.74499 WP_003400858.1.74511 WP_003400858.1.74523 WP_003400858.1.74525 WP_003400858.1.74551 WP_003400858.1.74683 WP_003400858.1.7469 WP_003400858.1.74725 WP_003400858.1.74760 WP_003400858.1.74786 WP_003400858.1.74809 WP_003400858.1.7496 WP_003400858.1.75045 WP_003400858.1.75202 WP_003400858.1.75342 WP_003400858.1.75510 WP_003400858.1.75598 WP_003400858.1.75645 WP_003400858.1.75671 WP_003400858.1.75749 WP_003400858.1.75811 WP_003400858.1.75878 WP_003400858.1.75927 WP_003400858.1.75946 WP_003400858.1.76007 WP_003400858.1.76052 WP_003400858.1.76058 WP_003400858.1.76133 WP_003400858.1.76209 WP_003400858.1.76239 WP_003400858.1.76277 WP_003400858.1.76280 WP_003400858.1.76413 WP_003400858.1.76521 WP_003400858.1.76616 WP_003400858.1.76639 WP_003400858.1.76640 WP_003400858.1.76644 WP_003400858.1.76677 WP_003400858.1.76734 WP_003400858.1.76744 WP_003400858.1.76750 WP_003400858.1.76754 WP_003400858.1.76757 WP_003400858.1.76881 WP_003400858.1.76963 WP_003400858.1.77008 WP_003400858.1.77093 WP_003400858.1.77125 WP_003400858.1.77166 WP_003400858.1.77404 WP_003400858.1.77510 WP_003400858.1.77530 WP_003400858.1.77605 WP_003400858.1.7766 WP_003400858.1.77706 WP_003400858.1.77726 WP_003400858.1.77820 WP_003400858.1.77868 WP_003400858.1.77879 WP_003400858.1.77890 WP_003400858.1.77911 WP_003400858.1.78075 WP_003400858.1.78084 WP_003400858.1.78098 WP_003400858.1.78113 WP_003400858.1.78200 WP_003400858.1.78216 WP_003400858.1.78429 WP_003400858.1.78435 WP_003400858.1.78499 WP_003400858.1.785 WP_003400858.1.78526 WP_003400858.1.78538 WP_003400858.1.78544 WP_003400858.1.78547 WP_003400858.1.78646 WP_003400858.1.78649 WP_003400858.1.78793 WP_003400858.1.78848 WP_003400858.1.78932 WP_003400858.1.78969 WP_003400858.1.79005 WP_003400858.1.79016 WP_003400858.1.79066 WP_003400858.1.79095 WP_003400858.1.79122 WP_003400858.1.79198 WP_003400858.1.79213 WP_003400858.1.79273 WP_003400858.1.79330 WP_003400858.1.79339 WP_003400858.1.79399 WP_003400858.1.79445 WP_003400858.1.79471 WP_003400858.1.79502 WP_003400858.1.79508 WP_003400858.1.79514 WP_003400858.1.79561 WP_003400858.1.79578 WP_003400858.1.79598 WP_003400858.1.79615 WP_003400858.1.79684 WP_003400858.1.79863 WP_003400858.1.79885 WP_003400858.1.79898 WP_003400858.1.79900 WP_003400858.1.80022 WP_003400858.1.80030 WP_003400858.1.80129 WP_003400858.1.80177 WP_003400858.1.80234 WP_003400858.1.8029 WP_003400858.1.80304 WP_003400858.1.80326 WP_003400858.1.80351 WP_003400858.1.8037 WP_003400858.1.80399 WP_003400858.1.80507 WP_003400858.1.80743 WP_003400858.1.8093 WP_003400858.1.8105 WP_003400858.1.81063 WP_003400858.1.81119 WP_003400858.1.81125 WP_003400858.1.812 WP_003400858.1.81264 WP_003400858.1.81297 WP_003400858.1.8138 WP_003400858.1.8143 WP_003400858.1.81505 WP_003400858.1.81560 WP_003400858.1.81583 WP_003400858.1.81712 WP_003400858.1.81809 WP_003400858.1.81911 WP_003400858.1.81918 WP_003400858.1.82069 WP_003400858.1.82071 WP_003400858.1.82108 WP_003400858.1.82136 WP_003400858.1.82158 WP_003400858.1.8217 WP_003400858.1.82236 WP_003400858.1.82271 WP_003400858.1.82307 WP_003400858.1.82309 WP_003400858.1.82317 WP_003400858.1.82374 WP_003400858.1.82429 WP_003400858.1.82460 WP_003400858.1.82494 WP_003400858.1.82577 WP_003400858.1.82625 WP_003400858.1.82651 WP_003400858.1.82685 WP_003400858.1.8271 WP_003400858.1.82712 WP_003400858.1.82743 WP_003400858.1.82757 WP_003400858.1.82836 WP_003400858.1.82871 WP_003400858.1.82892 WP_003400858.1.82973 WP_003400858.1.83074 WP_003400858.1.83110 WP_003400858.1.8317 WP_003400858.1.83191 WP_003400858.1.83268 WP_003400858.1.83309 WP_003400858.1.83349 WP_003400858.1.8335 WP_003400858.1.83389 WP_003400858.1.83408 WP_003400858.1.83589 WP_003400858.1.83611 WP_003400858.1.83638 WP_003400858.1.83648 WP_003400858.1.83667 WP_003400858.1.83689 WP_003400858.1.83704 WP_003400858.1.83802 WP_003400858.1.83839 WP_003400858.1.83920 WP_003400858.1.83929 WP_003400858.1.83991 WP_003400858.1.8400 WP_003400858.1.84057 WP_003400858.1.84112 WP_003400858.1.84146 WP_003400858.1.84228 WP_003400858.1.8424 WP_003400858.1.84244 WP_003400858.1.84388 WP_003400858.1.84438 WP_003400858.1.84460 WP_003400858.1.84655 WP_003400858.1.84748 WP_003400858.1.84772 WP_003400858.1.848 WP_003400858.1.84911 WP_003400858.1.84985 WP_003400858.1.8503 WP_003400858.1.85043 WP_003400858.1.85284 WP_003400858.1.85341 WP_003400858.1.85399 WP_003400858.1.8546 WP_003400858.1.85464 WP_003400858.1.85478 WP_003400858.1.85480 WP_003400858.1.85488 WP_003400858.1.85551 WP_003400858.1.85577 WP_003400858.1.85648 WP_003400858.1.85704 WP_003400858.1.85808 WP_003400858.1.85832 WP_003400858.1.8586 WP_003400858.1.85913 WP_003400858.1.85953 WP_003400858.1.85986 WP_003400858.1.86000 WP_003400858.1.86024 WP_003400858.1.86025 WP_003400858.1.86032 WP_003400858.1.86048 WP_003400858.1.86052 WP_003400858.1.86122 WP_003400858.1.86124 WP_003400858.1.86249 WP_003400858.1.86368 WP_003400858.1.86499 WP_003400858.1.86561 WP_003400858.1.8666 WP_003400858.1.86801 WP_003400858.1.86820 WP_003400858.1.8685 WP_003400858.1.86851 WP_003400858.1.86855 WP_003400858.1.86867 WP_003400858.1.86892 WP_003400858.1.86941 WP_003400858.1.86963 WP_003400858.1.86979 WP_003400858.1.8700 WP_003400858.1.87001 WP_003400858.1.87116 WP_003400858.1.8714 WP_003400858.1.87162 WP_003400858.1.87240 WP_003400858.1.87275 WP_003400858.1.87369 WP_003400858.1.87401 WP_003400858.1.87404 WP_003400858.1.87406 WP_003400858.1.87409 WP_003400858.1.87494 WP_003400858.1.87617 WP_003400858.1.87634 WP_003400858.1.87658 WP_003400858.1.87684 WP_003400858.1.87707 WP_003400858.1.87732 WP_003400858.1.87809 WP_003400858.1.87827 WP_003400858.1.87831 WP_003400858.1.87835 WP_003400858.1.8789 WP_003400858.1.87955 WP_003400858.1.88039 WP_003400858.1.88191 WP_003400858.1.88205 WP_003400858.1.88219 WP_003400858.1.88315 WP_003400858.1.8840 WP_003400858.1.88521 WP_003400858.1.88537 WP_003400858.1.88616 WP_003400858.1.88625 WP_003400858.1.8870 WP_003400858.1.88756 WP_003400858.1.888 WP_003400858.1.88886 WP_003400858.1.88965 WP_003400858.1.89162 WP_003400858.1.8917 WP_003400858.1.89225 WP_003400858.1.89293 WP_003400858.1.8935 WP_003400858.1.8943 WP_003400858.1.89567 WP_003400858.1.89613 WP_003400858.1.89762 WP_003400858.1.89802 WP_003400858.1.8982 WP_003400858.1.89829 WP_003400858.1.89831 WP_003400858.1.8989 WP_003400858.1.89922 WP_003400858.1.89963 WP_003400858.1.8998 WP_003400858.1.90048 WP_003400858.1.90137 WP_003400858.1.90157 WP_003400858.1.90184 WP_003400858.1.90231 WP_003400858.1.90372 WP_003400858.1.9050 WP_003400858.1.90687 WP_003400858.1.90722 WP_003400858.1.90767 WP_003400858.1.90771 WP_003400858.1.90831 WP_003400858.1.9102 WP_003400858.1.91053 WP_003400858.1.91151 WP_003400858.1.91214 WP_003400858.1.91251 WP_003400858.1.91265 WP_003400858.1.9128 WP_003400858.1.91411 WP_003400858.1.91508 WP_003400858.1.91713 WP_003400858.1.91716 WP_003400858.1.91743 WP_003400858.1.91896 WP_003400858.1.91931 WP_003400858.1.91937 WP_003400858.1.91976 WP_003400858.1.92021 WP_003400858.1.92083 WP_003400858.1.92127 WP_003400858.1.92144 WP_003400858.1.92150 WP_003400858.1.92153 WP_003400858.1.92220 WP_003400858.1.92356 WP_003400858.1.92364 WP_003400858.1.92428 WP_003400858.1.92471 WP_003400858.1.92490 WP_003400858.1.9251 WP_003400858.1.92523 WP_003400858.1.92527 WP_003400858.1.92610 WP_003400858.1.92613 WP_003400858.1.9265 WP_003400858.1.92660 WP_003400858.1.92677 WP_003400858.1.92706 WP_003400858.1.92736 WP_003400858.1.9274 WP_003400858.1.92752 WP_003400858.1.92803 WP_003400858.1.92856 WP_003400858.1.92996 WP_003400858.1.93008 WP_003400858.1.93015 WP_003400858.1.93043 WP_003400858.1.93137 WP_003400858.1.93257 WP_003400858.1.93337 WP_003400858.1.93349 WP_003400858.1.93377 WP_003400858.1.9338 WP_003400858.1.93407 WP_003400858.1.93419 WP_003400858.1.93443 WP_003400858.1.93499 WP_003400858.1.93564 WP_003400858.1.9363 WP_003400858.1.93659 WP_003400858.1.93693 WP_003400858.1.93823 WP_003400858.1.93903 WP_003400858.1.93907 WP_003400858.1.94184 WP_003400858.1.94205 WP_003400858.1.94226 WP_003400858.1.94292 WP_003400858.1.94297 WP_003400858.1.94326 WP_003400858.1.94470 WP_003400858.1.94511 WP_003400858.1.94525 WP_003400858.1.946 WP_003400858.1.94629 WP_003400858.1.94673 WP_003400858.1.94736 WP_003400858.1.94776 WP_003400858.1.94852 WP_003400858.1.94979 WP_003400858.1.94994 WP_003400858.1.95010 WP_003400858.1.95015 WP_003400858.1.95034 WP_003400858.1.9514 WP_003400858.1.95179 WP_003400858.1.95344 WP_003400858.1.95454 WP_003400858.1.95455 WP_003400858.1.95497 WP_003400858.1.95727 WP_003400858.1.95758 WP_003400858.1.9590 WP_003400858.1.95908 WP_003400858.1.95973 WP_003400858.1.96062 WP_003400858.1.96182 WP_003400858.1.96204 WP_003400858.1.96235 WP_003400858.1.96286 WP_003400858.1.96456 WP_003400858.1.96560 WP_003400858.1.96569 WP_003400858.1.96573 WP_003400858.1.96575 WP_003400858.1.96733 WP_003400858.1.96742 WP_003400858.1.96832 WP_003400858.1.9685 WP_003400858.1.97056 WP_003400858.1.97099 WP_003400858.1.97108 WP_003400858.1.97127 WP_003400858.1.97129 WP_003400858.1.9716 WP_003400858.1.97176 WP_003400858.1.97222 WP_003400858.1.97325 WP_003400858.1.97330 WP_003400858.1.97366 WP_003400858.1.97540 WP_003400858.1.97550 WP_003400858.1.97577 WP_003400858.1.97584 WP_003400858.1.9759 WP_003400858.1.97596 WP_003400858.1.97797 WP_003400858.1.9782 WP_003400858.1.9790 WP_003400858.1.97977 WP_003400858.1.97979 WP_003400858.1.97995 WP_003400858.1.98034 WP_003400858.1.98071 WP_003400858.1.98113 WP_003400858.1.98128 WP_003400858.1.98213 WP_003400858.1.98225 WP_003400858.1.98350 WP_003400858.1.98395 WP_003400858.1.98441 WP_003400858.1.98566 WP_003400858.1.98590 WP_003400858.1.98629 WP_003400858.1.98645 WP_003400858.1.98649 WP_003400858.1.98906 WP_003400858.1.98935 WP_003400858.1.98953 WP_003400858.1.99037 WP_003400858.1.99062 WP_003400858.1.99211 WP_003400858.1.99251 WP_003400858.1.99269 WP_003400858.1.99316 WP_003400858.1.99368 WP_003400858.1.99379 WP_003400858.1.99404 WP_003400858.1.99460 WP_003400858.1.99575 WP_003400858.1.99578 WP_003400858.1.99605 WP_003400858.1.99672 WP_003400858.1.99701 WP_003400858.1.99798 WP_003400858.1.99832 WP_003400858.1.99886 WP_003400858.1.9993 WP_003400858.1.99982 gi|339630201|ref|YP_004721843.1| 233413.Mb0122c 410289.BCG_0152c 561275.JTY_0122 gi|121636031|ref|YP_976254.1| gi|479312964|ref|YP_007853016.1| gi|378769864|ref|YP_005169597.1| gi|31791296|ref|NP_853789.1| gi|506924514|ref|YP_008004964.1| gi|506924514|ref|YP_008004964.1| gi|224988504|ref|YP_002643191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]