SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378770600|ref|YP_005170333.1| from Mycobacterium bovis BCG str. Mexico

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378770600|ref|YP_005170333.1|
Domain Number 1 Region: 11-314
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.34e-57
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378770600|ref|YP_005170333.1|
Sequence length 334
Comment putative dehydrogenase [Mycobacterium bovis BCG str. Mexico]
Sequence
MTRTSEGLAAFVVDQLEELYRRMWVLRLLDMALEQLRIEGLINGPLQGGFGQEAVSVGAA
AALGEGDVIITTHRPHAQHVGTDAPLGPVIADMLGATAGDLEGADEDAHIADPRAGLPAA
IRVVKQSPLLAIGHAYALWLRDTGRVTLCVTQDCDVDADAFNEAADLAAVWQLPVVILVE
NIRGALSVHLGRYTHEPRVYRRAVAYGMPGVSVDGNDVEAVRDCVANAVVRARAGGGPTL
VQAITYRTTDFSGSDRGGYRDLAGSEQFLDPLIFARRRLIAAGTTRGRLDEQERAACQQV
ADAVAFAKARARPNGGGPISRPTSGWHQQPKTRF
Download sequence
Identical sequences A0A0D1PYJ1 A0A0H3MB90 A0A0K2HT96
gi|121636766|ref|YP_976989.1| WP_011799135.1.101146 WP_011799135.1.101996 WP_011799135.1.11587 WP_011799135.1.12187 WP_011799135.1.12801 WP_011799135.1.14658 WP_011799135.1.15345 WP_011799135.1.16973 WP_011799135.1.17039 WP_011799135.1.17314 WP_011799135.1.23140 WP_011799135.1.23497 WP_011799135.1.24062 WP_011799135.1.25965 WP_011799135.1.26265 WP_011799135.1.26412 WP_011799135.1.27254 WP_011799135.1.29559 WP_011799135.1.30669 WP_011799135.1.30732 WP_011799135.1.32822 WP_011799135.1.34111 WP_011799135.1.34358 WP_011799135.1.35680 WP_011799135.1.36657 WP_011799135.1.38135 WP_011799135.1.41583 WP_011799135.1.42201 WP_011799135.1.42417 WP_011799135.1.44016 WP_011799135.1.48109 WP_011799135.1.50868 WP_011799135.1.54502 WP_011799135.1.56729 WP_011799135.1.57616 WP_011799135.1.58000 WP_011799135.1.58101 WP_011799135.1.61256 WP_011799135.1.61778 WP_011799135.1.62360 WP_011799135.1.64966 WP_011799135.1.66013 WP_011799135.1.66460 WP_011799135.1.69181 WP_011799135.1.71621 WP_011799135.1.71820 WP_011799135.1.72218 WP_011799135.1.7266 WP_011799135.1.74477 WP_011799135.1.76976 WP_011799135.1.77093 WP_011799135.1.77166 WP_011799135.1.77879 WP_011799135.1.78429 WP_011799135.1.78544 WP_011799135.1.78848 WP_011799135.1.83268 WP_011799135.1.83704 WP_011799135.1.84911 WP_011799135.1.8943 WP_011799135.1.9128 WP_011799135.1.91411 WP_011799135.1.91508 WP_011799135.1.93008 WP_011799135.1.94184 WP_011799135.1.95908 WP_011799135.1.97330 WP_011799135.1.97568 WP_011799135.1.97596 WP_011799135.1.99037 WP_011799135.1.99269 gi|224989237|ref|YP_002643924.1| 410289.BCG_0895 561275.JTY_0865 gi|449062875|ref|YP_007429958.1| gi|378770600|ref|YP_005170333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]