SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378770610|ref|YP_005170343.1| from Mycobacterium bovis BCG str. Mexico

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378770610|ref|YP_005170343.1|
Domain Number 1 Region: 368-549
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.95e-47
Family Pyruvate oxidase and decarboxylase PP module 0.00000425
Further Details:      
 
Domain Number 2 Region: 14-193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.87e-40
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000137
Further Details:      
 
Domain Number 3 Region: 178-349
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.19e-21
Family Pyruvate oxidase and decarboxylase, middle domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378770610|ref|YP_005170343.1|
Sequence length 560
Comment putative pyruvate decarboxylase [Mycobacterium bovis BCG str. Mexico]
Sequence
MTPQKSDACSDPVYTVGDYLLDRLAELGVSEIFGVPGDYNLQFLDHIVAHPTIRWVGSAN
ELNAGYAADGYGRLRGMSAVVTTFGVGELSVTNAIAGSYAEHVPVVHIVGGPTKDAQGTR
RALHHSLGDGDFEHFLRISREITCAQANLMPATAGREIDRVLSEVREQKRPGYILLSSDV
ARFPTEPPAAPLPRYPGGTSPRALSLFTKAAIELIADHQLTVLADLLVHRLQAVKELEAL
LAADVVPHATLMWGKSLLDESSPNFLGIYAGAASAERVRAAIEGAPVLVTAGVVFTDMVS
GFFSQRIDPARTIDIGQYQSSVADQVFAPLEMSAALQALATILTGRGISSPPVVPPPAEP
PPAMPARDEPLTQQMVWDRVCSALTPGNVVLADQGTSFYGMADHRLPQGVTFIGQPLWGS
IGYTLPAAVGAAVAHPDRRTVLLIGDGAAQLTVQELGTFSREGLSPVIVVVNNDGYTVER
AIHGETAPYNDIVSWNWTELPSALGVTNHLAFRAQTYGQLDDALTVAAARRDRMVLVEVV
LPRLEIPRLLGQLVGSMAPQ
Download sequence
Identical sequences A0A045IMK1 A0A083WHL4 A0A0H3LAU1 A0A120IVW7 A0A197J3D5 A0A1S1B649 A1KGY5 A5U0P1 I6XWF2 P9WG37 Q7U140
gi|121636776|ref|YP_976999.1| gi|385990315|ref|YP_005908613.1| gi|471336716|ref|YP_007609429.1| gi|479313736|ref|YP_007853788.1| gi|375297358|ref|YP_005101625.1| gi|525673643|ref|YP_008224953.1| gi|494699242|ref|YP_007964724.1| gi|479054804|ref|YP_007350610.1| gi|392385563|ref|YP_005307192.1| gi|148822061|ref|YP_001286815.1| 233413.Mb0876c 336982.TBFG_10870 410289.BCG_0905c 419947.MRA_0861 478434.TBMG_03137 561275.JTY_0875 83332.Rv0853c gi|378770610|ref|YP_005170343.1| gi|449062886|ref|YP_007429969.1| gi|392433564|ref|YP_006474608.1| gi|15607993|ref|NP_215368.1| NP_215368.1.84033 WP_003900222.1.100000 WP_003900222.1.100021 WP_003900222.1.100069 WP_003900222.1.100087 WP_003900222.1.100208 WP_003900222.1.100216 WP_003900222.1.100255 WP_003900222.1.100260 WP_003900222.1.100270 WP_003900222.1.100279 WP_003900222.1.100286 WP_003900222.1.100308 WP_003900222.1.100309 WP_003900222.1.100318 WP_003900222.1.100337 WP_003900222.1.100338 WP_003900222.1.100383 WP_003900222.1.100395 WP_003900222.1.100396 WP_003900222.1.1004 WP_003900222.1.100401 WP_003900222.1.100460 WP_003900222.1.100552 WP_003900222.1.100581 WP_003900222.1.100600 WP_003900222.1.100625 WP_003900222.1.100666 WP_003900222.1.100671 WP_003900222.1.100682 WP_003900222.1.100697 WP_003900222.1.100703 WP_003900222.1.100716 WP_003900222.1.100722 WP_003900222.1.100754 WP_003900222.1.100757 WP_003900222.1.100772 WP_003900222.1.1008 WP_003900222.1.100812 WP_003900222.1.100866 WP_003900222.1.10088 WP_003900222.1.100889 WP_003900222.1.100910 WP_003900222.1.100915 WP_003900222.1.100918 WP_003900222.1.100935 WP_003900222.1.100984 WP_003900222.1.100998 WP_003900222.1.101025 WP_003900222.1.10104 WP_003900222.1.101048 WP_003900222.1.101075 WP_003900222.1.101143 WP_003900222.1.101146 WP_003900222.1.10116 WP_003900222.1.10117 WP_003900222.1.101209 WP_003900222.1.101323 WP_003900222.1.101324 WP_003900222.1.101350 WP_003900222.1.101403 WP_003900222.1.101421 WP_003900222.1.10144 WP_003900222.1.101442 WP_003900222.1.10145 WP_003900222.1.101452 WP_003900222.1.101456 WP_003900222.1.101481 WP_003900222.1.101493 WP_003900222.1.101496 WP_003900222.1.101525 WP_003900222.1.101533 WP_003900222.1.101535 WP_003900222.1.101553 WP_003900222.1.101558 WP_003900222.1.10156 WP_003900222.1.101573 WP_003900222.1.10159 WP_003900222.1.101592 WP_003900222.1.101604 WP_003900222.1.101607 WP_003900222.1.101671 WP_003900222.1.101687 WP_003900222.1.101698 WP_003900222.1.10170 WP_003900222.1.101713 WP_003900222.1.101722 WP_003900222.1.101733 WP_003900222.1.101743 WP_003900222.1.101764 WP_003900222.1.101795 WP_003900222.1.101797 WP_003900222.1.101798 WP_003900222.1.101802 WP_003900222.1.101826 WP_003900222.1.101858 WP_003900222.1.101859 WP_003900222.1.101888 WP_003900222.1.101894 WP_003900222.1.101899 WP_003900222.1.101923 WP_003900222.1.101925 WP_003900222.1.10193 WP_003900222.1.101996 WP_003900222.1.102 WP_003900222.1.102008 WP_003900222.1.102017 WP_003900222.1.102053 WP_003900222.1.102055 WP_003900222.1.102063 WP_003900222.1.102099 WP_003900222.1.1021 WP_003900222.1.10211 WP_003900222.1.102119 WP_003900222.1.102121 WP_003900222.1.102143 WP_003900222.1.10216 WP_003900222.1.10224 WP_003900222.1.10253 WP_003900222.1.10262 WP_003900222.1.10277 WP_003900222.1.1033 WP_003900222.1.10350 WP_003900222.1.10366 WP_003900222.1.10376 WP_003900222.1.10396 WP_003900222.1.10410 WP_003900222.1.10414 WP_003900222.1.10421 WP_003900222.1.10430 WP_003900222.1.1044 WP_003900222.1.10440 WP_003900222.1.10471 WP_003900222.1.10472 WP_003900222.1.105 WP_003900222.1.10518 WP_003900222.1.10545 WP_003900222.1.1057 WP_003900222.1.10594 WP_003900222.1.10606 WP_003900222.1.10615 WP_003900222.1.10635 WP_003900222.1.10643 WP_003900222.1.10648 WP_003900222.1.10709 WP_003900222.1.10735 WP_003900222.1.10740 WP_003900222.1.10756 WP_003900222.1.1078 WP_003900222.1.10791 WP_003900222.1.10799 WP_003900222.1.10825 WP_003900222.1.10848 WP_003900222.1.10863 WP_003900222.1.10879 WP_003900222.1.10912 WP_003900222.1.10927 WP_003900222.1.1095 WP_003900222.1.10956 WP_003900222.1.10962 WP_003900222.1.10980 WP_003900222.1.1100 WP_003900222.1.11040 WP_003900222.1.11061 WP_003900222.1.11070 WP_003900222.1.11141 WP_003900222.1.11171 WP_003900222.1.11175 WP_003900222.1.11176 WP_003900222.1.11222 WP_003900222.1.11236 WP_003900222.1.11329 WP_003900222.1.1133 WP_003900222.1.11342 WP_003900222.1.11373 WP_003900222.1.11376 WP_003900222.1.11390 WP_003900222.1.11402 WP_003900222.1.11481 WP_003900222.1.11487 WP_003900222.1.11489 WP_003900222.1.11491 WP_003900222.1.11587 WP_003900222.1.11589 WP_003900222.1.11596 WP_003900222.1.11610 WP_003900222.1.11697 WP_003900222.1.11707 WP_003900222.1.11752 WP_003900222.1.11761 WP_003900222.1.11775 WP_003900222.1.11822 WP_003900222.1.11826 WP_003900222.1.11856 WP_003900222.1.11898 WP_003900222.1.11906 WP_003900222.1.11939 WP_003900222.1.11960 WP_003900222.1.11961 WP_003900222.1.11972 WP_003900222.1.11984 WP_003900222.1.120 WP_003900222.1.12001 WP_003900222.1.12049 WP_003900222.1.12052 WP_003900222.1.12100 WP_003900222.1.12116 WP_003900222.1.12130 WP_003900222.1.12133 WP_003900222.1.12161 WP_003900222.1.12165 WP_003900222.1.12184 WP_003900222.1.12187 WP_003900222.1.12190 WP_003900222.1.12216 WP_003900222.1.12265 WP_003900222.1.12275 WP_003900222.1.12293 WP_003900222.1.12294 WP_003900222.1.123 WP_003900222.1.1231 WP_003900222.1.12314 WP_003900222.1.12338 WP_003900222.1.1236 WP_003900222.1.12371 WP_003900222.1.12372 WP_003900222.1.12389 WP_003900222.1.12406 WP_003900222.1.1241 WP_003900222.1.12421 WP_003900222.1.12424 WP_003900222.1.12464 WP_003900222.1.12479 WP_003900222.1.12519 WP_003900222.1.12523 WP_003900222.1.12526 WP_003900222.1.1255 WP_003900222.1.12550 WP_003900222.1.12669 WP_003900222.1.1267 WP_003900222.1.12672 WP_003900222.1.12692 WP_003900222.1.1271 WP_003900222.1.12710 WP_003900222.1.1279 WP_003900222.1.12794 WP_003900222.1.12801 WP_003900222.1.12804 WP_003900222.1.12821 WP_003900222.1.12841 WP_003900222.1.12871 WP_003900222.1.12901 WP_003900222.1.12941 WP_003900222.1.12947 WP_003900222.1.12957 WP_003900222.1.12972 WP_003900222.1.13028 WP_003900222.1.13043 WP_003900222.1.13087 WP_003900222.1.13090 WP_003900222.1.13096 WP_003900222.1.13175 WP_003900222.1.13183 WP_003900222.1.132 WP_003900222.1.13249 WP_003900222.1.13282 WP_003900222.1.13284 WP_003900222.1.13296 WP_003900222.1.13302 WP_003900222.1.13306 WP_003900222.1.13313 WP_003900222.1.13321 WP_003900222.1.13345 WP_003900222.1.13370 WP_003900222.1.1338 WP_003900222.1.13420 WP_003900222.1.13433 WP_003900222.1.13435 WP_003900222.1.13461 WP_003900222.1.13489 WP_003900222.1.13526 WP_003900222.1.13551 WP_003900222.1.13564 WP_003900222.1.13579 WP_003900222.1.13647 WP_003900222.1.13687 WP_003900222.1.13697 WP_003900222.1.13719 WP_003900222.1.13763 WP_003900222.1.13774 WP_003900222.1.13793 WP_003900222.1.13817 WP_003900222.1.13834 WP_003900222.1.13866 WP_003900222.1.13899 WP_003900222.1.13909 WP_003900222.1.13919 WP_003900222.1.13920 WP_003900222.1.13953 WP_003900222.1.13962 WP_003900222.1.1398 WP_003900222.1.13988 WP_003900222.1.14027 WP_003900222.1.14046 WP_003900222.1.14115 WP_003900222.1.1415 WP_003900222.1.14152 WP_003900222.1.14158 WP_003900222.1.14175 WP_003900222.1.14178 WP_003900222.1.14194 WP_003900222.1.14195 WP_003900222.1.14208 WP_003900222.1.14266 WP_003900222.1.14273 WP_003900222.1.14303 WP_003900222.1.14310 WP_003900222.1.14341 WP_003900222.1.14416 WP_003900222.1.14428 WP_003900222.1.14441 WP_003900222.1.14469 WP_003900222.1.14477 WP_003900222.1.14504 WP_003900222.1.14514 WP_003900222.1.1452 WP_003900222.1.14527 WP_003900222.1.1454 WP_003900222.1.14548 WP_003900222.1.14561 WP_003900222.1.14573 WP_003900222.1.1462 WP_003900222.1.14658 WP_003900222.1.14667 WP_003900222.1.14668 WP_003900222.1.14675 WP_003900222.1.14694 WP_003900222.1.14695 WP_003900222.1.14709 WP_003900222.1.14783 WP_003900222.1.14865 WP_003900222.1.14872 WP_003900222.1.14905 WP_003900222.1.14926 WP_003900222.1.14951 WP_003900222.1.14955 WP_003900222.1.15003 WP_003900222.1.15009 WP_003900222.1.15028 WP_003900222.1.15040 WP_003900222.1.15052 WP_003900222.1.15065 WP_003900222.1.15072 WP_003900222.1.15089 WP_003900222.1.1509 WP_003900222.1.15126 WP_003900222.1.15168 WP_003900222.1.15172 WP_003900222.1.15187 WP_003900222.1.15196 WP_003900222.1.15210 WP_003900222.1.15216 WP_003900222.1.15217 WP_003900222.1.1523 WP_003900222.1.15232 WP_003900222.1.15238 WP_003900222.1.15240 WP_003900222.1.15253 WP_003900222.1.15267 WP_003900222.1.1527 WP_003900222.1.15292 WP_003900222.1.15299 WP_003900222.1.15322 WP_003900222.1.1534 WP_003900222.1.15345 WP_003900222.1.15365 WP_003900222.1.15372 WP_003900222.1.15386 WP_003900222.1.15387 WP_003900222.1.15449 WP_003900222.1.15477 WP_003900222.1.15481 WP_003900222.1.15492 WP_003900222.1.15511 WP_003900222.1.15512 WP_003900222.1.15558 WP_003900222.1.15559 WP_003900222.1.15599 WP_003900222.1.15611 WP_003900222.1.15633 WP_003900222.1.15643 WP_003900222.1.15688 WP_003900222.1.15755 WP_003900222.1.15763 WP_003900222.1.15774 WP_003900222.1.15780 WP_003900222.1.15827 WP_003900222.1.15834 WP_003900222.1.15842 WP_003900222.1.15848 WP_003900222.1.15853 WP_003900222.1.15870 WP_003900222.1.15877 WP_003900222.1.15896 WP_003900222.1.15926 WP_003900222.1.15933 WP_003900222.1.15946 WP_003900222.1.15973 WP_003900222.1.15987 WP_003900222.1.15993 WP_003900222.1.16009 WP_003900222.1.16025 WP_003900222.1.16055 WP_003900222.1.16066 WP_003900222.1.16069 WP_003900222.1.16077 WP_003900222.1.16106 WP_003900222.1.16108 WP_003900222.1.16110 WP_003900222.1.16130 WP_003900222.1.16136 WP_003900222.1.16139 WP_003900222.1.16141 WP_003900222.1.16143 WP_003900222.1.1630 WP_003900222.1.16327 WP_003900222.1.16334 WP_003900222.1.16341 WP_003900222.1.16345 WP_003900222.1.16374 WP_003900222.1.16384 WP_003900222.1.16386 WP_003900222.1.164 WP_003900222.1.1642 WP_003900222.1.16421 WP_003900222.1.16426 WP_003900222.1.16431 WP_003900222.1.16438 WP_003900222.1.1644 WP_003900222.1.16442 WP_003900222.1.16448 WP_003900222.1.16451 WP_003900222.1.16476 WP_003900222.1.16480 WP_003900222.1.16494 WP_003900222.1.1652 WP_003900222.1.16549 WP_003900222.1.16560 WP_003900222.1.16598 WP_003900222.1.16619 WP_003900222.1.16620 WP_003900222.1.16622 WP_003900222.1.16637 WP_003900222.1.16707 WP_003900222.1.16724 WP_003900222.1.16731 WP_003900222.1.16743 WP_003900222.1.16837 WP_003900222.1.16852 WP_003900222.1.16940 WP_003900222.1.16950 WP_003900222.1.16959 WP_003900222.1.16968 WP_003900222.1.1697 WP_003900222.1.16973 WP_003900222.1.16977 WP_003900222.1.16987 WP_003900222.1.17005 WP_003900222.1.17006 WP_003900222.1.17015 WP_003900222.1.17019 WP_003900222.1.17039 WP_003900222.1.17041 WP_003900222.1.17052 WP_003900222.1.17057 WP_003900222.1.17062 WP_003900222.1.1707 WP_003900222.1.17094 WP_003900222.1.17147 WP_003900222.1.17167 WP_003900222.1.17224 WP_003900222.1.17251 WP_003900222.1.17288 WP_003900222.1.17314 WP_003900222.1.17345 WP_003900222.1.17412 WP_003900222.1.17440 WP_003900222.1.17466 WP_003900222.1.17477 WP_003900222.1.17483 WP_003900222.1.17505 WP_003900222.1.17527 WP_003900222.1.17535 WP_003900222.1.17540 WP_003900222.1.17553 WP_003900222.1.17558 WP_003900222.1.17599 WP_003900222.1.17655 WP_003900222.1.17679 WP_003900222.1.1768 WP_003900222.1.17687 WP_003900222.1.17700 WP_003900222.1.17710 WP_003900222.1.17713 WP_003900222.1.17788 WP_003900222.1.17798 WP_003900222.1.17803 WP_003900222.1.17821 WP_003900222.1.17830 WP_003900222.1.17878 WP_003900222.1.1792 WP_003900222.1.17923 WP_003900222.1.1795 WP_003900222.1.17955 WP_003900222.1.18013 WP_003900222.1.18033 WP_003900222.1.18057 WP_003900222.1.18065 WP_003900222.1.18070 WP_003900222.1.18116 WP_003900222.1.18120 WP_003900222.1.18126 WP_003900222.1.1817 WP_003900222.1.18206 WP_003900222.1.18240 WP_003900222.1.18306 WP_003900222.1.18364 WP_003900222.1.18399 WP_003900222.1.18411 WP_003900222.1.18444 WP_003900222.1.18448 WP_003900222.1.18467 WP_003900222.1.18476 WP_003900222.1.18522 WP_003900222.1.18580 WP_003900222.1.18582 WP_003900222.1.18601 WP_003900222.1.18639 WP_003900222.1.18647 WP_003900222.1.18710 WP_003900222.1.18751 WP_003900222.1.18781 WP_003900222.1.18793 WP_003900222.1.18804 WP_003900222.1.18816 WP_003900222.1.18823 WP_003900222.1.18827 WP_003900222.1.18838 WP_003900222.1.18849 WP_003900222.1.18856 WP_003900222.1.18945 WP_003900222.1.19056 WP_003900222.1.19063 WP_003900222.1.19066 WP_003900222.1.19085 WP_003900222.1.19094 WP_003900222.1.19144 WP_003900222.1.19193 WP_003900222.1.19231 WP_003900222.1.19243 WP_003900222.1.19264 WP_003900222.1.19295 WP_003900222.1.19307 WP_003900222.1.1933 WP_003900222.1.19364 WP_003900222.1.19382 WP_003900222.1.19400 WP_003900222.1.19426 WP_003900222.1.19429 WP_003900222.1.19464 WP_003900222.1.19480 WP_003900222.1.19512 WP_003900222.1.19553 WP_003900222.1.19562 WP_003900222.1.19568 WP_003900222.1.19572 WP_003900222.1.19595 WP_003900222.1.19596 WP_003900222.1.19694 WP_003900222.1.1970 WP_003900222.1.19707 WP_003900222.1.19742 WP_003900222.1.19785 WP_003900222.1.19820 WP_003900222.1.19868 WP_003900222.1.19900 WP_003900222.1.19922 WP_003900222.1.19936 WP_003900222.1.19946 WP_003900222.1.19960 WP_003900222.1.19964 WP_003900222.1.20007 WP_003900222.1.20016 WP_003900222.1.20028 WP_003900222.1.2003 WP_003900222.1.20037 WP_003900222.1.20039 WP_003900222.1.20082 WP_003900222.1.20085 WP_003900222.1.20097 WP_003900222.1.20116 WP_003900222.1.20130 WP_003900222.1.20140 WP_003900222.1.20141 WP_003900222.1.20142 WP_003900222.1.20239 WP_003900222.1.20243 WP_003900222.1.20259 WP_003900222.1.20262 WP_003900222.1.20268 WP_003900222.1.20272 WP_003900222.1.20273 WP_003900222.1.20280 WP_003900222.1.20294 WP_003900222.1.20300 WP_003900222.1.20309 WP_003900222.1.2037 WP_003900222.1.20372 WP_003900222.1.20381 WP_003900222.1.20427 WP_003900222.1.20432 WP_003900222.1.20457 WP_003900222.1.20459 WP_003900222.1.20460 WP_003900222.1.20542 WP_003900222.1.20578 WP_003900222.1.20608 WP_003900222.1.20624 WP_003900222.1.20707 WP_003900222.1.20722 WP_003900222.1.20729 WP_003900222.1.20742 WP_003900222.1.20751 WP_003900222.1.20776 WP_003900222.1.20843 WP_003900222.1.20850 WP_003900222.1.2086 WP_003900222.1.20868 WP_003900222.1.20876 WP_003900222.1.20897 WP_003900222.1.20898 WP_003900222.1.2090 WP_003900222.1.20916 WP_003900222.1.20921 WP_003900222.1.20926 WP_003900222.1.20927 WP_003900222.1.20951 WP_003900222.1.20970 WP_003900222.1.2104 WP_003900222.1.21127 WP_003900222.1.21135 WP_003900222.1.21173 WP_003900222.1.21187 WP_003900222.1.212 WP_003900222.1.21219 WP_003900222.1.2123 WP_003900222.1.21231 WP_003900222.1.21234 WP_003900222.1.2126 WP_003900222.1.21292 WP_003900222.1.21307 WP_003900222.1.2131 WP_003900222.1.21321 WP_003900222.1.21365 WP_003900222.1.2137 WP_003900222.1.21392 WP_003900222.1.21397 WP_003900222.1.21403 WP_003900222.1.21415 WP_003900222.1.21418 WP_003900222.1.21430 WP_003900222.1.21434 WP_003900222.1.21444 WP_003900222.1.21468 WP_003900222.1.21498 WP_003900222.1.21509 WP_003900222.1.21513 WP_003900222.1.21560 WP_003900222.1.21565 WP_003900222.1.21586 WP_003900222.1.21591 WP_003900222.1.21602 WP_003900222.1.21638 WP_003900222.1.21639 WP_003900222.1.21655 WP_003900222.1.21658 WP_003900222.1.2168 WP_003900222.1.2174 WP_003900222.1.21741 WP_003900222.1.21742 WP_003900222.1.21777 WP_003900222.1.21786 WP_003900222.1.21795 WP_003900222.1.218 WP_003900222.1.21826 WP_003900222.1.21829 WP_003900222.1.21840 WP_003900222.1.21843 WP_003900222.1.21872 WP_003900222.1.2188 WP_003900222.1.21882 WP_003900222.1.21906 WP_003900222.1.21912 WP_003900222.1.2194 WP_003900222.1.21941 WP_003900222.1.21956 WP_003900222.1.21958 WP_003900222.1.21960 WP_003900222.1.21971 WP_003900222.1.21973 WP_003900222.1.21983 WP_003900222.1.22003 WP_003900222.1.22013 WP_003900222.1.22025 WP_003900222.1.22036 WP_003900222.1.22075 WP_003900222.1.2212 WP_003900222.1.22140 WP_003900222.1.22233 WP_003900222.1.22277 WP_003900222.1.22305 WP_003900222.1.22348 WP_003900222.1.22356 WP_003900222.1.22366 WP_003900222.1.2238 WP_003900222.1.22437 WP_003900222.1.22438 WP_003900222.1.22445 WP_003900222.1.22490 WP_003900222.1.22511 WP_003900222.1.22524 WP_003900222.1.2253 WP_003900222.1.22585 WP_003900222.1.22589 WP_003900222.1.22606 WP_003900222.1.22608 WP_003900222.1.22609 WP_003900222.1.22618 WP_003900222.1.2262 WP_003900222.1.22624 WP_003900222.1.22629 WP_003900222.1.22647 WP_003900222.1.22664 WP_003900222.1.22665 WP_003900222.1.22670 WP_003900222.1.22674 WP_003900222.1.22680 WP_003900222.1.22725 WP_003900222.1.22728 WP_003900222.1.22733 WP_003900222.1.2275 WP_003900222.1.22754 WP_003900222.1.22800 WP_003900222.1.22804 WP_003900222.1.22844 WP_003900222.1.22963 WP_003900222.1.22970 WP_003900222.1.22996 WP_003900222.1.22997 WP_003900222.1.22999 WP_003900222.1.23015 WP_003900222.1.23032 WP_003900222.1.231 WP_003900222.1.23101 WP_003900222.1.2312 WP_003900222.1.23140 WP_003900222.1.23153 WP_003900222.1.23171 WP_003900222.1.23199 WP_003900222.1.2320 WP_003900222.1.23204 WP_003900222.1.23229 WP_003900222.1.23233 WP_003900222.1.2326 WP_003900222.1.23261 WP_003900222.1.2329 WP_003900222.1.23308 WP_003900222.1.23316 WP_003900222.1.23325 WP_003900222.1.2339 WP_003900222.1.23406 WP_003900222.1.23438 WP_003900222.1.23445 WP_003900222.1.23452 WP_003900222.1.2349 WP_003900222.1.23496 WP_003900222.1.23497 WP_003900222.1.23506 WP_003900222.1.23530 WP_003900222.1.23539 WP_003900222.1.23546 WP_003900222.1.23551 WP_003900222.1.23573 WP_003900222.1.23583 WP_003900222.1.23628 WP_003900222.1.23677 WP_003900222.1.23683 WP_003900222.1.23692 WP_003900222.1.23694 WP_003900222.1.23699 WP_003900222.1.2371 WP_003900222.1.23803 WP_003900222.1.23807 WP_003900222.1.23825 WP_003900222.1.23832 WP_003900222.1.2384 WP_003900222.1.23843 WP_003900222.1.23863 WP_003900222.1.23894 WP_003900222.1.23993 WP_003900222.1.2400 WP_003900222.1.24007 WP_003900222.1.24008 WP_003900222.1.24046 WP_003900222.1.24057 WP_003900222.1.24062 WP_003900222.1.24113 WP_003900222.1.24119 WP_003900222.1.24128 WP_003900222.1.24140 WP_003900222.1.24176 WP_003900222.1.24190 WP_003900222.1.24202 WP_003900222.1.24244 WP_003900222.1.24261 WP_003900222.1.24294 WP_003900222.1.24357 WP_003900222.1.24396 WP_003900222.1.24414 WP_003900222.1.2443 WP_003900222.1.24446 WP_003900222.1.24461 WP_003900222.1.24500 WP_003900222.1.24509 WP_003900222.1.24529 WP_003900222.1.24553 WP_003900222.1.24599 WP_003900222.1.24629 WP_003900222.1.24638 WP_003900222.1.2466 WP_003900222.1.24767 WP_003900222.1.24824 WP_003900222.1.24831 WP_003900222.1.24848 WP_003900222.1.24857 WP_003900222.1.24893 WP_003900222.1.24907 WP_003900222.1.24933 WP_003900222.1.24956 WP_003900222.1.24958 WP_003900222.1.2499 WP_003900222.1.2505 WP_003900222.1.25051 WP_003900222.1.2507 WP_003900222.1.25129 WP_003900222.1.25184 WP_003900222.1.25247 WP_003900222.1.25252 WP_003900222.1.25278 WP_003900222.1.25283 WP_003900222.1.25309 WP_003900222.1.25313 WP_003900222.1.25338 WP_003900222.1.25342 WP_003900222.1.25343 WP_003900222.1.25367 WP_003900222.1.25393 WP_003900222.1.25435 WP_003900222.1.25437 WP_003900222.1.25445 WP_003900222.1.25455 WP_003900222.1.25473 WP_003900222.1.25542 WP_003900222.1.25579 WP_003900222.1.25606 WP_003900222.1.25645 WP_003900222.1.2566 WP_003900222.1.25673 WP_003900222.1.25674 WP_003900222.1.25736 WP_003900222.1.25738 WP_003900222.1.25756 WP_003900222.1.25759 WP_003900222.1.25813 WP_003900222.1.25853 WP_003900222.1.25854 WP_003900222.1.25874 WP_003900222.1.25885 WP_003900222.1.25892 WP_003900222.1.25906 WP_003900222.1.25914 WP_003900222.1.25916 WP_003900222.1.2594 WP_003900222.1.25965 WP_003900222.1.25972 WP_003900222.1.26017 WP_003900222.1.26032 WP_003900222.1.26038 WP_003900222.1.26072 WP_003900222.1.26089 WP_003900222.1.26098 WP_003900222.1.26109 WP_003900222.1.26118 WP_003900222.1.26126 WP_003900222.1.26168 WP_003900222.1.26182 WP_003900222.1.26190 WP_003900222.1.2620 WP_003900222.1.26234 WP_003900222.1.26265 WP_003900222.1.26267 WP_003900222.1.26292 WP_003900222.1.26310 WP_003900222.1.26328 WP_003900222.1.26349 WP_003900222.1.26374 WP_003900222.1.26407 WP_003900222.1.26412 WP_003900222.1.26464 WP_003900222.1.26571 WP_003900222.1.2659 WP_003900222.1.26597 WP_003900222.1.26629 WP_003900222.1.26702 WP_003900222.1.26707 WP_003900222.1.26710 WP_003900222.1.26737 WP_003900222.1.26738 WP_003900222.1.26745 WP_003900222.1.26756 WP_003900222.1.2677 WP_003900222.1.26779 WP_003900222.1.26780 WP_003900222.1.26798 WP_003900222.1.26854 WP_003900222.1.26868 WP_003900222.1.26876 WP_003900222.1.26945 WP_003900222.1.26959 WP_003900222.1.26984 WP_003900222.1.26992 WP_003900222.1.27004 WP_003900222.1.27017 WP_003900222.1.27045 WP_003900222.1.27074 WP_003900222.1.27075 WP_003900222.1.27128 WP_003900222.1.27130 WP_003900222.1.27139 WP_003900222.1.27152 WP_003900222.1.27162 WP_003900222.1.27164 WP_003900222.1.27193 WP_003900222.1.27235 WP_003900222.1.27254 WP_003900222.1.27278 WP_003900222.1.27343 WP_003900222.1.27352 WP_003900222.1.27369 WP_003900222.1.27391 WP_003900222.1.27398 WP_003900222.1.27410 WP_003900222.1.27411 WP_003900222.1.27449 WP_003900222.1.27460 WP_003900222.1.27463 WP_003900222.1.2749 WP_003900222.1.27492 WP_003900222.1.27528 WP_003900222.1.27541 WP_003900222.1.27576 WP_003900222.1.27582 WP_003900222.1.27596 WP_003900222.1.27607 WP_003900222.1.277 WP_003900222.1.27724 WP_003900222.1.27730 WP_003900222.1.27736 WP_003900222.1.27743 WP_003900222.1.27750 WP_003900222.1.27771 WP_003900222.1.27779 WP_003900222.1.27795 WP_003900222.1.27803 WP_003900222.1.27915 WP_003900222.1.27935 WP_003900222.1.28053 WP_003900222.1.28092 WP_003900222.1.28106 WP_003900222.1.28131 WP_003900222.1.28142 WP_003900222.1.28159 WP_003900222.1.2816 WP_003900222.1.28161 WP_003900222.1.28192 WP_003900222.1.28202 WP_003900222.1.28241 WP_003900222.1.28242 WP_003900222.1.28269 WP_003900222.1.28293 WP_003900222.1.28331 WP_003900222.1.28367 WP_003900222.1.28391 WP_003900222.1.2842 WP_003900222.1.28448 WP_003900222.1.28473 WP_003900222.1.28493 WP_003900222.1.28497 WP_003900222.1.28530 WP_003900222.1.28545 WP_003900222.1.28561 WP_003900222.1.28567 WP_003900222.1.28585 WP_003900222.1.286 WP_003900222.1.28610 WP_003900222.1.28617 WP_003900222.1.28634 WP_003900222.1.28642 WP_003900222.1.28671 WP_003900222.1.28682 WP_003900222.1.28698 WP_003900222.1.28703 WP_003900222.1.28739 WP_003900222.1.28758 WP_003900222.1.28781 WP_003900222.1.28787 WP_003900222.1.28827 WP_003900222.1.28839 WP_003900222.1.28847 WP_003900222.1.28850 WP_003900222.1.28851 WP_003900222.1.28865 WP_003900222.1.28897 WP_003900222.1.28914 WP_003900222.1.28935 WP_003900222.1.28939 WP_003900222.1.28943 WP_003900222.1.28952 WP_003900222.1.28975 WP_003900222.1.28993 WP_003900222.1.29028 WP_003900222.1.29033 WP_003900222.1.29058 WP_003900222.1.29078 WP_003900222.1.29102 WP_003900222.1.29115 WP_003900222.1.2916 WP_003900222.1.29217 WP_003900222.1.29223 WP_003900222.1.29234 WP_003900222.1.29264 WP_003900222.1.29275 WP_003900222.1.29306 WP_003900222.1.29339 WP_003900222.1.29364 WP_003900222.1.29367 WP_003900222.1.29399 WP_003900222.1.29426 WP_003900222.1.2944 WP_003900222.1.29449 WP_003900222.1.29450 WP_003900222.1.29452 WP_003900222.1.2949 WP_003900222.1.29525 WP_003900222.1.2953 WP_003900222.1.29559 WP_003900222.1.29587 WP_003900222.1.2959 WP_003900222.1.29592 WP_003900222.1.29611 WP_003900222.1.29649 WP_003900222.1.2965 WP_003900222.1.29659 WP_003900222.1.2969 WP_003900222.1.29698 WP_003900222.1.29742 WP_003900222.1.29745 WP_003900222.1.29747 WP_003900222.1.29769 WP_003900222.1.29825 WP_003900222.1.29830 WP_003900222.1.29861 WP_003900222.1.29869 WP_003900222.1.29883 WP_003900222.1.29890 WP_003900222.1.29931 WP_003900222.1.30014 WP_003900222.1.3004 WP_003900222.1.30074 WP_003900222.1.30097 WP_003900222.1.30101 WP_003900222.1.30106 WP_003900222.1.30114 WP_003900222.1.30126 WP_003900222.1.30131 WP_003900222.1.30138 WP_003900222.1.30139 WP_003900222.1.30145 WP_003900222.1.30211 WP_003900222.1.30224 WP_003900222.1.30235 WP_003900222.1.30237 WP_003900222.1.3027 WP_003900222.1.30279 WP_003900222.1.30282 WP_003900222.1.30283 WP_003900222.1.30288 WP_003900222.1.30291 WP_003900222.1.30363 WP_003900222.1.30374 WP_003900222.1.30404 WP_003900222.1.3043 WP_003900222.1.30438 WP_003900222.1.30462 WP_003900222.1.30464 WP_003900222.1.30468 WP_003900222.1.30500 WP_003900222.1.3057 WP_003900222.1.30574 WP_003900222.1.30628 WP_003900222.1.30641 WP_003900222.1.30642 WP_003900222.1.30661 WP_003900222.1.30669 WP_003900222.1.30683 WP_003900222.1.30699 WP_003900222.1.30709 WP_003900222.1.30713 WP_003900222.1.30716 WP_003900222.1.30719 WP_003900222.1.30732 WP_003900222.1.30736 WP_003900222.1.30791 WP_003900222.1.308 WP_003900222.1.30807 WP_003900222.1.30818 WP_003900222.1.30824 WP_003900222.1.30877 WP_003900222.1.30888 WP_003900222.1.30901 WP_003900222.1.30912 WP_003900222.1.30913 WP_003900222.1.30914 WP_003900222.1.30919 WP_003900222.1.30977 WP_003900222.1.3100 WP_003900222.1.31002 WP_003900222.1.3101 WP_003900222.1.31034 WP_003900222.1.31047 WP_003900222.1.31074 WP_003900222.1.31127 WP_003900222.1.31184 WP_003900222.1.31199 WP_003900222.1.31230 WP_003900222.1.31233 WP_003900222.1.31263 WP_003900222.1.31264 WP_003900222.1.31287 WP_003900222.1.31346 WP_003900222.1.31354 WP_003900222.1.31390 WP_003900222.1.31414 WP_003900222.1.31417 WP_003900222.1.31428 WP_003900222.1.3143 WP_003900222.1.31458 WP_003900222.1.31483 WP_003900222.1.3149 WP_003900222.1.31498 WP_003900222.1.31507 WP_003900222.1.31548 WP_003900222.1.31569 WP_003900222.1.316 WP_003900222.1.31629 WP_003900222.1.31666 WP_003900222.1.31693 WP_003900222.1.31703 WP_003900222.1.31745 WP_003900222.1.31770 WP_003900222.1.31776 WP_003900222.1.31783 WP_003900222.1.318 WP_003900222.1.31840 WP_003900222.1.31930 WP_003900222.1.31932 WP_003900222.1.31985 WP_003900222.1.31991 WP_003900222.1.31995 WP_003900222.1.32004 WP_003900222.1.3204 WP_003900222.1.32045 WP_003900222.1.32071 WP_003900222.1.32098 WP_003900222.1.32132 WP_003900222.1.32164 WP_003900222.1.32179 WP_003900222.1.32198 WP_003900222.1.32297 WP_003900222.1.32403 WP_003900222.1.32416 WP_003900222.1.32433 WP_003900222.1.32461 WP_003900222.1.32482 WP_003900222.1.32503 WP_003900222.1.32556 WP_003900222.1.32562 WP_003900222.1.32569 WP_003900222.1.32592 WP_003900222.1.32620 WP_003900222.1.32647 WP_003900222.1.32653 WP_003900222.1.32654 WP_003900222.1.32695 WP_003900222.1.32706 WP_003900222.1.32716 WP_003900222.1.32738 WP_003900222.1.32752 WP_003900222.1.32780 WP_003900222.1.32781 WP_003900222.1.32793 WP_003900222.1.32799 WP_003900222.1.32822 WP_003900222.1.32833 WP_003900222.1.32880 WP_003900222.1.32909 WP_003900222.1.32935 WP_003900222.1.32974 WP_003900222.1.3302 WP_003900222.1.33028 WP_003900222.1.33035 WP_003900222.1.33044 WP_003900222.1.33054 WP_003900222.1.33148 WP_003900222.1.33155 WP_003900222.1.33168 WP_003900222.1.3321 WP_003900222.1.33215 WP_003900222.1.3325 WP_003900222.1.3327 WP_003900222.1.33278 WP_003900222.1.33288 WP_003900222.1.33305 WP_003900222.1.3331 WP_003900222.1.33319 WP_003900222.1.3333 WP_003900222.1.33393 WP_003900222.1.33403 WP_003900222.1.33452 WP_003900222.1.33467 WP_003900222.1.33477 WP_003900222.1.3349 WP_003900222.1.33601 WP_003900222.1.33602 WP_003900222.1.33633 WP_003900222.1.33646 WP_003900222.1.33673 WP_003900222.1.3369 WP_003900222.1.33705 WP_003900222.1.33762 WP_003900222.1.33832 WP_003900222.1.33839 WP_003900222.1.33848 WP_003900222.1.33886 WP_003900222.1.33895 WP_003900222.1.33906 WP_003900222.1.33912 WP_003900222.1.33954 WP_003900222.1.3399 WP_003900222.1.3405 WP_003900222.1.34055 WP_003900222.1.34056 WP_003900222.1.34065 WP_003900222.1.34109 WP_003900222.1.34111 WP_003900222.1.34131 WP_003900222.1.34152 WP_003900222.1.34153 WP_003900222.1.34181 WP_003900222.1.34197 WP_003900222.1.34215 WP_003900222.1.34219 WP_003900222.1.34255 WP_003900222.1.34260 WP_003900222.1.34275 WP_003900222.1.343 WP_003900222.1.34347 WP_003900222.1.34358 WP_003900222.1.34392 WP_003900222.1.344 WP_003900222.1.34428 WP_003900222.1.3443 WP_003900222.1.34499 WP_003900222.1.34505 WP_003900222.1.34529 WP_003900222.1.34551 WP_003900222.1.34563 WP_003900222.1.34581 WP_003900222.1.34588 WP_003900222.1.34596 WP_003900222.1.34639 WP_003900222.1.34673 WP_003900222.1.34724 WP_003900222.1.34740 WP_003900222.1.34755 WP_003900222.1.34777 WP_003900222.1.34783 WP_003900222.1.34841 WP_003900222.1.34919 WP_003900222.1.3492 WP_003900222.1.34933 WP_003900222.1.34945 WP_003900222.1.34946 WP_003900222.1.34954 WP_003900222.1.34960 WP_003900222.1.34961 WP_003900222.1.34963 WP_003900222.1.34965 WP_003900222.1.34968 WP_003900222.1.35023 WP_003900222.1.35072 WP_003900222.1.35078 WP_003900222.1.35100 WP_003900222.1.35146 WP_003900222.1.35156 WP_003900222.1.35160 WP_003900222.1.35162 WP_003900222.1.35173 WP_003900222.1.35176 WP_003900222.1.35213 WP_003900222.1.35221 WP_003900222.1.35246 WP_003900222.1.35278 WP_003900222.1.35301 WP_003900222.1.35311 WP_003900222.1.35312 WP_003900222.1.35317 WP_003900222.1.35319 WP_003900222.1.35347 WP_003900222.1.35363 WP_003900222.1.35382 WP_003900222.1.35385 WP_003900222.1.35426 WP_003900222.1.3548 WP_003900222.1.35484 WP_003900222.1.35492 WP_003900222.1.3553 WP_003900222.1.35553 WP_003900222.1.35561 WP_003900222.1.35602 WP_003900222.1.35610 WP_003900222.1.35635 WP_003900222.1.35687 WP_003900222.1.35707 WP_003900222.1.35732 WP_003900222.1.35754 WP_003900222.1.35767 WP_003900222.1.35770 WP_003900222.1.35771 WP_003900222.1.35780 WP_003900222.1.35805 WP_003900222.1.35811 WP_003900222.1.35821 WP_003900222.1.3584 WP_003900222.1.35848 WP_003900222.1.35864 WP_003900222.1.35874 WP_003900222.1.35876 WP_003900222.1.35897 WP_003900222.1.35899 WP_003900222.1.35923 WP_003900222.1.3593 WP_003900222.1.35954 WP_003900222.1.36014 WP_003900222.1.36023 WP_003900222.1.36075 WP_003900222.1.36089 WP_003900222.1.36097 WP_003900222.1.36098 WP_003900222.1.36116 WP_003900222.1.36145 WP_003900222.1.36156 WP_003900222.1.36205 WP_003900222.1.36246 WP_003900222.1.36252 WP_003900222.1.36260 WP_003900222.1.36270 WP_003900222.1.36303 WP_003900222.1.36309 WP_003900222.1.36315 WP_003900222.1.36319 WP_003900222.1.36326 WP_003900222.1.3634 WP_003900222.1.36356 WP_003900222.1.36357 WP_003900222.1.3636 WP_003900222.1.36385 WP_003900222.1.36399 WP_003900222.1.36436 WP_003900222.1.36465 WP_003900222.1.36469 WP_003900222.1.36485 WP_003900222.1.36508 WP_003900222.1.36540 WP_003900222.1.36561 WP_003900222.1.36571 WP_003900222.1.36573 WP_003900222.1.36578 WP_003900222.1.36585 WP_003900222.1.36597 WP_003900222.1.36614 WP_003900222.1.36657 WP_003900222.1.36674 WP_003900222.1.36720 WP_003900222.1.36727 WP_003900222.1.36733 WP_003900222.1.36785 WP_003900222.1.36810 WP_003900222.1.36844 WP_003900222.1.36851 WP_003900222.1.36893 WP_003900222.1.36921 WP_003900222.1.36935 WP_003900222.1.36941 WP_003900222.1.3695 WP_003900222.1.36951 WP_003900222.1.36968 WP_003900222.1.37004 WP_003900222.1.37012 WP_003900222.1.37088 WP_003900222.1.37131 WP_003900222.1.37157 WP_003900222.1.37175 WP_003900222.1.37188 WP_003900222.1.37213 WP_003900222.1.37229 WP_003900222.1.3724 WP_003900222.1.37277 WP_003900222.1.37305 WP_003900222.1.37330 WP_003900222.1.37389 WP_003900222.1.37400 WP_003900222.1.37440 WP_003900222.1.37459 WP_003900222.1.37468 WP_003900222.1.37475 WP_003900222.1.37484 WP_003900222.1.37601 WP_003900222.1.37612 WP_003900222.1.37632 WP_003900222.1.37643 WP_003900222.1.37655 WP_003900222.1.37660 WP_003900222.1.37674 WP_003900222.1.37700 WP_003900222.1.37701 WP_003900222.1.37709 WP_003900222.1.37711 WP_003900222.1.37721 WP_003900222.1.37722 WP_003900222.1.37765 WP_003900222.1.37772 WP_003900222.1.37804 WP_003900222.1.37809 WP_003900222.1.37859 WP_003900222.1.37877 WP_003900222.1.37912 WP_003900222.1.37913 WP_003900222.1.37950 WP_003900222.1.37973 WP_003900222.1.37975 WP_003900222.1.37983 WP_003900222.1.38 WP_003900222.1.38002 WP_003900222.1.3802 WP_003900222.1.38039 WP_003900222.1.38040 WP_003900222.1.38067 WP_003900222.1.38068 WP_003900222.1.38135 WP_003900222.1.38138 WP_003900222.1.38144 WP_003900222.1.38158 WP_003900222.1.38299 WP_003900222.1.38332 WP_003900222.1.38347 WP_003900222.1.38354 WP_003900222.1.38380 WP_003900222.1.38384 WP_003900222.1.38389 WP_003900222.1.38402 WP_003900222.1.38421 WP_003900222.1.38466 WP_003900222.1.38483 WP_003900222.1.385 WP_003900222.1.38530 WP_003900222.1.38535 WP_003900222.1.38539 WP_003900222.1.38594 WP_003900222.1.38611 WP_003900222.1.38638 WP_003900222.1.38639 WP_003900222.1.38646 WP_003900222.1.38648 WP_003900222.1.38659 WP_003900222.1.38660 WP_003900222.1.38671 WP_003900222.1.38672 WP_003900222.1.38677 WP_003900222.1.38750 WP_003900222.1.38772 WP_003900222.1.38812 WP_003900222.1.38821 WP_003900222.1.38844 WP_003900222.1.38863 WP_003900222.1.38865 WP_003900222.1.38873 WP_003900222.1.3889 WP_003900222.1.38894 WP_003900222.1.38909 WP_003900222.1.38975 WP_003900222.1.38991 WP_003900222.1.39025 WP_003900222.1.39070 WP_003900222.1.39176 WP_003900222.1.39190 WP_003900222.1.39207 WP_003900222.1.39211 WP_003900222.1.39236 WP_003900222.1.39239 WP_003900222.1.39295 WP_003900222.1.39306 WP_003900222.1.39359 WP_003900222.1.39364 WP_003900222.1.39447 WP_003900222.1.3945 WP_003900222.1.39455 WP_003900222.1.3949 WP_003900222.1.39521 WP_003900222.1.39560 WP_003900222.1.39592 WP_003900222.1.39593 WP_003900222.1.396 WP_003900222.1.3960 WP_003900222.1.39616 WP_003900222.1.39654 WP_003900222.1.39657 WP_003900222.1.39661 WP_003900222.1.39674 WP_003900222.1.39678 WP_003900222.1.3971 WP_003900222.1.39728 WP_003900222.1.39739 WP_003900222.1.39748 WP_003900222.1.39751 WP_003900222.1.39759 WP_003900222.1.39801 WP_003900222.1.39804 WP_003900222.1.39848 WP_003900222.1.39877 WP_003900222.1.39925 WP_003900222.1.3994 WP_003900222.1.39959 WP_003900222.1.39960 WP_003900222.1.3997 WP_003900222.1.39980 WP_003900222.1.40000 WP_003900222.1.40028 WP_003900222.1.40029 WP_003900222.1.40096 WP_003900222.1.40150 WP_003900222.1.40156 WP_003900222.1.40174 WP_003900222.1.40186 WP_003900222.1.40276 WP_003900222.1.40277 WP_003900222.1.40323 WP_003900222.1.40336 WP_003900222.1.40353 WP_003900222.1.4036 WP_003900222.1.40402 WP_003900222.1.40413 WP_003900222.1.40446 WP_003900222.1.40451 WP_003900222.1.40455 WP_003900222.1.40523 WP_003900222.1.40543 WP_003900222.1.40641 WP_003900222.1.40646 WP_003900222.1.40651 WP_003900222.1.40653 WP_003900222.1.40705 WP_003900222.1.40723 WP_003900222.1.40735 WP_003900222.1.40852 WP_003900222.1.40876 WP_003900222.1.40881 WP_003900222.1.40922 WP_003900222.1.40948 WP_003900222.1.4095 WP_003900222.1.40956 WP_003900222.1.40957 WP_003900222.1.40964 WP_003900222.1.4097 WP_003900222.1.41000 WP_003900222.1.41055 WP_003900222.1.41123 WP_003900222.1.41177 WP_003900222.1.41202 WP_003900222.1.41219 WP_003900222.1.41231 WP_003900222.1.41249 WP_003900222.1.41296 WP_003900222.1.41355 WP_003900222.1.41376 WP_003900222.1.41430 WP_003900222.1.41447 WP_003900222.1.41469 WP_003900222.1.41504 WP_003900222.1.41564 WP_003900222.1.41583 WP_003900222.1.41616 WP_003900222.1.41632 WP_003900222.1.41635 WP_003900222.1.41636 WP_003900222.1.41648 WP_003900222.1.41660 WP_003900222.1.41685 WP_003900222.1.41695 WP_003900222.1.41704 WP_003900222.1.41719 WP_003900222.1.41733 WP_003900222.1.41744 WP_003900222.1.41774 WP_003900222.1.41791 WP_003900222.1.41803 WP_003900222.1.41820 WP_003900222.1.41828 WP_003900222.1.41829 WP_003900222.1.41860 WP_003900222.1.41912 WP_003900222.1.41921 WP_003900222.1.41933 WP_003900222.1.42043 WP_003900222.1.42075 WP_003900222.1.42078 WP_003900222.1.42094 WP_003900222.1.42112 WP_003900222.1.4212 WP_003900222.1.42122 WP_003900222.1.42134 WP_003900222.1.42183 WP_003900222.1.42188 WP_003900222.1.42201 WP_003900222.1.42202 WP_003900222.1.42247 WP_003900222.1.42255 WP_003900222.1.42278 WP_003900222.1.42304 WP_003900222.1.42309 WP_003900222.1.42370 WP_003900222.1.42385 WP_003900222.1.42400 WP_003900222.1.42414 WP_003900222.1.42417 WP_003900222.1.42430 WP_003900222.1.42465 WP_003900222.1.42467 WP_003900222.1.42473 WP_003900222.1.42494 WP_003900222.1.42519 WP_003900222.1.42524 WP_003900222.1.42534 WP_003900222.1.42562 WP_003900222.1.42568 WP_003900222.1.42570 WP_003900222.1.42618 WP_003900222.1.42660 WP_003900222.1.42695 WP_003900222.1.42704 WP_003900222.1.42705 WP_003900222.1.42722 WP_003900222.1.42777 WP_003900222.1.42782 WP_003900222.1.42839 WP_003900222.1.42842 WP_003900222.1.42905 WP_003900222.1.42916 WP_003900222.1.42930 WP_003900222.1.42971 WP_003900222.1.43005 WP_003900222.1.43009 WP_003900222.1.43053 WP_003900222.1.43082 WP_003900222.1.43087 WP_003900222.1.43098 WP_003900222.1.43208 WP_003900222.1.43236 WP_003900222.1.43246 WP_003900222.1.43266 WP_003900222.1.43273 WP_003900222.1.43296 WP_003900222.1.43368 WP_003900222.1.43395 WP_003900222.1.43475 WP_003900222.1.43478 WP_003900222.1.43484 WP_003900222.1.43557 WP_003900222.1.43578 WP_003900222.1.43588 WP_003900222.1.43643 WP_003900222.1.43664 WP_003900222.1.43684 WP_003900222.1.43686 WP_003900222.1.43706 WP_003900222.1.43716 WP_003900222.1.4377 WP_003900222.1.43781 WP_003900222.1.43794 WP_003900222.1.43815 WP_003900222.1.43846 WP_003900222.1.43861 WP_003900222.1.43863 WP_003900222.1.43866 WP_003900222.1.43872 WP_003900222.1.43885 WP_003900222.1.43897 WP_003900222.1.4390 WP_003900222.1.43902 WP_003900222.1.43921 WP_003900222.1.43936 WP_003900222.1.43937 WP_003900222.1.43960 WP_003900222.1.4399 WP_003900222.1.43996 WP_003900222.1.44 WP_003900222.1.44001 WP_003900222.1.44008 WP_003900222.1.44016 WP_003900222.1.44033 WP_003900222.1.44041 WP_003900222.1.44070 WP_003900222.1.44071 WP_003900222.1.44076 WP_003900222.1.44111 WP_003900222.1.44124 WP_003900222.1.44169 WP_003900222.1.44219 WP_003900222.1.44237 WP_003900222.1.44277 WP_003900222.1.44279 WP_003900222.1.44336 WP_003900222.1.44355 WP_003900222.1.4438 WP_003900222.1.44392 WP_003900222.1.4441 WP_003900222.1.44415 WP_003900222.1.44464 WP_003900222.1.44466 WP_003900222.1.44492 WP_003900222.1.44494 WP_003900222.1.44500 WP_003900222.1.44519 WP_003900222.1.44526 WP_003900222.1.44532 WP_003900222.1.44534 WP_003900222.1.44562 WP_003900222.1.44589 WP_003900222.1.44597 WP_003900222.1.44600 WP_003900222.1.44602 WP_003900222.1.44615 WP_003900222.1.4464 WP_003900222.1.44651 WP_003900222.1.44659 WP_003900222.1.44665 WP_003900222.1.44694 WP_003900222.1.44700 WP_003900222.1.44735 WP_003900222.1.44740 WP_003900222.1.44757 WP_003900222.1.4476 WP_003900222.1.44767 WP_003900222.1.44776 WP_003900222.1.44779 WP_003900222.1.44786 WP_003900222.1.44864 WP_003900222.1.44901 WP_003900222.1.44913 WP_003900222.1.4492 WP_003900222.1.44939 WP_003900222.1.44979 WP_003900222.1.44981 WP_003900222.1.45002 WP_003900222.1.4504 WP_003900222.1.45066 WP_003900222.1.45081 WP_003900222.1.45113 WP_003900222.1.45129 WP_003900222.1.45135 WP_003900222.1.45147 WP_003900222.1.45168 WP_003900222.1.4517 WP_003900222.1.45185 WP_003900222.1.45192 WP_003900222.1.45200 WP_003900222.1.45205 WP_003900222.1.45211 WP_003900222.1.45249 WP_003900222.1.4526 WP_003900222.1.45286 WP_003900222.1.45326 WP_003900222.1.45347 WP_003900222.1.45374 WP_003900222.1.45390 WP_003900222.1.454 WP_003900222.1.45407 WP_003900222.1.45451 WP_003900222.1.45453 WP_003900222.1.45460 WP_003900222.1.45463 WP_003900222.1.45470 WP_003900222.1.45474 WP_003900222.1.45491 WP_003900222.1.45563 WP_003900222.1.45584 WP_003900222.1.45619 WP_003900222.1.45626 WP_003900222.1.45631 WP_003900222.1.45697 WP_003900222.1.4571 WP_003900222.1.45765 WP_003900222.1.45783 WP_003900222.1.45805 WP_003900222.1.45815 WP_003900222.1.45849 WP_003900222.1.45884 WP_003900222.1.4590 WP_003900222.1.45923 WP_003900222.1.45963 WP_003900222.1.45992 WP_003900222.1.46025 WP_003900222.1.46083 WP_003900222.1.46090 WP_003900222.1.46092 WP_003900222.1.46101 WP_003900222.1.46107 WP_003900222.1.46128 WP_003900222.1.46129 WP_003900222.1.46141 WP_003900222.1.46150 WP_003900222.1.46201 WP_003900222.1.46226 WP_003900222.1.46253 WP_003900222.1.46285 WP_003900222.1.46300 WP_003900222.1.46336 WP_003900222.1.46365 WP_003900222.1.46370 WP_003900222.1.46381 WP_003900222.1.46402 WP_003900222.1.46411 WP_003900222.1.4644 WP_003900222.1.46442 WP_003900222.1.46463 WP_003900222.1.46478 WP_003900222.1.46492 WP_003900222.1.4653 WP_003900222.1.46532 WP_003900222.1.46539 WP_003900222.1.46568 WP_003900222.1.46585 WP_003900222.1.46609 WP_003900222.1.46613 WP_003900222.1.46625 WP_003900222.1.46642 WP_003900222.1.46647 WP_003900222.1.46674 WP_003900222.1.46773 WP_003900222.1.46786 WP_003900222.1.46792 WP_003900222.1.46847 WP_003900222.1.46851 WP_003900222.1.4687 WP_003900222.1.46897 WP_003900222.1.46980 WP_003900222.1.47011 WP_003900222.1.47012 WP_003900222.1.47066 WP_003900222.1.47106 WP_003900222.1.47142 WP_003900222.1.47166 WP_003900222.1.47207 WP_003900222.1.47210 WP_003900222.1.47261 WP_003900222.1.47262 WP_003900222.1.47402 WP_003900222.1.47423 WP_003900222.1.47467 WP_003900222.1.47502 WP_003900222.1.4751 WP_003900222.1.47511 WP_003900222.1.47540 WP_003900222.1.47568 WP_003900222.1.47572 WP_003900222.1.47636 WP_003900222.1.4764 WP_003900222.1.47653 WP_003900222.1.47679 WP_003900222.1.47690 WP_003900222.1.47717 WP_003900222.1.47743 WP_003900222.1.47754 WP_003900222.1.47776 WP_003900222.1.47780 WP_003900222.1.47805 WP_003900222.1.47832 WP_003900222.1.47847 WP_003900222.1.47861 WP_003900222.1.47868 WP_003900222.1.47893 WP_003900222.1.47899 WP_003900222.1.479 WP_003900222.1.47912 WP_003900222.1.47913 WP_003900222.1.47926 WP_003900222.1.4794 WP_003900222.1.47943 WP_003900222.1.47959 WP_003900222.1.47974 WP_003900222.1.47993 WP_003900222.1.48004 WP_003900222.1.48039 WP_003900222.1.48050 WP_003900222.1.48097 WP_003900222.1.48101 WP_003900222.1.48143 WP_003900222.1.48152 WP_003900222.1.48155 WP_003900222.1.48170 WP_003900222.1.48173 WP_003900222.1.48177 WP_003900222.1.48185 WP_003900222.1.48219 WP_003900222.1.4823 WP_003900222.1.48240 WP_003900222.1.48256 WP_003900222.1.48264 WP_003900222.1.48287 WP_003900222.1.48330 WP_003900222.1.48333 WP_003900222.1.48348 WP_003900222.1.48354 WP_003900222.1.48372 WP_003900222.1.48383 WP_003900222.1.48388 WP_003900222.1.48419 WP_003900222.1.48423 WP_003900222.1.48443 WP_003900222.1.48450 WP_003900222.1.48543 WP_003900222.1.48648 WP_003900222.1.48658 WP_003900222.1.48666 WP_003900222.1.48687 WP_003900222.1.48779 WP_003900222.1.4878 WP_003900222.1.48798 WP_003900222.1.48826 WP_003900222.1.48843 WP_003900222.1.48857 WP_003900222.1.4890 WP_003900222.1.48946 WP_003900222.1.48979 WP_003900222.1.49017 WP_003900222.1.49048 WP_003900222.1.4906 WP_003900222.1.49103 WP_003900222.1.49110 WP_003900222.1.49111 WP_003900222.1.4919 WP_003900222.1.49251 WP_003900222.1.49254 WP_003900222.1.49263 WP_003900222.1.49291 WP_003900222.1.49296 WP_003900222.1.49335 WP_003900222.1.49337 WP_003900222.1.49419 WP_003900222.1.49437 WP_003900222.1.49439 WP_003900222.1.49506 WP_003900222.1.49523 WP_003900222.1.49526 WP_003900222.1.49532 WP_003900222.1.49588 WP_003900222.1.4959 WP_003900222.1.49687 WP_003900222.1.49699 WP_003900222.1.49709 WP_003900222.1.4971 WP_003900222.1.4972 WP_003900222.1.49746 WP_003900222.1.49764 WP_003900222.1.49773 WP_003900222.1.49796 WP_003900222.1.49814 WP_003900222.1.49815 WP_003900222.1.49816 WP_003900222.1.49839 WP_003900222.1.49857 WP_003900222.1.49878 WP_003900222.1.49880 WP_003900222.1.49944 WP_003900222.1.4999 WP_003900222.1.50068 WP_003900222.1.5008 WP_003900222.1.50081 WP_003900222.1.50126 WP_003900222.1.50149 WP_003900222.1.50162 WP_003900222.1.5018 WP_003900222.1.50218 WP_003900222.1.50235 WP_003900222.1.50249 WP_003900222.1.50265 WP_003900222.1.50271 WP_003900222.1.50324 WP_003900222.1.50347 WP_003900222.1.50372 WP_003900222.1.50398 WP_003900222.1.50407 WP_003900222.1.50444 WP_003900222.1.50466 WP_003900222.1.5048 WP_003900222.1.5050 WP_003900222.1.50540 WP_003900222.1.50554 WP_003900222.1.50557 WP_003900222.1.50632 WP_003900222.1.50633 WP_003900222.1.50642 WP_003900222.1.50655 WP_003900222.1.50683 WP_003900222.1.50692 WP_003900222.1.50714 WP_003900222.1.50729 WP_003900222.1.50756 WP_003900222.1.50784 WP_003900222.1.50794 WP_003900222.1.50841 WP_003900222.1.50860 WP_003900222.1.50868 WP_003900222.1.50877 WP_003900222.1.50981 WP_003900222.1.50987 WP_003900222.1.51009 WP_003900222.1.51037 WP_003900222.1.51074 WP_003900222.1.51082 WP_003900222.1.51116 WP_003900222.1.51149 WP_003900222.1.51157 WP_003900222.1.51213 WP_003900222.1.51232 WP_003900222.1.51247 WP_003900222.1.51266 WP_003900222.1.51279 WP_003900222.1.51291 WP_003900222.1.51301 WP_003900222.1.51391 WP_003900222.1.51422 WP_003900222.1.51445 WP_003900222.1.51455 WP_003900222.1.51466 WP_003900222.1.51478 WP_003900222.1.51497 WP_003900222.1.51520 WP_003900222.1.51593 WP_003900222.1.51628 WP_003900222.1.5164 WP_003900222.1.51647 WP_003900222.1.51660 WP_003900222.1.51696 WP_003900222.1.51721 WP_003900222.1.51788 WP_003900222.1.51795 WP_003900222.1.51801 WP_003900222.1.51819 WP_003900222.1.51854 WP_003900222.1.51923 WP_003900222.1.51942 WP_003900222.1.51948 WP_003900222.1.51963 WP_003900222.1.51969 WP_003900222.1.52000 WP_003900222.1.52003 WP_003900222.1.52006 WP_003900222.1.52036 WP_003900222.1.52038 WP_003900222.1.52046 WP_003900222.1.52059 WP_003900222.1.52069 WP_003900222.1.52082 WP_003900222.1.52102 WP_003900222.1.52106 WP_003900222.1.52166 WP_003900222.1.52168 WP_003900222.1.52178 WP_003900222.1.52206 WP_003900222.1.52216 WP_003900222.1.52238 WP_003900222.1.52241 WP_003900222.1.52280 WP_003900222.1.52314 WP_003900222.1.52385 WP_003900222.1.52390 WP_003900222.1.524 WP_003900222.1.52460 WP_003900222.1.52485 WP_003900222.1.52486 WP_003900222.1.52495 WP_003900222.1.52504 WP_003900222.1.52522 WP_003900222.1.52533 WP_003900222.1.52545 WP_003900222.1.52553 WP_003900222.1.52563 WP_003900222.1.52564 WP_003900222.1.52574 WP_003900222.1.52641 WP_003900222.1.52673 WP_003900222.1.52674 WP_003900222.1.52708 WP_003900222.1.52713 WP_003900222.1.52761 WP_003900222.1.52778 WP_003900222.1.52791 WP_003900222.1.52797 WP_003900222.1.52872 WP_003900222.1.52891 WP_003900222.1.52892 WP_003900222.1.52970 WP_003900222.1.53053 WP_003900222.1.53056 WP_003900222.1.5309 WP_003900222.1.531 WP_003900222.1.53117 WP_003900222.1.53118 WP_003900222.1.53142 WP_003900222.1.53143 WP_003900222.1.53157 WP_003900222.1.53167 WP_003900222.1.53200 WP_003900222.1.53204 WP_003900222.1.53213 WP_003900222.1.53217 WP_003900222.1.53226 WP_003900222.1.53229 WP_003900222.1.53230 WP_003900222.1.53237 WP_003900222.1.53254 WP_003900222.1.53257 WP_003900222.1.5327 WP_003900222.1.53276 WP_003900222.1.53278 WP_003900222.1.53302 WP_003900222.1.53306 WP_003900222.1.5334 WP_003900222.1.5335 WP_003900222.1.53353 WP_003900222.1.53381 WP_003900222.1.53413 WP_003900222.1.53458 WP_003900222.1.53460 WP_003900222.1.53480 WP_003900222.1.53517 WP_003900222.1.53522 WP_003900222.1.53525 WP_003900222.1.53526 WP_003900222.1.53553 WP_003900222.1.53606 WP_003900222.1.53609 WP_003900222.1.53628 WP_003900222.1.53643 WP_003900222.1.53667 WP_003900222.1.53679 WP_003900222.1.53715 WP_003900222.1.53730 WP_003900222.1.53742 WP_003900222.1.53743 WP_003900222.1.53754 WP_003900222.1.53775 WP_003900222.1.53803 WP_003900222.1.53818 WP_003900222.1.53822 WP_003900222.1.53865 WP_003900222.1.53888 WP_003900222.1.53912 WP_003900222.1.53914 WP_003900222.1.53952 WP_003900222.1.5398 WP_003900222.1.54089 WP_003900222.1.54093 WP_003900222.1.54112 WP_003900222.1.54125 WP_003900222.1.54141 WP_003900222.1.54162 WP_003900222.1.54179 WP_003900222.1.54218 WP_003900222.1.54227 WP_003900222.1.54232 WP_003900222.1.54241 WP_003900222.1.54247 WP_003900222.1.54260 WP_003900222.1.54275 WP_003900222.1.54280 WP_003900222.1.54294 WP_003900222.1.54314 WP_003900222.1.54347 WP_003900222.1.54351 WP_003900222.1.54428 WP_003900222.1.54449 WP_003900222.1.54494 WP_003900222.1.54502 WP_003900222.1.54514 WP_003900222.1.54519 WP_003900222.1.5452 WP_003900222.1.54531 WP_003900222.1.54537 WP_003900222.1.54553 WP_003900222.1.54555 WP_003900222.1.54575 WP_003900222.1.54633 WP_003900222.1.54686 WP_003900222.1.54687 WP_003900222.1.54705 WP_003900222.1.54730 WP_003900222.1.54732 WP_003900222.1.5475 WP_003900222.1.54807 WP_003900222.1.54836 WP_003900222.1.54838 WP_003900222.1.54860 WP_003900222.1.54888 WP_003900222.1.54897 WP_003900222.1.54905 WP_003900222.1.54909 WP_003900222.1.54937 WP_003900222.1.54939 WP_003900222.1.54944 WP_003900222.1.54945 WP_003900222.1.54953 WP_003900222.1.54964 WP_003900222.1.55015 WP_003900222.1.55022 WP_003900222.1.55023 WP_003900222.1.55051 WP_003900222.1.55088 WP_003900222.1.55106 WP_003900222.1.55126 WP_003900222.1.55128 WP_003900222.1.55140 WP_003900222.1.55150 WP_003900222.1.55210 WP_003900222.1.55227 WP_003900222.1.55248 WP_003900222.1.55257 WP_003900222.1.55267 WP_003900222.1.55279 WP_003900222.1.55307 WP_003900222.1.55326 WP_003900222.1.55328 WP_003900222.1.5533 WP_003900222.1.55345 WP_003900222.1.55459 WP_003900222.1.55501 WP_003900222.1.55504 WP_003900222.1.55578 WP_003900222.1.55626 WP_003900222.1.55641 WP_003900222.1.5569 WP_003900222.1.55723 WP_003900222.1.55735 WP_003900222.1.5574 WP_003900222.1.55772 WP_003900222.1.55802 WP_003900222.1.55819 WP_003900222.1.55821 WP_003900222.1.55849 WP_003900222.1.55856 WP_003900222.1.55882 WP_003900222.1.55883 WP_003900222.1.55894 WP_003900222.1.55902 WP_003900222.1.55909 WP_003900222.1.55961 WP_003900222.1.55977 WP_003900222.1.56028 WP_003900222.1.56057 WP_003900222.1.56060 WP_003900222.1.56107 WP_003900222.1.56163 WP_003900222.1.56167 WP_003900222.1.56178 WP_003900222.1.56287 WP_003900222.1.56292 WP_003900222.1.56327 WP_003900222.1.56341 WP_003900222.1.56365 WP_003900222.1.56394 WP_003900222.1.56443 WP_003900222.1.56473 WP_003900222.1.56478 WP_003900222.1.56500 WP_003900222.1.56517 WP_003900222.1.56534 WP_003900222.1.56577 WP_003900222.1.56593 WP_003900222.1.56625 WP_003900222.1.56637 WP_003900222.1.56670 WP_003900222.1.56697 WP_003900222.1.567 WP_003900222.1.56701 WP_003900222.1.56709 WP_003900222.1.56729 WP_003900222.1.56743 WP_003900222.1.56755 WP_003900222.1.56764 WP_003900222.1.56769 WP_003900222.1.56770 WP_003900222.1.56795 WP_003900222.1.5681 WP_003900222.1.56827 WP_003900222.1.56839 WP_003900222.1.56863 WP_003900222.1.56868 WP_003900222.1.56869 WP_003900222.1.56915 WP_003900222.1.56926 WP_003900222.1.56961 WP_003900222.1.56971 WP_003900222.1.56972 WP_003900222.1.57023 WP_003900222.1.57077 WP_003900222.1.57087 WP_003900222.1.57094 WP_003900222.1.57134 WP_003900222.1.57151 WP_003900222.1.57169 WP_003900222.1.57208 WP_003900222.1.57212 WP_003900222.1.57230 WP_003900222.1.5724 WP_003900222.1.5725 WP_003900222.1.5727 WP_003900222.1.57273 WP_003900222.1.573 WP_003900222.1.57314 WP_003900222.1.57326 WP_003900222.1.57328 WP_003900222.1.57331 WP_003900222.1.57340 WP_003900222.1.57351 WP_003900222.1.57352 WP_003900222.1.57380 WP_003900222.1.5744 WP_003900222.1.57440 WP_003900222.1.5745 WP_003900222.1.57461 WP_003900222.1.57469 WP_003900222.1.57489 WP_003900222.1.575 WP_003900222.1.57509 WP_003900222.1.57519 WP_003900222.1.57551 WP_003900222.1.5758 WP_003900222.1.57604 WP_003900222.1.57616 WP_003900222.1.57617 WP_003900222.1.57619 WP_003900222.1.57627 WP_003900222.1.57642 WP_003900222.1.57667 WP_003900222.1.57675 WP_003900222.1.57689 WP_003900222.1.57794 WP_003900222.1.57821 WP_003900222.1.57825 WP_003900222.1.57843 WP_003900222.1.57906 WP_003900222.1.57924 WP_003900222.1.57926 WP_003900222.1.57930 WP_003900222.1.57957 WP_003900222.1.57960 WP_003900222.1.57964 WP_003900222.1.57991 WP_003900222.1.58000 WP_003900222.1.58086 WP_003900222.1.58101 WP_003900222.1.58103 WP_003900222.1.58108 WP_003900222.1.5811 WP_003900222.1.58121 WP_003900222.1.58145 WP_003900222.1.58164 WP_003900222.1.58174 WP_003900222.1.582 WP_003900222.1.58202 WP_003900222.1.5824 WP_003900222.1.58283 WP_003900222.1.58288 WP_003900222.1.5830 WP_003900222.1.58303 WP_003900222.1.58311 WP_003900222.1.58330 WP_003900222.1.58359 WP_003900222.1.58386 WP_003900222.1.58393 WP_003900222.1.58431 WP_003900222.1.5844 WP_003900222.1.58488 WP_003900222.1.58518 WP_003900222.1.58534 WP_003900222.1.58559 WP_003900222.1.58567 WP_003900222.1.58573 WP_003900222.1.58602 WP_003900222.1.58619 WP_003900222.1.58630 WP_003900222.1.5865 WP_003900222.1.58671 WP_003900222.1.58690 WP_003900222.1.58702 WP_003900222.1.58743 WP_003900222.1.5879 WP_003900222.1.5881 WP_003900222.1.58848 WP_003900222.1.58857 WP_003900222.1.58891 WP_003900222.1.58892 WP_003900222.1.5890 WP_003900222.1.58939 WP_003900222.1.58941 WP_003900222.1.58953 WP_003900222.1.5898 WP_003900222.1.59029 WP_003900222.1.59037 WP_003900222.1.59044 WP_003900222.1.59088 WP_003900222.1.5914 WP_003900222.1.59166 WP_003900222.1.59205 WP_003900222.1.59209 WP_003900222.1.59237 WP_003900222.1.59240 WP_003900222.1.59253 WP_003900222.1.59254 WP_003900222.1.59262 WP_003900222.1.59270 WP_003900222.1.59304 WP_003900222.1.59305 WP_003900222.1.59309 WP_003900222.1.59316 WP_003900222.1.59326 WP_003900222.1.59333 WP_003900222.1.59338 WP_003900222.1.59388 WP_003900222.1.59428 WP_003900222.1.59487 WP_003900222.1.59537 WP_003900222.1.59561 WP_003900222.1.59722 WP_003900222.1.59732 WP_003900222.1.59738 WP_003900222.1.59750 WP_003900222.1.59808 WP_003900222.1.59850 WP_003900222.1.59856 WP_003900222.1.59860 WP_003900222.1.59861 WP_003900222.1.5987 WP_003900222.1.59878 WP_003900222.1.59952 WP_003900222.1.5996 WP_003900222.1.59961 WP_003900222.1.59974 WP_003900222.1.6000 WP_003900222.1.60007 WP_003900222.1.60016 WP_003900222.1.6003 WP_003900222.1.60047 WP_003900222.1.6007 WP_003900222.1.60121 WP_003900222.1.60125 WP_003900222.1.60135 WP_003900222.1.60139 WP_003900222.1.60152 WP_003900222.1.60171 WP_003900222.1.60197 WP_003900222.1.6020 WP_003900222.1.60205 WP_003900222.1.60207 WP_003900222.1.60215 WP_003900222.1.60267 WP_003900222.1.60288 WP_003900222.1.60291 WP_003900222.1.60301 WP_003900222.1.60312 WP_003900222.1.60313 WP_003900222.1.60314 WP_003900222.1.60413 WP_003900222.1.60421 WP_003900222.1.60451 WP_003900222.1.60460 WP_003900222.1.60479 WP_003900222.1.60487 WP_003900222.1.60512 WP_003900222.1.60573 WP_003900222.1.60583 WP_003900222.1.60632 WP_003900222.1.60657 WP_003900222.1.60687 WP_003900222.1.60689 WP_003900222.1.60727 WP_003900222.1.60738 WP_003900222.1.60763 WP_003900222.1.6077 WP_003900222.1.60791 WP_003900222.1.60870 WP_003900222.1.60878 WP_003900222.1.60879 WP_003900222.1.60978 WP_003900222.1.61000 WP_003900222.1.61001 WP_003900222.1.61012 WP_003900222.1.61014 WP_003900222.1.61015 WP_003900222.1.61037 WP_003900222.1.61052 WP_003900222.1.61065 WP_003900222.1.61100 WP_003900222.1.61101 WP_003900222.1.61138 WP_003900222.1.61142 WP_003900222.1.612 WP_003900222.1.61234 WP_003900222.1.61256 WP_003900222.1.61281 WP_003900222.1.61314 WP_003900222.1.61321 WP_003900222.1.61326 WP_003900222.1.61328 WP_003900222.1.61391 WP_003900222.1.61406 WP_003900222.1.61409 WP_003900222.1.61420 WP_003900222.1.61422 WP_003900222.1.61425 WP_003900222.1.61428 WP_003900222.1.61494 WP_003900222.1.61522 WP_003900222.1.61552 WP_003900222.1.61557 WP_003900222.1.61571 WP_003900222.1.61573 WP_003900222.1.61584 WP_003900222.1.61586 WP_003900222.1.6160 WP_003900222.1.61614 WP_003900222.1.6163 WP_003900222.1.61655 WP_003900222.1.61665 WP_003900222.1.61669 WP_003900222.1.61682 WP_003900222.1.61692 WP_003900222.1.61719 WP_003900222.1.61728 WP_003900222.1.61750 WP_003900222.1.61754 WP_003900222.1.61755 WP_003900222.1.61778 WP_003900222.1.6179 WP_003900222.1.61793 WP_003900222.1.61816 WP_003900222.1.61842 WP_003900222.1.61850 WP_003900222.1.61862 WP_003900222.1.61865 WP_003900222.1.61911 WP_003900222.1.61925 WP_003900222.1.61941 WP_003900222.1.61979 WP_003900222.1.61987 WP_003900222.1.61998 WP_003900222.1.62021 WP_003900222.1.62087 WP_003900222.1.62089 WP_003900222.1.62101 WP_003900222.1.62104 WP_003900222.1.6211 WP_003900222.1.62132 WP_003900222.1.62162 WP_003900222.1.62238 WP_003900222.1.62270 WP_003900222.1.62281 WP_003900222.1.6231 WP_003900222.1.62359 WP_003900222.1.62360 WP_003900222.1.62371 WP_003900222.1.62379 WP_003900222.1.62395 WP_003900222.1.62408 WP_003900222.1.62468 WP_003900222.1.6248 WP_003900222.1.62508 WP_003900222.1.62594 WP_003900222.1.62606 WP_003900222.1.62616 WP_003900222.1.62715 WP_003900222.1.62730 WP_003900222.1.62738 WP_003900222.1.62761 WP_003900222.1.62766 WP_003900222.1.62786 WP_003900222.1.62839 WP_003900222.1.62936 WP_003900222.1.6294 WP_003900222.1.6295 WP_003900222.1.62962 WP_003900222.1.63007 WP_003900222.1.63019 WP_003900222.1.63032 WP_003900222.1.63037 WP_003900222.1.63064 WP_003900222.1.63066 WP_003900222.1.6308 WP_003900222.1.63096 WP_003900222.1.63106 WP_003900222.1.6314 WP_003900222.1.63144 WP_003900222.1.63154 WP_003900222.1.63160 WP_003900222.1.63161 WP_003900222.1.63166 WP_003900222.1.63194 WP_003900222.1.6322 WP_003900222.1.63222 WP_003900222.1.63247 WP_003900222.1.6328 WP_003900222.1.63291 WP_003900222.1.63317 WP_003900222.1.63331 WP_003900222.1.63373 WP_003900222.1.63384 WP_003900222.1.63403 WP_003900222.1.63424 WP_003900222.1.6345 WP_003900222.1.63464 WP_003900222.1.63483 WP_003900222.1.63502 WP_003900222.1.63504 WP_003900222.1.63522 WP_003900222.1.63564 WP_003900222.1.63567 WP_003900222.1.63596 WP_003900222.1.63600 WP_003900222.1.63623 WP_003900222.1.63624 WP_003900222.1.63625 WP_003900222.1.63627 WP_003900222.1.63654 WP_003900222.1.63662 WP_003900222.1.63711 WP_003900222.1.63734 WP_003900222.1.63807 WP_003900222.1.63844 WP_003900222.1.63888 WP_003900222.1.63913 WP_003900222.1.63918 WP_003900222.1.63970 WP_003900222.1.64027 WP_003900222.1.64058 WP_003900222.1.64065 WP_003900222.1.6407 WP_003900222.1.64082 WP_003900222.1.64091 WP_003900222.1.64102 WP_003900222.1.64104 WP_003900222.1.64119 WP_003900222.1.64219 WP_003900222.1.6422 WP_003900222.1.64222 WP_003900222.1.64223 WP_003900222.1.64228 WP_003900222.1.64235 WP_003900222.1.64249 WP_003900222.1.6427 WP_003900222.1.64278 WP_003900222.1.64414 WP_003900222.1.64419 WP_003900222.1.6443 WP_003900222.1.64463 WP_003900222.1.64497 WP_003900222.1.64506 WP_003900222.1.64513 WP_003900222.1.64514 WP_003900222.1.64515 WP_003900222.1.64522 WP_003900222.1.64526 WP_003900222.1.64543 WP_003900222.1.64588 WP_003900222.1.64589 WP_003900222.1.64594 WP_003900222.1.64595 WP_003900222.1.64608 WP_003900222.1.64619 WP_003900222.1.64629 WP_003900222.1.6464 WP_003900222.1.64664 WP_003900222.1.64669 WP_003900222.1.64672 WP_003900222.1.64682 WP_003900222.1.64727 WP_003900222.1.64729 WP_003900222.1.64774 WP_003900222.1.64776 WP_003900222.1.64802 WP_003900222.1.64832 WP_003900222.1.6486 WP_003900222.1.64870 WP_003900222.1.64898 WP_003900222.1.64922 WP_003900222.1.64924 WP_003900222.1.6493 WP_003900222.1.64937 WP_003900222.1.64941 WP_003900222.1.64966 WP_003900222.1.64973 WP_003900222.1.65001 WP_003900222.1.65026 WP_003900222.1.65053 WP_003900222.1.65070 WP_003900222.1.65079 WP_003900222.1.65102 WP_003900222.1.65157 WP_003900222.1.65181 WP_003900222.1.65212 WP_003900222.1.65229 WP_003900222.1.6523 WP_003900222.1.65253 WP_003900222.1.65289 WP_003900222.1.65291 WP_003900222.1.65315 WP_003900222.1.65329 WP_003900222.1.65359 WP_003900222.1.6536 WP_003900222.1.65374 WP_003900222.1.65414 WP_003900222.1.65416 WP_003900222.1.65433 WP_003900222.1.65455 WP_003900222.1.65467 WP_003900222.1.65488 WP_003900222.1.65529 WP_003900222.1.65539 WP_003900222.1.65583 WP_003900222.1.65612 WP_003900222.1.65635 WP_003900222.1.65637 WP_003900222.1.65648 WP_003900222.1.65683 WP_003900222.1.65688 WP_003900222.1.65707 WP_003900222.1.65733 WP_003900222.1.65746 WP_003900222.1.65747 WP_003900222.1.65759 WP_003900222.1.65830 WP_003900222.1.65858 WP_003900222.1.65862 WP_003900222.1.65869 WP_003900222.1.65929 WP_003900222.1.65958 WP_003900222.1.66013 WP_003900222.1.6606 WP_003900222.1.66089 WP_003900222.1.66151 WP_003900222.1.66229 WP_003900222.1.66276 WP_003900222.1.66293 WP_003900222.1.66297 WP_003900222.1.66323 WP_003900222.1.66325 WP_003900222.1.6633 WP_003900222.1.66334 WP_003900222.1.66355 WP_003900222.1.66367 WP_003900222.1.66396 WP_003900222.1.66451 WP_003900222.1.66455 WP_003900222.1.66457 WP_003900222.1.66460 WP_003900222.1.66464 WP_003900222.1.66487 WP_003900222.1.66504 WP_003900222.1.66580 WP_003900222.1.66582 WP_003900222.1.66612 WP_003900222.1.66615 WP_003900222.1.66617 WP_003900222.1.66635 WP_003900222.1.66656 WP_003900222.1.66663 WP_003900222.1.66675 WP_003900222.1.66715 WP_003900222.1.66718 WP_003900222.1.66762 WP_003900222.1.66776 WP_003900222.1.66808 WP_003900222.1.66817 WP_003900222.1.66819 WP_003900222.1.66826 WP_003900222.1.66830 WP_003900222.1.66868 WP_003900222.1.66878 WP_003900222.1.66880 WP_003900222.1.66893 WP_003900222.1.66961 WP_003900222.1.67005 WP_003900222.1.6704 WP_003900222.1.67044 WP_003900222.1.67061 WP_003900222.1.67089 WP_003900222.1.67146 WP_003900222.1.67170 WP_003900222.1.67197 WP_003900222.1.67198 WP_003900222.1.6720 WP_003900222.1.67207 WP_003900222.1.67218 WP_003900222.1.67220 WP_003900222.1.67225 WP_003900222.1.67231 WP_003900222.1.6724 WP_003900222.1.67298 WP_003900222.1.67307 WP_003900222.1.67324 WP_003900222.1.67332 WP_003900222.1.67346 WP_003900222.1.67354 WP_003900222.1.67360 WP_003900222.1.67381 WP_003900222.1.67396 WP_003900222.1.67417 WP_003900222.1.67422 WP_003900222.1.67453 WP_003900222.1.67459 WP_003900222.1.6746 WP_003900222.1.67473 WP_003900222.1.67481 WP_003900222.1.67482 WP_003900222.1.67496 WP_003900222.1.67499 WP_003900222.1.67516 WP_003900222.1.67536 WP_003900222.1.67575 WP_003900222.1.67598 WP_003900222.1.67602 WP_003900222.1.67679 WP_003900222.1.67744 WP_003900222.1.6775 WP_003900222.1.67750 WP_003900222.1.6777 WP_003900222.1.67809 WP_003900222.1.67816 WP_003900222.1.67844 WP_003900222.1.67848 WP_003900222.1.67870 WP_003900222.1.67888 WP_003900222.1.67915 WP_003900222.1.67945 WP_003900222.1.67949 WP_003900222.1.67980 WP_003900222.1.68029 WP_003900222.1.68037 WP_003900222.1.68038 WP_003900222.1.68045 WP_003900222.1.68057 WP_003900222.1.68083 WP_003900222.1.68088 WP_003900222.1.68106 WP_003900222.1.68164 WP_003900222.1.68169 WP_003900222.1.68193 WP_003900222.1.68212 WP_003900222.1.68227 WP_003900222.1.68243 WP_003900222.1.6825 WP_003900222.1.68297 WP_003900222.1.68309 WP_003900222.1.68329 WP_003900222.1.68340 WP_003900222.1.68384 WP_003900222.1.68388 WP_003900222.1.68429 WP_003900222.1.6843 WP_003900222.1.68433 WP_003900222.1.68444 WP_003900222.1.68465 WP_003900222.1.68484 WP_003900222.1.68569 WP_003900222.1.68576 WP_003900222.1.68580 WP_003900222.1.68586 WP_003900222.1.68624 WP_003900222.1.68637 WP_003900222.1.68646 WP_003900222.1.68669 WP_003900222.1.68672 WP_003900222.1.68684 WP_003900222.1.68704 WP_003900222.1.68708 WP_003900222.1.68730 WP_003900222.1.68734 WP_003900222.1.68754 WP_003900222.1.6876 WP_003900222.1.68761 WP_003900222.1.68763 WP_003900222.1.68766 WP_003900222.1.68774 WP_003900222.1.68796 WP_003900222.1.68824 WP_003900222.1.68832 WP_003900222.1.68833 WP_003900222.1.68841 WP_003900222.1.68859 WP_003900222.1.68876 WP_003900222.1.68906 WP_003900222.1.68916 WP_003900222.1.68923 WP_003900222.1.68945 WP_003900222.1.6896 WP_003900222.1.68984 WP_003900222.1.68997 WP_003900222.1.69008 WP_003900222.1.69076 WP_003900222.1.69079 WP_003900222.1.6908 WP_003900222.1.69082 WP_003900222.1.69178 WP_003900222.1.69181 WP_003900222.1.69208 WP_003900222.1.69256 WP_003900222.1.69311 WP_003900222.1.69315 WP_003900222.1.69322 WP_003900222.1.69342 WP_003900222.1.6935 WP_003900222.1.6936 WP_003900222.1.69374 WP_003900222.1.69398 WP_003900222.1.69401 WP_003900222.1.69426 WP_003900222.1.69429 WP_003900222.1.6949 WP_003900222.1.6951 WP_003900222.1.69511 WP_003900222.1.69526 WP_003900222.1.69528 WP_003900222.1.69547 WP_003900222.1.69573 WP_003900222.1.69581 WP_003900222.1.69634 WP_003900222.1.69647 WP_003900222.1.69673 WP_003900222.1.69682 WP_003900222.1.69684 WP_003900222.1.69686 WP_003900222.1.69707 WP_003900222.1.69709 WP_003900222.1.69736 WP_003900222.1.69778 WP_003900222.1.69800 WP_003900222.1.69802 WP_003900222.1.69845 WP_003900222.1.69870 WP_003900222.1.69873 WP_003900222.1.69898 WP_003900222.1.69913 WP_003900222.1.69925 WP_003900222.1.69931 WP_003900222.1.69938 WP_003900222.1.69955 WP_003900222.1.69981 WP_003900222.1.69990 WP_003900222.1.70 WP_003900222.1.70000 WP_003900222.1.70017 WP_003900222.1.70032 WP_003900222.1.70055 WP_003900222.1.70062 WP_003900222.1.70131 WP_003900222.1.7022 WP_003900222.1.70227 WP_003900222.1.70255 WP_003900222.1.70271 WP_003900222.1.70274 WP_003900222.1.7029 WP_003900222.1.70325 WP_003900222.1.70328 WP_003900222.1.70364 WP_003900222.1.70368 WP_003900222.1.70369 WP_003900222.1.70418 WP_003900222.1.70422 WP_003900222.1.70435 WP_003900222.1.70444 WP_003900222.1.70463 WP_003900222.1.70471 WP_003900222.1.70480 WP_003900222.1.70498 WP_003900222.1.70505 WP_003900222.1.70525 WP_003900222.1.70577 WP_003900222.1.70610 WP_003900222.1.70615 WP_003900222.1.70618 WP_003900222.1.70622 WP_003900222.1.70626 WP_003900222.1.70668 WP_003900222.1.70699 WP_003900222.1.70704 WP_003900222.1.70729 WP_003900222.1.70757 WP_003900222.1.70834 WP_003900222.1.7084 WP_003900222.1.70840 WP_003900222.1.70864 WP_003900222.1.70871 WP_003900222.1.70915 WP_003900222.1.70955 WP_003900222.1.70958 WP_003900222.1.70964 WP_003900222.1.70976 WP_003900222.1.71015 WP_003900222.1.71026 WP_003900222.1.71063 WP_003900222.1.71083 WP_003900222.1.7111 WP_003900222.1.71118 WP_003900222.1.71128 WP_003900222.1.7113 WP_003900222.1.71187 WP_003900222.1.71191 WP_003900222.1.71255 WP_003900222.1.71258 WP_003900222.1.71289 WP_003900222.1.71326 WP_003900222.1.71329 WP_003900222.1.71331 WP_003900222.1.71344 WP_003900222.1.71440 WP_003900222.1.71457 WP_003900222.1.7146 WP_003900222.1.71464 WP_003900222.1.71490 WP_003900222.1.71509 WP_003900222.1.71517 WP_003900222.1.71532 WP_003900222.1.71621 WP_003900222.1.71630 WP_003900222.1.71638 WP_003900222.1.71654 WP_003900222.1.71664 WP_003900222.1.71665 WP_003900222.1.71701 WP_003900222.1.71718 WP_003900222.1.71731 WP_003900222.1.71778 WP_003900222.1.71781 WP_003900222.1.71803 WP_003900222.1.71820 WP_003900222.1.7185 WP_003900222.1.71851 WP_003900222.1.71909 WP_003900222.1.71957 WP_003900222.1.72047 WP_003900222.1.72061 WP_003900222.1.72072 WP_003900222.1.72111 WP_003900222.1.72122 WP_003900222.1.72128 WP_003900222.1.72143 WP_003900222.1.7216 WP_003900222.1.72168 WP_003900222.1.72179 WP_003900222.1.72209 WP_003900222.1.72218 WP_003900222.1.72219 WP_003900222.1.72227 WP_003900222.1.7224 WP_003900222.1.72268 WP_003900222.1.72380 WP_003900222.1.72401 WP_003900222.1.72405 WP_003900222.1.72420 WP_003900222.1.72441 WP_003900222.1.72451 WP_003900222.1.72452 WP_003900222.1.72457 WP_003900222.1.72459 WP_003900222.1.72460 WP_003900222.1.72466 WP_003900222.1.72488 WP_003900222.1.72492 WP_003900222.1.72506 WP_003900222.1.72543 WP_003900222.1.7256 WP_003900222.1.72576 WP_003900222.1.72578 WP_003900222.1.72585 WP_003900222.1.72591 WP_003900222.1.72592 WP_003900222.1.72640 WP_003900222.1.7266 WP_003900222.1.72684 WP_003900222.1.72739 WP_003900222.1.72744 WP_003900222.1.72759 WP_003900222.1.72792 WP_003900222.1.72826 WP_003900222.1.72852 WP_003900222.1.72853 WP_003900222.1.72879 WP_003900222.1.72938 WP_003900222.1.72954 WP_003900222.1.72957 WP_003900222.1.72959 WP_003900222.1.72973 WP_003900222.1.7298 WP_003900222.1.72982 WP_003900222.1.72988 WP_003900222.1.72993 WP_003900222.1.73006 WP_003900222.1.73013 WP_003900222.1.73025 WP_003900222.1.73028 WP_003900222.1.73092 WP_003900222.1.73118 WP_003900222.1.7312 WP_003900222.1.73127 WP_003900222.1.73134 WP_003900222.1.73150 WP_003900222.1.73154 WP_003900222.1.73163 WP_003900222.1.73182 WP_003900222.1.73205 WP_003900222.1.7321 WP_003900222.1.73365 WP_003900222.1.73404 WP_003900222.1.73424 WP_003900222.1.73436 WP_003900222.1.73445 WP_003900222.1.73453 WP_003900222.1.73466 WP_003900222.1.73470 WP_003900222.1.73471 WP_003900222.1.73478 WP_003900222.1.73482 WP_003900222.1.73507 WP_003900222.1.73532 WP_003900222.1.73550 WP_003900222.1.73564 WP_003900222.1.73629 WP_003900222.1.73644 WP_003900222.1.73661 WP_003900222.1.7368 WP_003900222.1.73723 WP_003900222.1.73744 WP_003900222.1.73760 WP_003900222.1.7379 WP_003900222.1.73813 WP_003900222.1.73840 WP_003900222.1.73876 WP_003900222.1.7389 WP_003900222.1.73986 WP_003900222.1.74016 WP_003900222.1.74083 WP_003900222.1.74101 WP_003900222.1.74120 WP_003900222.1.74129 WP_003900222.1.7417 WP_003900222.1.74190 WP_003900222.1.74210 WP_003900222.1.74259 WP_003900222.1.74262 WP_003900222.1.74282 WP_003900222.1.74291 WP_003900222.1.74296 WP_003900222.1.74304 WP_003900222.1.7432 WP_003900222.1.74347 WP_003900222.1.7436 WP_003900222.1.74395 WP_003900222.1.74400 WP_003900222.1.74401 WP_003900222.1.74442 WP_003900222.1.74477 WP_003900222.1.74487 WP_003900222.1.74499 WP_003900222.1.74511 WP_003900222.1.74523 WP_003900222.1.74525 WP_003900222.1.74551 WP_003900222.1.74555 WP_003900222.1.74628 WP_003900222.1.74641 WP_003900222.1.74653 WP_003900222.1.74660 WP_003900222.1.74683 WP_003900222.1.7469 WP_003900222.1.74725 WP_003900222.1.74760 WP_003900222.1.74786 WP_003900222.1.74820 WP_003900222.1.74870 WP_003900222.1.74881 WP_003900222.1.74888 WP_003900222.1.7496 WP_003900222.1.74988 WP_003900222.1.75043 WP_003900222.1.75045 WP_003900222.1.75078 WP_003900222.1.75081 WP_003900222.1.75120 WP_003900222.1.75188 WP_003900222.1.75200 WP_003900222.1.75202 WP_003900222.1.75234 WP_003900222.1.75239 WP_003900222.1.75250 WP_003900222.1.75263 WP_003900222.1.75281 WP_003900222.1.75342 WP_003900222.1.75376 WP_003900222.1.75395 WP_003900222.1.75441 WP_003900222.1.75510 WP_003900222.1.75598 WP_003900222.1.75635 WP_003900222.1.75645 WP_003900222.1.75665 WP_003900222.1.75671 WP_003900222.1.75749 WP_003900222.1.75772 WP_003900222.1.75774 WP_003900222.1.75833 WP_003900222.1.7585 WP_003900222.1.75864 WP_003900222.1.75868 WP_003900222.1.75878 WP_003900222.1.75927 WP_003900222.1.75946 WP_003900222.1.75968 WP_003900222.1.75974 WP_003900222.1.76007 WP_003900222.1.76016 WP_003900222.1.76032 WP_003900222.1.76037 WP_003900222.1.7604 WP_003900222.1.76045 WP_003900222.1.76052 WP_003900222.1.76058 WP_003900222.1.76126 WP_003900222.1.76138 WP_003900222.1.76157 WP_003900222.1.76172 WP_003900222.1.76177 WP_003900222.1.76183 WP_003900222.1.76239 WP_003900222.1.76277 WP_003900222.1.76280 WP_003900222.1.76281 WP_003900222.1.76291 WP_003900222.1.76297 WP_003900222.1.76360 WP_003900222.1.76379 WP_003900222.1.76403 WP_003900222.1.76414 WP_003900222.1.76427 WP_003900222.1.76436 WP_003900222.1.76442 WP_003900222.1.76443 WP_003900222.1.76456 WP_003900222.1.76521 WP_003900222.1.76533 WP_003900222.1.76616 WP_003900222.1.76625 WP_003900222.1.76629 WP_003900222.1.76635 WP_003900222.1.76639 WP_003900222.1.76640 WP_003900222.1.76644 WP_003900222.1.76677 WP_003900222.1.76678 WP_003900222.1.76679 WP_003900222.1.76734 WP_003900222.1.76744 WP_003900222.1.76750 WP_003900222.1.76754 WP_003900222.1.76757 WP_003900222.1.76781 WP_003900222.1.76818 WP_003900222.1.76824 WP_003900222.1.76835 WP_003900222.1.76873 WP_003900222.1.76881 WP_003900222.1.76888 WP_003900222.1.76900 WP_003900222.1.7691 WP_003900222.1.76954 WP_003900222.1.76955 WP_003900222.1.76963 WP_003900222.1.76976 WP_003900222.1.770 WP_003900222.1.77000 WP_003900222.1.77008 WP_003900222.1.77021 WP_003900222.1.77056 WP_003900222.1.77065 WP_003900222.1.77075 WP_003900222.1.77093 WP_003900222.1.77118 WP_003900222.1.77125 WP_003900222.1.77141 WP_003900222.1.77142 WP_003900222.1.77166 WP_003900222.1.77250 WP_003900222.1.77252 WP_003900222.1.77260 WP_003900222.1.77266 WP_003900222.1.77280 WP_003900222.1.77312 WP_003900222.1.77348 WP_003900222.1.77351 WP_003900222.1.77352 WP_003900222.1.77361 WP_003900222.1.774 WP_003900222.1.7740 WP_003900222.1.77404 WP_003900222.1.77425 WP_003900222.1.77463 WP_003900222.1.77474 WP_003900222.1.7748 WP_003900222.1.77491 WP_003900222.1.77499 WP_003900222.1.77510 WP_003900222.1.77530 WP_003900222.1.77554 WP_003900222.1.77599 WP_003900222.1.77605 WP_003900222.1.7762 WP_003900222.1.77627 WP_003900222.1.77649 WP_003900222.1.77654 WP_003900222.1.7766 WP_003900222.1.77667 WP_003900222.1.77706 WP_003900222.1.77726 WP_003900222.1.7778 WP_003900222.1.77790 WP_003900222.1.77809 WP_003900222.1.77820 WP_003900222.1.77855 WP_003900222.1.77865 WP_003900222.1.77868 WP_003900222.1.77879 WP_003900222.1.77909 WP_003900222.1.77911 WP_003900222.1.77931 WP_003900222.1.77984 WP_003900222.1.78020 WP_003900222.1.78024 WP_003900222.1.78075 WP_003900222.1.78084 WP_003900222.1.78086 WP_003900222.1.78098 WP_003900222.1.78105 WP_003900222.1.78113 WP_003900222.1.78200 WP_003900222.1.78216 WP_003900222.1.78236 WP_003900222.1.78238 WP_003900222.1.78322 WP_003900222.1.78338 WP_003900222.1.7836 WP_003900222.1.78360 WP_003900222.1.78386 WP_003900222.1.78429 WP_003900222.1.78435 WP_003900222.1.7844 WP_003900222.1.78459 WP_003900222.1.78488 WP_003900222.1.7849 WP_003900222.1.78499 WP_003900222.1.785 WP_003900222.1.78516 WP_003900222.1.78524 WP_003900222.1.78526 WP_003900222.1.78544 WP_003900222.1.78545 WP_003900222.1.78547 WP_003900222.1.78574 WP_003900222.1.78580 WP_003900222.1.78620 WP_003900222.1.78646 WP_003900222.1.78648 WP_003900222.1.78649 WP_003900222.1.78655 WP_003900222.1.78657 WP_003900222.1.78659 WP_003900222.1.7869 WP_003900222.1.78692 WP_003900222.1.78760 WP_003900222.1.78766 WP_003900222.1.78778 WP_003900222.1.78784 WP_003900222.1.78788 WP_003900222.1.78790 WP_003900222.1.78793 WP_003900222.1.78848 WP_003900222.1.78860 WP_003900222.1.7887 WP_003900222.1.78884 WP_003900222.1.78932 WP_003900222.1.78969 WP_003900222.1.78977 WP_003900222.1.78980 WP_003900222.1.79005 WP_003900222.1.79016 WP_003900222.1.79066 WP_003900222.1.79077 WP_003900222.1.79122 WP_003900222.1.79145 WP_003900222.1.79152 WP_003900222.1.79163 WP_003900222.1.79182 WP_003900222.1.79198 WP_003900222.1.79213 WP_003900222.1.79218 WP_003900222.1.79268 WP_003900222.1.79273 WP_003900222.1.79278 WP_003900222.1.79290 WP_003900222.1.79319 WP_003900222.1.79325 WP_003900222.1.79326 WP_003900222.1.79330 WP_003900222.1.79339 WP_003900222.1.79394 WP_003900222.1.79399 WP_003900222.1.79445 WP_003900222.1.79447 WP_003900222.1.79455 WP_003900222.1.79471 WP_003900222.1.79480 WP_003900222.1.79482 WP_003900222.1.79488 WP_003900222.1.79500 WP_003900222.1.79502 WP_003900222.1.79508 WP_003900222.1.79514 WP_003900222.1.79561 WP_003900222.1.79565 WP_003900222.1.79578 WP_003900222.1.79588 WP_003900222.1.79598 WP_003900222.1.79615 WP_003900222.1.79684 WP_003900222.1.79698 WP_003900222.1.797 WP_003900222.1.79802 WP_003900222.1.79819 WP_003900222.1.79826 WP_003900222.1.79828 WP_003900222.1.79851 WP_003900222.1.79853 WP_003900222.1.79863 WP_003900222.1.79881 WP_003900222.1.79885 WP_003900222.1.7990 WP_003900222.1.79900 WP_003900222.1.79913 WP_003900222.1.79918 WP_003900222.1.79947 WP_003900222.1.79948 WP_003900222.1.7995 WP_003900222.1.7997 WP_003900222.1.80004 WP_003900222.1.80015 WP_003900222.1.80022 WP_003900222.1.80030 WP_003900222.1.80054 WP_003900222.1.80084 WP_003900222.1.80129 WP_003900222.1.80177 WP_003900222.1.80234 WP_003900222.1.8026 WP_003900222.1.80275 WP_003900222.1.8029 WP_003900222.1.80299 WP_003900222.1.80300 WP_003900222.1.80304 WP_003900222.1.80326 WP_003900222.1.80351 WP_003900222.1.8037 WP_003900222.1.80370 WP_003900222.1.80387 WP_003900222.1.80399 WP_003900222.1.8044 WP_003900222.1.80451 WP_003900222.1.80458 WP_003900222.1.80503 WP_003900222.1.80552 WP_003900222.1.80576 WP_003900222.1.80588 WP_003900222.1.80599 WP_003900222.1.8060 WP_003900222.1.80624 WP_003900222.1.80636 WP_003900222.1.80673 WP_003900222.1.80711 WP_003900222.1.80714 WP_003900222.1.80743 WP_003900222.1.80784 WP_003900222.1.80815 WP_003900222.1.80853 WP_003900222.1.8093 WP_003900222.1.8097 WP_003900222.1.80988 WP_003900222.1.81007 WP_003900222.1.81013 WP_003900222.1.8105 WP_003900222.1.81063 WP_003900222.1.81075 WP_003900222.1.81091 WP_003900222.1.81119 WP_003900222.1.81125 WP_003900222.1.81136 WP_003900222.1.8114 WP_003900222.1.81192 WP_003900222.1.81230 WP_003900222.1.81249 WP_003900222.1.81250 WP_003900222.1.8128 WP_003900222.1.81297 WP_003900222.1.8138 WP_003900222.1.81407 WP_003900222.1.8143 WP_003900222.1.81439 WP_003900222.1.81465 WP_003900222.1.81505 WP_003900222.1.81529 WP_003900222.1.81538 WP_003900222.1.81541 WP_003900222.1.81560 WP_003900222.1.81561 WP_003900222.1.81567 WP_003900222.1.81583 WP_003900222.1.81712 WP_003900222.1.81720 WP_003900222.1.81731 WP_003900222.1.81774 WP_003900222.1.81809 WP_003900222.1.81820 WP_003900222.1.81850 WP_003900222.1.81883 WP_003900222.1.81911 WP_003900222.1.81918 WP_003900222.1.82048 WP_003900222.1.82069 WP_003900222.1.82071 WP_003900222.1.82108 WP_003900222.1.82142 WP_003900222.1.8215 WP_003900222.1.82158 WP_003900222.1.8217 WP_003900222.1.82209 WP_003900222.1.82210 WP_003900222.1.82236 WP_003900222.1.82251 WP_003900222.1.82271 WP_003900222.1.82305 WP_003900222.1.82307 WP_003900222.1.82317 WP_003900222.1.8232 WP_003900222.1.82346 WP_003900222.1.82374 WP_003900222.1.82385 WP_003900222.1.82429 WP_003900222.1.82460 WP_003900222.1.82462 WP_003900222.1.82483 WP_003900222.1.82494 WP_003900222.1.82531 WP_003900222.1.82546 WP_003900222.1.82547 WP_003900222.1.82577 WP_003900222.1.82597 WP_003900222.1.82598 WP_003900222.1.82625 WP_003900222.1.82642 WP_003900222.1.82651 WP_003900222.1.82653 WP_003900222.1.82681 WP_003900222.1.82685 WP_003900222.1.8271 WP_003900222.1.82712 WP_003900222.1.8273 WP_003900222.1.82743 WP_003900222.1.82757 WP_003900222.1.82774 WP_003900222.1.82836 WP_003900222.1.82860 WP_003900222.1.82892 WP_003900222.1.82935 WP_003900222.1.82973 WP_003900222.1.83004 WP_003900222.1.83009 WP_003900222.1.83044 WP_003900222.1.83065 WP_003900222.1.83074 WP_003900222.1.83110 WP_003900222.1.83146 WP_003900222.1.83149 WP_003900222.1.83159 WP_003900222.1.8317 WP_003900222.1.83181 WP_003900222.1.83182 WP_003900222.1.83191 WP_003900222.1.83197 WP_003900222.1.83212 WP_003900222.1.8326 WP_003900222.1.83262 WP_003900222.1.83268 WP_003900222.1.83309 WP_003900222.1.83332 WP_003900222.1.83334 WP_003900222.1.83341 WP_003900222.1.83349 WP_003900222.1.8335 WP_003900222.1.83353 WP_003900222.1.83367 WP_003900222.1.83380 WP_003900222.1.83381 WP_003900222.1.83389 WP_003900222.1.83408 WP_003900222.1.83409 WP_003900222.1.83435 WP_003900222.1.83470 WP_003900222.1.83524 WP_003900222.1.83526 WP_003900222.1.8358 WP_003900222.1.83589 WP_003900222.1.83601 WP_003900222.1.83638 WP_003900222.1.83648 WP_003900222.1.83656 WP_003900222.1.83667 WP_003900222.1.83692 WP_003900222.1.83705 WP_003900222.1.83766 WP_003900222.1.83793 WP_003900222.1.83794 WP_003900222.1.83802 WP_003900222.1.83805 WP_003900222.1.83839 WP_003900222.1.83842 WP_003900222.1.83850 WP_003900222.1.83861 WP_003900222.1.83884 WP_003900222.1.83920 WP_003900222.1.83929 WP_003900222.1.83930 WP_003900222.1.83975 WP_003900222.1.83991 WP_003900222.1.8400 WP_003900222.1.84027 WP_003900222.1.8404 WP_003900222.1.84057 WP_003900222.1.84070 WP_003900222.1.84112 WP_003900222.1.84146 WP_003900222.1.8415 WP_003900222.1.84176 WP_003900222.1.84186 WP_003900222.1.84192 WP_003900222.1.8424 WP_003900222.1.84244 WP_003900222.1.8426 WP_003900222.1.84277 WP_003900222.1.84287 WP_003900222.1.8434 WP_003900222.1.84388 WP_003900222.1.84408 WP_003900222.1.84438 WP_003900222.1.84460 WP_003900222.1.84488 WP_003900222.1.84504 WP_003900222.1.84525 WP_003900222.1.84620 WP_003900222.1.84623 WP_003900222.1.84655 WP_003900222.1.84666 WP_003900222.1.84670 WP_003900222.1.84739 WP_003900222.1.84748 WP_003900222.1.84772 WP_003900222.1.84774 WP_003900222.1.848 WP_003900222.1.84812 WP_003900222.1.84836 WP_003900222.1.84839 WP_003900222.1.84846 WP_003900222.1.84873 WP_003900222.1.84911 WP_003900222.1.84938 WP_003900222.1.84968 WP_003900222.1.84981 WP_003900222.1.84985 WP_003900222.1.8503 WP_003900222.1.85038 WP_003900222.1.85041 WP_003900222.1.85043 WP_003900222.1.8505 WP_003900222.1.85074 WP_003900222.1.8509 WP_003900222.1.8512 WP_003900222.1.85148 WP_003900222.1.8518 WP_003900222.1.85242 WP_003900222.1.85276 WP_003900222.1.85281 WP_003900222.1.85284 WP_003900222.1.85319 WP_003900222.1.85330 WP_003900222.1.85341 WP_003900222.1.85346 WP_003900222.1.8535 WP_003900222.1.85363 WP_003900222.1.85371 WP_003900222.1.85377 WP_003900222.1.85399 WP_003900222.1.85458 WP_003900222.1.85464 WP_003900222.1.85478 WP_003900222.1.85480 WP_003900222.1.85488 WP_003900222.1.85495 WP_003900222.1.85551 WP_003900222.1.85557 WP_003900222.1.85577 WP_003900222.1.85597 WP_003900222.1.85599 WP_003900222.1.85610 WP_003900222.1.8563 WP_003900222.1.85648 WP_003900222.1.85704 WP_003900222.1.85727 WP_003900222.1.85737 WP_003900222.1.85808 WP_003900222.1.85819 WP_003900222.1.85820 WP_003900222.1.85823 WP_003900222.1.8586 WP_003900222.1.85894 WP_003900222.1.85913 WP_003900222.1.85953 WP_003900222.1.85986 WP_003900222.1.86024 WP_003900222.1.86025 WP_003900222.1.86032 WP_003900222.1.86048 WP_003900222.1.86052 WP_003900222.1.86067 WP_003900222.1.86103 WP_003900222.1.86122 WP_003900222.1.86124 WP_003900222.1.86160 WP_003900222.1.86164 WP_003900222.1.86168 WP_003900222.1.86190 WP_003900222.1.86204 WP_003900222.1.86208 WP_003900222.1.86235 WP_003900222.1.86249 WP_003900222.1.86260 WP_003900222.1.86290 WP_003900222.1.86334 WP_003900222.1.86337 WP_003900222.1.86368 WP_003900222.1.86377 WP_003900222.1.86425 WP_003900222.1.86459 WP_003900222.1.86499 WP_003900222.1.86520 WP_003900222.1.86561 WP_003900222.1.86568 WP_003900222.1.86575 WP_003900222.1.86584 WP_003900222.1.86626 WP_003900222.1.86648 WP_003900222.1.8666 WP_003900222.1.86684 WP_003900222.1.86696 WP_003900222.1.86705 WP_003900222.1.86718 WP_003900222.1.86725 WP_003900222.1.86757 WP_003900222.1.86801 WP_003900222.1.86814 WP_003900222.1.86820 WP_003900222.1.86825 WP_003900222.1.86834 WP_003900222.1.8685 WP_003900222.1.86851 WP_003900222.1.86867 WP_003900222.1.86877 WP_003900222.1.86883 WP_003900222.1.86892 WP_003900222.1.86933 WP_003900222.1.86941 WP_003900222.1.86950 WP_003900222.1.86962 WP_003900222.1.86963 WP_003900222.1.86979 WP_003900222.1.8700 WP_003900222.1.87001 WP_003900222.1.87002 WP_003900222.1.87116 WP_003900222.1.8714 WP_003900222.1.87178 WP_003900222.1.87191 WP_003900222.1.87201 WP_003900222.1.87240 WP_003900222.1.87273 WP_003900222.1.87275 WP_003900222.1.8733 WP_003900222.1.87345 WP_003900222.1.87369 WP_003900222.1.8737 WP_003900222.1.87401 WP_003900222.1.87404 WP_003900222.1.87406 WP_003900222.1.87409 WP_003900222.1.87444 WP_003900222.1.87446 WP_003900222.1.87459 WP_003900222.1.87472 WP_003900222.1.87494 WP_003900222.1.87496 WP_003900222.1.87582 WP_003900222.1.87588 WP_003900222.1.87619 WP_003900222.1.87620 WP_003900222.1.87634 WP_003900222.1.87650 WP_003900222.1.87654 WP_003900222.1.87658 WP_003900222.1.87665 WP_003900222.1.87676 WP_003900222.1.87677 WP_003900222.1.87684 WP_003900222.1.87692 WP_003900222.1.87707 WP_003900222.1.87732 WP_003900222.1.87809 WP_003900222.1.87817 WP_003900222.1.87827 WP_003900222.1.87831 WP_003900222.1.87835 WP_003900222.1.87837 WP_003900222.1.87866 WP_003900222.1.8789 WP_003900222.1.87911 WP_003900222.1.87924 WP_003900222.1.87951 WP_003900222.1.87955 WP_003900222.1.87956 WP_003900222.1.87991 WP_003900222.1.88037 WP_003900222.1.88039 WP_003900222.1.88072 WP_003900222.1.88077 WP_003900222.1.88121 WP_003900222.1.88180 WP_003900222.1.88205 WP_003900222.1.88217 WP_003900222.1.88219 WP_003900222.1.88245 WP_003900222.1.88294 WP_003900222.1.88315 WP_003900222.1.88316 WP_003900222.1.88338 WP_003900222.1.8840 WP_003900222.1.88437 WP_003900222.1.88453 WP_003900222.1.88489 WP_003900222.1.88507 WP_003900222.1.88521 WP_003900222.1.88530 WP_003900222.1.88537 WP_003900222.1.88541 WP_003900222.1.88592 WP_003900222.1.88616 WP_003900222.1.88618 WP_003900222.1.8862 WP_003900222.1.88625 WP_003900222.1.88632 WP_003900222.1.88634 WP_003900222.1.88649 WP_003900222.1.8870 WP_003900222.1.88737 WP_003900222.1.888 WP_003900222.1.88824 WP_003900222.1.88886 WP_003900222.1.88965 WP_003900222.1.88985 WP_003900222.1.8902 WP_003900222.1.89025 WP_003900222.1.89041 WP_003900222.1.89046 WP_003900222.1.89082 WP_003900222.1.89162 WP_003900222.1.89168 WP_003900222.1.8917 WP_003900222.1.89193 WP_003900222.1.89207 WP_003900222.1.89225 WP_003900222.1.89277 WP_003900222.1.89293 WP_003900222.1.89320 WP_003900222.1.89378 WP_003900222.1.89392 WP_003900222.1.89406 WP_003900222.1.8943 WP_003900222.1.89451 WP_003900222.1.89473 WP_003900222.1.89475 WP_003900222.1.89483 WP_003900222.1.895 WP_003900222.1.89513 WP_003900222.1.89517 WP_003900222.1.89522 WP_003900222.1.8954 WP_003900222.1.89543 WP_003900222.1.89567 WP_003900222.1.8957 WP_003900222.1.89572 WP_003900222.1.89607 WP_003900222.1.89613 WP_003900222.1.89625 WP_003900222.1.8967 WP_003900222.1.89670 WP_003900222.1.89676 WP_003900222.1.89729 WP_003900222.1.89739 WP_003900222.1.89762 WP_003900222.1.8977 WP_003900222.1.89802 WP_003900222.1.8982 WP_003900222.1.89829 WP_003900222.1.89831 WP_003900222.1.89844 WP_003900222.1.89849 WP_003900222.1.8989 WP_003900222.1.89901 WP_003900222.1.89903 WP_003900222.1.89922 WP_003900222.1.89963 WP_003900222.1.89971 WP_003900222.1.8998 WP_003900222.1.89987 WP_003900222.1.90048 WP_003900222.1.9007 WP_003900222.1.90080 WP_003900222.1.90130 WP_003900222.1.90137 WP_003900222.1.90157 WP_003900222.1.90184 WP_003900222.1.90199 WP_003900222.1.90231 WP_003900222.1.90245 WP_003900222.1.90308 WP_003900222.1.90322 WP_003900222.1.90328 WP_003900222.1.90372 WP_003900222.1.90439 WP_003900222.1.90481 WP_003900222.1.90499 WP_003900222.1.9050 WP_003900222.1.90527 WP_003900222.1.90550 WP_003900222.1.90560 WP_003900222.1.90612 WP_003900222.1.90640 WP_003900222.1.90672 WP_003900222.1.90691 WP_003900222.1.90711 WP_003900222.1.90722 WP_003900222.1.90744 WP_003900222.1.9075 WP_003900222.1.90767 WP_003900222.1.90771 WP_003900222.1.90788 WP_003900222.1.90800 WP_003900222.1.90816 WP_003900222.1.90819 WP_003900222.1.9082 WP_003900222.1.90884 WP_003900222.1.90899 WP_003900222.1.90906 WP_003900222.1.90958 WP_003900222.1.90976 WP_003900222.1.90977 WP_003900222.1.90987 WP_003900222.1.9102 WP_003900222.1.91026 WP_003900222.1.91043 WP_003900222.1.91053 WP_003900222.1.91106 WP_003900222.1.91112 WP_003900222.1.91144 WP_003900222.1.91157 WP_003900222.1.91167 WP_003900222.1.91192 WP_003900222.1.91201 WP_003900222.1.91207 WP_003900222.1.91208 WP_003900222.1.91211 WP_003900222.1.91214 WP_003900222.1.91230 WP_003900222.1.91251 WP_003900222.1.91260 WP_003900222.1.91265 WP_003900222.1.9128 WP_003900222.1.91284 WP_003900222.1.91294 WP_003900222.1.91322 WP_003900222.1.91352 WP_003900222.1.9139 WP_003900222.1.91398 WP_003900222.1.91411 WP_003900222.1.91436 WP_003900222.1.91483 WP_003900222.1.91508 WP_003900222.1.91576 WP_003900222.1.91589 WP_003900222.1.91694 WP_003900222.1.91713 WP_003900222.1.91716 WP_003900222.1.91717 WP_003900222.1.91743 WP_003900222.1.91759 WP_003900222.1.91784 WP_003900222.1.91786 WP_003900222.1.91802 WP_003900222.1.91822 WP_003900222.1.91828 WP_003900222.1.91896 WP_003900222.1.9190 WP_003900222.1.91915 WP_003900222.1.91937 WP_003900222.1.91953 WP_003900222.1.91978 WP_003900222.1.92021 WP_003900222.1.92083 WP_003900222.1.92127 WP_003900222.1.92144 WP_003900222.1.92150 WP_003900222.1.92153 WP_003900222.1.92190 WP_003900222.1.92192 WP_003900222.1.92200 WP_003900222.1.92221 WP_003900222.1.92222 WP_003900222.1.92273 WP_003900222.1.92289 WP_003900222.1.92294 WP_003900222.1.92300 WP_003900222.1.92317 WP_003900222.1.92334 WP_003900222.1.92338 WP_003900222.1.92345 WP_003900222.1.92364 WP_003900222.1.92380 WP_003900222.1.92416 WP_003900222.1.92428 WP_003900222.1.92447 WP_003900222.1.92456 WP_003900222.1.92467 WP_003900222.1.92490 WP_003900222.1.92508 WP_003900222.1.9251 WP_003900222.1.92511 WP_003900222.1.92523 WP_003900222.1.92597 WP_003900222.1.92603 WP_003900222.1.92606 WP_003900222.1.92610 WP_003900222.1.92613 WP_003900222.1.9263 WP_003900222.1.9265 WP_003900222.1.92650 WP_003900222.1.92660 WP_003900222.1.92677 WP_003900222.1.92685 WP_003900222.1.92689 WP_003900222.1.92706 WP_003900222.1.92714 WP_003900222.1.92736 WP_003900222.1.9274 WP_003900222.1.92752 WP_003900222.1.92777 WP_003900222.1.92803 WP_003900222.1.92833 WP_003900222.1.92856 WP_003900222.1.92892 WP_003900222.1.92907 WP_003900222.1.9291 WP_003900222.1.92917 WP_003900222.1.92996 WP_003900222.1.93006 WP_003900222.1.93008 WP_003900222.1.93043 WP_003900222.1.9307 WP_003900222.1.93097 WP_003900222.1.93137 WP_003900222.1.93192 WP_003900222.1.93199 WP_003900222.1.93203 WP_003900222.1.93212 WP_003900222.1.93234 WP_003900222.1.93245 WP_003900222.1.93257 WP_003900222.1.93297 WP_003900222.1.93320 WP_003900222.1.93328 WP_003900222.1.93337 WP_003900222.1.93343 WP_003900222.1.93349 WP_003900222.1.93377 WP_003900222.1.9338 WP_003900222.1.93407 WP_003900222.1.93417 WP_003900222.1.93419 WP_003900222.1.9344 WP_003900222.1.93443 WP_003900222.1.93447 WP_003900222.1.93470 WP_003900222.1.93483 WP_003900222.1.93487 WP_003900222.1.93499 WP_003900222.1.93516 WP_003900222.1.93536 WP_003900222.1.93544 WP_003900222.1.93555 WP_003900222.1.93560 WP_003900222.1.93564 WP_003900222.1.9357 WP_003900222.1.93573 WP_003900222.1.93576 WP_003900222.1.93588 WP_003900222.1.9363 WP_003900222.1.93645 WP_003900222.1.93659 WP_003900222.1.93677 WP_003900222.1.9368 WP_003900222.1.93689 WP_003900222.1.93693 WP_003900222.1.93698 WP_003900222.1.93706 WP_003900222.1.9371 WP_003900222.1.93792 WP_003900222.1.93823 WP_003900222.1.93871 WP_003900222.1.9388 WP_003900222.1.93894 WP_003900222.1.93903 WP_003900222.1.93913 WP_003900222.1.93946 WP_003900222.1.93950 WP_003900222.1.93953 WP_003900222.1.93988 WP_003900222.1.9407 WP_003900222.1.94143 WP_003900222.1.94154 WP_003900222.1.94184 WP_003900222.1.94204 WP_003900222.1.94205 WP_003900222.1.94226 WP_003900222.1.94231 WP_003900222.1.94256 WP_003900222.1.94261 WP_003900222.1.94281 WP_003900222.1.94292 WP_003900222.1.94297 WP_003900222.1.9431 WP_003900222.1.94326 WP_003900222.1.94339 WP_003900222.1.94392 WP_003900222.1.94416 WP_003900222.1.94421 WP_003900222.1.94456 WP_003900222.1.94480 WP_003900222.1.94495 WP_003900222.1.94511 WP_003900222.1.94512 WP_003900222.1.94525 WP_003900222.1.94528 WP_003900222.1.94564 WP_003900222.1.94602 WP_003900222.1.94623 WP_003900222.1.9465 WP_003900222.1.94673 WP_003900222.1.94730 WP_003900222.1.94776 WP_003900222.1.9478 WP_003900222.1.94834 WP_003900222.1.94872 WP_003900222.1.9488 WP_003900222.1.94902 WP_003900222.1.94916 WP_003900222.1.94979 WP_003900222.1.94994 WP_003900222.1.94998 WP_003900222.1.95007 WP_003900222.1.95015 WP_003900222.1.95034 WP_003900222.1.95068 WP_003900222.1.95081 WP_003900222.1.95082 WP_003900222.1.95096 WP_003900222.1.95112 WP_003900222.1.95138 WP_003900222.1.9514 WP_003900222.1.95179 WP_003900222.1.95190 WP_003900222.1.95234 WP_003900222.1.95241 WP_003900222.1.95257 WP_003900222.1.95279 WP_003900222.1.9531 WP_003900222.1.95335 WP_003900222.1.9535 WP_003900222.1.95370 WP_003900222.1.95416 WP_003900222.1.95417 WP_003900222.1.95454 WP_003900222.1.95455 WP_003900222.1.95509 WP_003900222.1.95529 WP_003900222.1.95556 WP_003900222.1.95557 WP_003900222.1.95565 WP_003900222.1.95578 WP_003900222.1.95580 WP_003900222.1.95585 WP_003900222.1.95643 WP_003900222.1.95679 WP_003900222.1.95685 WP_003900222.1.957 WP_003900222.1.95724 WP_003900222.1.95727 WP_003900222.1.95735 WP_003900222.1.95758 WP_003900222.1.95772 WP_003900222.1.95839 WP_003900222.1.9585 WP_003900222.1.9590 WP_003900222.1.95902 WP_003900222.1.95908 WP_003900222.1.95924 WP_003900222.1.95926 WP_003900222.1.95953 WP_003900222.1.95958 WP_003900222.1.95964 WP_003900222.1.95973 WP_003900222.1.96006 WP_003900222.1.9602 WP_003900222.1.96036 WP_003900222.1.96062 WP_003900222.1.96065 WP_003900222.1.96098 WP_003900222.1.96146 WP_003900222.1.96166 WP_003900222.1.96171 WP_003900222.1.96204 WP_003900222.1.96230 WP_003900222.1.96235 WP_003900222.1.96242 WP_003900222.1.96245 WP_003900222.1.96254 WP_003900222.1.96259 WP_003900222.1.96313 WP_003900222.1.96345 WP_003900222.1.96360 WP_003900222.1.96373 WP_003900222.1.96456 WP_003900222.1.96486 WP_003900222.1.96560 WP_003900222.1.96569 WP_003900222.1.96573 WP_003900222.1.96575 WP_003900222.1.96611 WP_003900222.1.9667 WP_003900222.1.96681 WP_003900222.1.96726 WP_003900222.1.96733 WP_003900222.1.96742 WP_003900222.1.9678 WP_003900222.1.96832 WP_003900222.1.9685 WP_003900222.1.97008 WP_003900222.1.97009 WP_003900222.1.97056 WP_003900222.1.97084 WP_003900222.1.97087 WP_003900222.1.97094 WP_003900222.1.97096 WP_003900222.1.97108 WP_003900222.1.97113 WP_003900222.1.97122 WP_003900222.1.97127 WP_003900222.1.97129 WP_003900222.1.9716 WP_003900222.1.97176 WP_003900222.1.97222 WP_003900222.1.97223 WP_003900222.1.97237 WP_003900222.1.97270 WP_003900222.1.97283 WP_003900222.1.97296 WP_003900222.1.97321 WP_003900222.1.97330 WP_003900222.1.97366 WP_003900222.1.97376 WP_003900222.1.97380 WP_003900222.1.9739 WP_003900222.1.97462 WP_003900222.1.97535 WP_003900222.1.97540 WP_003900222.1.97546 WP_003900222.1.97550 WP_003900222.1.97577 WP_003900222.1.97584 WP_003900222.1.9759 WP_003900222.1.97591 WP_003900222.1.97596 WP_003900222.1.97609 WP_003900222.1.97618 WP_003900222.1.9763 WP_003900222.1.97700 WP_003900222.1.97701 WP_003900222.1.9773 WP_003900222.1.97730 WP_003900222.1.97740 WP_003900222.1.97751 WP_003900222.1.97754 WP_003900222.1.97797 WP_003900222.1.9782 WP_003900222.1.9784 WP_003900222.1.97888 WP_003900222.1.9795 WP_003900222.1.97951 WP_003900222.1.97958 WP_003900222.1.97966 WP_003900222.1.97979 WP_003900222.1.97995 WP_003900222.1.98034 WP_003900222.1.98052 WP_003900222.1.98071 WP_003900222.1.98113 WP_003900222.1.98114 WP_003900222.1.98128 WP_003900222.1.98181 WP_003900222.1.98188 WP_003900222.1.98189 WP_003900222.1.98213 WP_003900222.1.98225 WP_003900222.1.98291 WP_003900222.1.98335 WP_003900222.1.98350 WP_003900222.1.98395 WP_003900222.1.98412 WP_003900222.1.98443 WP_003900222.1.98462 WP_003900222.1.9848 WP_003900222.1.98482 WP_003900222.1.98488 WP_003900222.1.98503 WP_003900222.1.98516 WP_003900222.1.98524 WP_003900222.1.98536 WP_003900222.1.98541 WP_003900222.1.98576 WP_003900222.1.98590 WP_003900222.1.98594 WP_003900222.1.98599 WP_003900222.1.98629 WP_003900222.1.98645 WP_003900222.1.98649 WP_003900222.1.9867 WP_003900222.1.98697 WP_003900222.1.98701 WP_003900222.1.98739 WP_003900222.1.98749 WP_003900222.1.98765 WP_003900222.1.98770 WP_003900222.1.98777 WP_003900222.1.98838 WP_003900222.1.98850 WP_003900222.1.98906 WP_003900222.1.98935 WP_003900222.1.98948 WP_003900222.1.98953 WP_003900222.1.98984 WP_003900222.1.99030 WP_003900222.1.99037 WP_003900222.1.99055 WP_003900222.1.99062 WP_003900222.1.99086 WP_003900222.1.99115 WP_003900222.1.99211 WP_003900222.1.99222 WP_003900222.1.99269 WP_003900222.1.99294 WP_003900222.1.99316 WP_003900222.1.99322 WP_003900222.1.99328 WP_003900222.1.99365 WP_003900222.1.99368 WP_003900222.1.99402 WP_003900222.1.99404 WP_003900222.1.99419 WP_003900222.1.99460 WP_003900222.1.99468 WP_003900222.1.99513 WP_003900222.1.99529 WP_003900222.1.99548 WP_003900222.1.99572 WP_003900222.1.99578 WP_003900222.1.99605 WP_003900222.1.99609 WP_003900222.1.99635 WP_003900222.1.99650 WP_003900222.1.99701 WP_003900222.1.99711 WP_003900222.1.99716 WP_003900222.1.99740 WP_003900222.1.99745 WP_003900222.1.99749 WP_003900222.1.9976 WP_003900222.1.99817 WP_003900222.1.99832 WP_003900222.1.99847 WP_003900222.1.99852 WP_003900222.1.99886 WP_003900222.1.99897 WP_003900222.1.99899 WP_003900222.1.99915 WP_003900222.1.9993 WP_003900222.1.99982 WP_003900222.1.99991 gi|383306752|ref|YP_005359563.1| gi|31792041|ref|NP_854534.1| gi|506925282|ref|YP_008005732.1| gi|385997634|ref|YP_005915932.1| gi|148660630|ref|YP_001282153.1| gi|224989247|ref|YP_002643934.1| gi|506925282|ref|YP_008005732.1| Rv0853c gi|197739605|ref|YP_002160919.1| gi|253800125|ref|YP_003033126.1| gi|15607993|ref|NP_215368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]