SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378771566|ref|YP_005171299.1| from Mycobacterium bovis BCG str. Mexico

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378771566|ref|YP_005171299.1|
Domain Number 1 Region: 362-541
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.09e-47
Family Pyruvate oxidase and decarboxylase PP module 0.00016
Further Details:      
 
Domain Number 2 Region: 10-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-40
Family Pyruvate oxidase and decarboxylase Pyr module 0.00019
Further Details:      
 
Domain Number 3 Region: 192-346
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.71e-28
Family Pyruvate oxidase and decarboxylase, middle domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378771566|ref|YP_005171299.1|
Sequence length 547
Comment putative Acetolactate synthase [Mycobacterium bovis BCG str. Mexico]
Sequence
MSTDTAPAQTMHAGRLIARRLKASGIDTVFTLSGGHLFSIYDGCREEGIRLIDTRHEQTA
AFAAEGWSKVTRVPGVAALTAGPGITNGMSAMAAAQQNQSPLVVLGGRAPALRWGMGSLQ
EIDHVPFVAPVARFAATAQSAENAGLLVDQALQAAVSAPSGVAFVDFPMDHAFSMSSDNG
RPGALTELPAGPTPAGDALDRAAGLLSTAQRPVIMAGTNVWWGHAEAALLRLVEERHIPV
LMNGMARGVVPADHRLAFSRARSKALGEADVALIVGVPMDFRLGFGGVFGSTTQLIVADR
VEPAREHPRPVAAGLYGDLTATLSALAGSGGTDHQGWIEELATAETMARDLEKAELVDDR
IPLHPMRVYAELAALLERDALVVIDAGDFGSYAGRMIDSYLPGCWLDSGPFGCLGSGPGY
ALAAKLARPQRQVVLLQGDGAFGFSGMEWDTLVRHNVAVVSVIGNNGIWGLEKHPMEALY
GYSVVAELRPGTRYDEVVRALGGHGELVSVPAELRPALERAFASGLPAVVNVLTDPSVAY
PRRSNLA
Download sequence
Identical sequences A0A045HK15 A0A083W4W0 A0A0H3LGJ2 A0A0H3MB66 A0A0K2HX80 A0A109SNG2 A0A197J4K3 A5U3I7 F8M9I3 I6XCK7 M8CMM7 P66947 P9WG38 P9WG39
gi|479055777|ref|YP_007351583.1| gi|506926298|ref|YP_008006748.1| gi|339631873|ref|YP_004723515.1| NP_216336.1.84033 WP_003409218.1.100000 WP_003409218.1.100021 WP_003409218.1.100069 WP_003409218.1.100087 WP_003409218.1.10015 WP_003409218.1.100208 WP_003409218.1.100216 WP_003409218.1.10022 WP_003409218.1.100255 WP_003409218.1.100260 WP_003409218.1.100270 WP_003409218.1.100279 WP_003409218.1.100286 WP_003409218.1.100308 WP_003409218.1.100309 WP_003409218.1.100318 WP_003409218.1.100337 WP_003409218.1.100338 WP_003409218.1.10037 WP_003409218.1.100383 WP_003409218.1.100395 WP_003409218.1.100396 WP_003409218.1.1004 WP_003409218.1.100401 WP_003409218.1.100459 WP_003409218.1.100460 WP_003409218.1.100552 WP_003409218.1.100581 WP_003409218.1.100600 WP_003409218.1.10064 WP_003409218.1.100666 WP_003409218.1.100671 WP_003409218.1.100677 WP_003409218.1.100682 WP_003409218.1.100697 WP_003409218.1.100703 WP_003409218.1.100716 WP_003409218.1.100722 WP_003409218.1.100754 WP_003409218.1.100757 WP_003409218.1.100772 WP_003409218.1.1008 WP_003409218.1.100812 WP_003409218.1.100845 WP_003409218.1.100866 WP_003409218.1.10088 WP_003409218.1.100889 WP_003409218.1.10090 WP_003409218.1.100910 WP_003409218.1.100918 WP_003409218.1.100935 WP_003409218.1.100984 WP_003409218.1.100992 WP_003409218.1.100998 WP_003409218.1.101 WP_003409218.1.101025 WP_003409218.1.101028 WP_003409218.1.10104 WP_003409218.1.101048 WP_003409218.1.101054 WP_003409218.1.101075 WP_003409218.1.101143 WP_003409218.1.101146 WP_003409218.1.10116 WP_003409218.1.10117 WP_003409218.1.101209 WP_003409218.1.10125 WP_003409218.1.101290 WP_003409218.1.101323 WP_003409218.1.101324 WP_003409218.1.101350 WP_003409218.1.101367 WP_003409218.1.101398 WP_003409218.1.101403 WP_003409218.1.101421 WP_003409218.1.10144 WP_003409218.1.101442 WP_003409218.1.10145 WP_003409218.1.101452 WP_003409218.1.101456 WP_003409218.1.101481 WP_003409218.1.101493 WP_003409218.1.101496 WP_003409218.1.101525 WP_003409218.1.101533 WP_003409218.1.101535 WP_003409218.1.101553 WP_003409218.1.101558 WP_003409218.1.10156 WP_003409218.1.101573 WP_003409218.1.101576 WP_003409218.1.10159 WP_003409218.1.101592 WP_003409218.1.101604 WP_003409218.1.101607 WP_003409218.1.101622 WP_003409218.1.101644 WP_003409218.1.101659 WP_003409218.1.101671 WP_003409218.1.101687 WP_003409218.1.101698 WP_003409218.1.10170 WP_003409218.1.101713 WP_003409218.1.101722 WP_003409218.1.101733 WP_003409218.1.101743 WP_003409218.1.101753 WP_003409218.1.101754 WP_003409218.1.101764 WP_003409218.1.101773 WP_003409218.1.101795 WP_003409218.1.101797 WP_003409218.1.101798 WP_003409218.1.101802 WP_003409218.1.101826 WP_003409218.1.101836 WP_003409218.1.101858 WP_003409218.1.101859 WP_003409218.1.101862 WP_003409218.1.101888 WP_003409218.1.101894 WP_003409218.1.101899 WP_003409218.1.1019 WP_003409218.1.101923 WP_003409218.1.101925 WP_003409218.1.10193 WP_003409218.1.101996 WP_003409218.1.102 WP_003409218.1.102008 WP_003409218.1.102017 WP_003409218.1.102053 WP_003409218.1.102055 WP_003409218.1.102063 WP_003409218.1.102099 WP_003409218.1.1021 WP_003409218.1.10211 WP_003409218.1.102119 WP_003409218.1.102121 WP_003409218.1.102143 WP_003409218.1.10216 WP_003409218.1.10224 WP_003409218.1.10253 WP_003409218.1.10262 WP_003409218.1.10272 WP_003409218.1.10277 WP_003409218.1.1033 WP_003409218.1.10350 WP_003409218.1.10362 WP_003409218.1.10366 WP_003409218.1.10376 WP_003409218.1.10396 WP_003409218.1.10410 WP_003409218.1.10414 WP_003409218.1.10421 WP_003409218.1.10430 WP_003409218.1.1044 WP_003409218.1.10440 WP_003409218.1.10445 WP_003409218.1.10472 WP_003409218.1.10489 WP_003409218.1.105 WP_003409218.1.10518 WP_003409218.1.10523 WP_003409218.1.10545 WP_003409218.1.1057 WP_003409218.1.10594 WP_003409218.1.10603 WP_003409218.1.10606 WP_003409218.1.10615 WP_003409218.1.10623 WP_003409218.1.10635 WP_003409218.1.10643 WP_003409218.1.10648 WP_003409218.1.10662 WP_003409218.1.10709 WP_003409218.1.10735 WP_003409218.1.10756 WP_003409218.1.1078 WP_003409218.1.10791 WP_003409218.1.10799 WP_003409218.1.10825 WP_003409218.1.10848 WP_003409218.1.10863 WP_003409218.1.10879 WP_003409218.1.10912 WP_003409218.1.10916 WP_003409218.1.10923 WP_003409218.1.10927 WP_003409218.1.1095 WP_003409218.1.10956 WP_003409218.1.10958 WP_003409218.1.10962 WP_003409218.1.10980 WP_003409218.1.10981 WP_003409218.1.10993 WP_003409218.1.1100 WP_003409218.1.11040 WP_003409218.1.11061 WP_003409218.1.11070 WP_003409218.1.11141 WP_003409218.1.11171 WP_003409218.1.11175 WP_003409218.1.11176 WP_003409218.1.11222 WP_003409218.1.11236 WP_003409218.1.11329 WP_003409218.1.1133 WP_003409218.1.11342 WP_003409218.1.11373 WP_003409218.1.11376 WP_003409218.1.11390 WP_003409218.1.11402 WP_003409218.1.11487 WP_003409218.1.11489 WP_003409218.1.11491 WP_003409218.1.11514 WP_003409218.1.11587 WP_003409218.1.11589 WP_003409218.1.11596 WP_003409218.1.11604 WP_003409218.1.11610 WP_003409218.1.11697 WP_003409218.1.11707 WP_003409218.1.11752 WP_003409218.1.11758 WP_003409218.1.11761 WP_003409218.1.11775 WP_003409218.1.11804 WP_003409218.1.11822 WP_003409218.1.11826 WP_003409218.1.11856 WP_003409218.1.11898 WP_003409218.1.11906 WP_003409218.1.11939 WP_003409218.1.11960 WP_003409218.1.11961 WP_003409218.1.11972 WP_003409218.1.11984 WP_003409218.1.120 WP_003409218.1.12001 WP_003409218.1.12049 WP_003409218.1.12052 WP_003409218.1.12100 WP_003409218.1.12116 WP_003409218.1.12130 WP_003409218.1.12161 WP_003409218.1.12165 WP_003409218.1.12184 WP_003409218.1.12187 WP_003409218.1.12190 WP_003409218.1.12216 WP_003409218.1.12265 WP_003409218.1.12275 WP_003409218.1.12293 WP_003409218.1.12294 WP_003409218.1.123 WP_003409218.1.1231 WP_003409218.1.12314 WP_003409218.1.12327 WP_003409218.1.12338 WP_003409218.1.1236 WP_003409218.1.12371 WP_003409218.1.12372 WP_003409218.1.12389 WP_003409218.1.12406 WP_003409218.1.1241 WP_003409218.1.12421 WP_003409218.1.12424 WP_003409218.1.12446 WP_003409218.1.12464 WP_003409218.1.12479 WP_003409218.1.12519 WP_003409218.1.12523 WP_003409218.1.12526 WP_003409218.1.1255 WP_003409218.1.12550 WP_003409218.1.12551 WP_003409218.1.12563 WP_003409218.1.12611 WP_003409218.1.12669 WP_003409218.1.1267 WP_003409218.1.12672 WP_003409218.1.12692 WP_003409218.1.1271 WP_003409218.1.12710 WP_003409218.1.12768 WP_003409218.1.1279 WP_003409218.1.12794 WP_003409218.1.12801 WP_003409218.1.12804 WP_003409218.1.12821 WP_003409218.1.12841 WP_003409218.1.12854 WP_003409218.1.12871 WP_003409218.1.12901 WP_003409218.1.12941 WP_003409218.1.12947 WP_003409218.1.12957 WP_003409218.1.12972 WP_003409218.1.13028 WP_003409218.1.13043 WP_003409218.1.13087 WP_003409218.1.13090 WP_003409218.1.13096 WP_003409218.1.13163 WP_003409218.1.13175 WP_003409218.1.13183 WP_003409218.1.132 WP_003409218.1.13249 WP_003409218.1.13282 WP_003409218.1.13284 WP_003409218.1.13296 WP_003409218.1.13298 WP_003409218.1.13302 WP_003409218.1.13306 WP_003409218.1.13312 WP_003409218.1.13313 WP_003409218.1.13321 WP_003409218.1.13345 WP_003409218.1.13358 WP_003409218.1.13370 WP_003409218.1.13375 WP_003409218.1.1338 WP_003409218.1.13420 WP_003409218.1.13433 WP_003409218.1.13435 WP_003409218.1.13438 WP_003409218.1.13461 WP_003409218.1.13466 WP_003409218.1.13489 WP_003409218.1.13526 WP_003409218.1.13551 WP_003409218.1.13561 WP_003409218.1.13564 WP_003409218.1.13579 WP_003409218.1.13647 WP_003409218.1.13667 WP_003409218.1.13697 WP_003409218.1.13719 WP_003409218.1.13763 WP_003409218.1.1377 WP_003409218.1.13774 WP_003409218.1.13786 WP_003409218.1.13793 WP_003409218.1.13794 WP_003409218.1.13817 WP_003409218.1.13834 WP_003409218.1.13866 WP_003409218.1.13899 WP_003409218.1.13909 WP_003409218.1.13910 WP_003409218.1.13919 WP_003409218.1.13920 WP_003409218.1.13952 WP_003409218.1.13953 WP_003409218.1.13962 WP_003409218.1.1398 WP_003409218.1.13988 WP_003409218.1.14027 WP_003409218.1.14046 WP_003409218.1.14115 WP_003409218.1.1415 WP_003409218.1.14152 WP_003409218.1.14158 WP_003409218.1.14162 WP_003409218.1.14175 WP_003409218.1.14178 WP_003409218.1.14194 WP_003409218.1.14195 WP_003409218.1.14208 WP_003409218.1.14238 WP_003409218.1.14266 WP_003409218.1.14273 WP_003409218.1.14303 WP_003409218.1.14306 WP_003409218.1.14307 WP_003409218.1.14310 WP_003409218.1.14341 WP_003409218.1.14382 WP_003409218.1.14428 WP_003409218.1.14441 WP_003409218.1.14469 WP_003409218.1.14477 WP_003409218.1.14504 WP_003409218.1.14514 WP_003409218.1.1452 WP_003409218.1.14527 WP_003409218.1.1454 WP_003409218.1.14544 WP_003409218.1.14548 WP_003409218.1.14551 WP_003409218.1.14561 WP_003409218.1.14573 WP_003409218.1.1462 WP_003409218.1.14658 WP_003409218.1.14667 WP_003409218.1.14668 WP_003409218.1.14675 WP_003409218.1.14694 WP_003409218.1.14695 WP_003409218.1.14709 WP_003409218.1.14766 WP_003409218.1.14783 WP_003409218.1.14865 WP_003409218.1.14872 WP_003409218.1.14905 WP_003409218.1.14926 WP_003409218.1.14951 WP_003409218.1.14955 WP_003409218.1.15003 WP_003409218.1.15009 WP_003409218.1.15028 WP_003409218.1.15040 WP_003409218.1.15052 WP_003409218.1.15065 WP_003409218.1.15072 WP_003409218.1.15089 WP_003409218.1.1509 WP_003409218.1.15126 WP_003409218.1.15131 WP_003409218.1.15168 WP_003409218.1.15174 WP_003409218.1.15187 WP_003409218.1.15196 WP_003409218.1.15210 WP_003409218.1.15216 WP_003409218.1.15217 WP_003409218.1.1523 WP_003409218.1.15232 WP_003409218.1.15240 WP_003409218.1.15253 WP_003409218.1.15267 WP_003409218.1.1527 WP_003409218.1.15299 WP_003409218.1.15302 WP_003409218.1.15322 WP_003409218.1.1534 WP_003409218.1.15345 WP_003409218.1.15365 WP_003409218.1.15372 WP_003409218.1.15386 WP_003409218.1.15387 WP_003409218.1.15442 WP_003409218.1.15447 WP_003409218.1.15449 WP_003409218.1.15477 WP_003409218.1.15481 WP_003409218.1.15492 WP_003409218.1.15511 WP_003409218.1.15512 WP_003409218.1.15558 WP_003409218.1.15559 WP_003409218.1.15566 WP_003409218.1.15599 WP_003409218.1.1560 WP_003409218.1.15611 WP_003409218.1.1563 WP_003409218.1.15633 WP_003409218.1.15643 WP_003409218.1.15688 WP_003409218.1.15755 WP_003409218.1.15763 WP_003409218.1.15774 WP_003409218.1.1578 WP_003409218.1.15780 WP_003409218.1.15834 WP_003409218.1.15842 WP_003409218.1.15848 WP_003409218.1.15853 WP_003409218.1.15870 WP_003409218.1.15877 WP_003409218.1.15893 WP_003409218.1.15896 WP_003409218.1.15926 WP_003409218.1.15933 WP_003409218.1.15946 WP_003409218.1.15958 WP_003409218.1.15973 WP_003409218.1.15987 WP_003409218.1.15993 WP_003409218.1.16009 WP_003409218.1.16025 WP_003409218.1.16043 WP_003409218.1.16055 WP_003409218.1.16066 WP_003409218.1.16069 WP_003409218.1.16077 WP_003409218.1.16106 WP_003409218.1.16108 WP_003409218.1.16110 WP_003409218.1.16130 WP_003409218.1.16136 WP_003409218.1.16139 WP_003409218.1.16141 WP_003409218.1.16143 WP_003409218.1.1630 WP_003409218.1.16318 WP_003409218.1.1632 WP_003409218.1.16327 WP_003409218.1.16334 WP_003409218.1.16341 WP_003409218.1.16345 WP_003409218.1.16374 WP_003409218.1.16384 WP_003409218.1.16386 WP_003409218.1.164 WP_003409218.1.1642 WP_003409218.1.16421 WP_003409218.1.16424 WP_003409218.1.16426 WP_003409218.1.16431 WP_003409218.1.16438 WP_003409218.1.1644 WP_003409218.1.16442 WP_003409218.1.16448 WP_003409218.1.16451 WP_003409218.1.16476 WP_003409218.1.16480 WP_003409218.1.16494 WP_003409218.1.1652 WP_003409218.1.16549 WP_003409218.1.16560 WP_003409218.1.16598 WP_003409218.1.16609 WP_003409218.1.16619 WP_003409218.1.16620 WP_003409218.1.16622 WP_003409218.1.16637 WP_003409218.1.16707 WP_003409218.1.16724 WP_003409218.1.16731 WP_003409218.1.16743 WP_003409218.1.1683 WP_003409218.1.16837 WP_003409218.1.16852 WP_003409218.1.16937 WP_003409218.1.16940 WP_003409218.1.16950 WP_003409218.1.16959 WP_003409218.1.16968 WP_003409218.1.1697 WP_003409218.1.16973 WP_003409218.1.16977 WP_003409218.1.16987 WP_003409218.1.17006 WP_003409218.1.17010 WP_003409218.1.17015 WP_003409218.1.17019 WP_003409218.1.17039 WP_003409218.1.17041 WP_003409218.1.17052 WP_003409218.1.17057 WP_003409218.1.17062 WP_003409218.1.1707 WP_003409218.1.17094 WP_003409218.1.17130 WP_003409218.1.17138 WP_003409218.1.17147 WP_003409218.1.17167 WP_003409218.1.17224 WP_003409218.1.17251 WP_003409218.1.17288 WP_003409218.1.17304 WP_003409218.1.17314 WP_003409218.1.17345 WP_003409218.1.17381 WP_003409218.1.17391 WP_003409218.1.17412 WP_003409218.1.1743 WP_003409218.1.17440 WP_003409218.1.17466 WP_003409218.1.17477 WP_003409218.1.17483 WP_003409218.1.17505 WP_003409218.1.17527 WP_003409218.1.17535 WP_003409218.1.17540 WP_003409218.1.17553 WP_003409218.1.17558 WP_003409218.1.17599 WP_003409218.1.17635 WP_003409218.1.17655 WP_003409218.1.17679 WP_003409218.1.1768 WP_003409218.1.17687 WP_003409218.1.17700 WP_003409218.1.17710 WP_003409218.1.17713 WP_003409218.1.17722 WP_003409218.1.17746 WP_003409218.1.17788 WP_003409218.1.17798 WP_003409218.1.17803 WP_003409218.1.17816 WP_003409218.1.17821 WP_003409218.1.17830 WP_003409218.1.17868 WP_003409218.1.17878 WP_003409218.1.1792 WP_003409218.1.17923 WP_003409218.1.1795 WP_003409218.1.17955 WP_003409218.1.17973 WP_003409218.1.18009 WP_003409218.1.18013 WP_003409218.1.18033 WP_003409218.1.18057 WP_003409218.1.18065 WP_003409218.1.18070 WP_003409218.1.18116 WP_003409218.1.18120 WP_003409218.1.18126 WP_003409218.1.1817 WP_003409218.1.18170 WP_003409218.1.18206 WP_003409218.1.18216 WP_003409218.1.18240 WP_003409218.1.18257 WP_003409218.1.18297 WP_003409218.1.18306 WP_003409218.1.18364 WP_003409218.1.18399 WP_003409218.1.18411 WP_003409218.1.18444 WP_003409218.1.18448 WP_003409218.1.18467 WP_003409218.1.18476 WP_003409218.1.18522 WP_003409218.1.18580 WP_003409218.1.18582 WP_003409218.1.18587 WP_003409218.1.186 WP_003409218.1.18601 WP_003409218.1.18639 WP_003409218.1.18646 WP_003409218.1.18647 WP_003409218.1.1868 WP_003409218.1.18694 WP_003409218.1.18710 WP_003409218.1.18751 WP_003409218.1.18781 WP_003409218.1.18793 WP_003409218.1.18804 WP_003409218.1.18816 WP_003409218.1.18823 WP_003409218.1.18827 WP_003409218.1.18838 WP_003409218.1.18849 WP_003409218.1.18856 WP_003409218.1.18945 WP_003409218.1.1898 WP_003409218.1.19005 WP_003409218.1.19056 WP_003409218.1.19063 WP_003409218.1.19066 WP_003409218.1.19071 WP_003409218.1.19085 WP_003409218.1.19094 WP_003409218.1.19144 WP_003409218.1.19159 WP_003409218.1.19193 WP_003409218.1.19231 WP_003409218.1.19243 WP_003409218.1.19264 WP_003409218.1.19295 WP_003409218.1.19326 WP_003409218.1.1933 WP_003409218.1.19364 WP_003409218.1.19382 WP_003409218.1.19400 WP_003409218.1.19426 WP_003409218.1.19429 WP_003409218.1.19464 WP_003409218.1.19480 WP_003409218.1.19512 WP_003409218.1.19553 WP_003409218.1.19562 WP_003409218.1.19564 WP_003409218.1.19568 WP_003409218.1.19572 WP_003409218.1.19595 WP_003409218.1.19596 WP_003409218.1.19600 WP_003409218.1.1967 WP_003409218.1.19694 WP_003409218.1.1970 WP_003409218.1.19707 WP_003409218.1.19742 WP_003409218.1.19785 WP_003409218.1.19820 WP_003409218.1.19868 WP_003409218.1.19874 WP_003409218.1.19890 WP_003409218.1.19900 WP_003409218.1.19922 WP_003409218.1.19936 WP_003409218.1.19946 WP_003409218.1.19949 WP_003409218.1.19960 WP_003409218.1.19964 WP_003409218.1.20007 WP_003409218.1.20016 WP_003409218.1.20028 WP_003409218.1.2003 WP_003409218.1.20037 WP_003409218.1.20039 WP_003409218.1.20082 WP_003409218.1.20085 WP_003409218.1.20097 WP_003409218.1.20116 WP_003409218.1.20130 WP_003409218.1.20140 WP_003409218.1.20141 WP_003409218.1.20142 WP_003409218.1.20158 WP_003409218.1.20239 WP_003409218.1.20243 WP_003409218.1.20259 WP_003409218.1.20262 WP_003409218.1.20268 WP_003409218.1.20272 WP_003409218.1.20273 WP_003409218.1.20280 WP_003409218.1.20294 WP_003409218.1.20300 WP_003409218.1.20309 WP_003409218.1.20322 WP_003409218.1.2037 WP_003409218.1.20372 WP_003409218.1.20381 WP_003409218.1.204 WP_003409218.1.20427 WP_003409218.1.20432 WP_003409218.1.20457 WP_003409218.1.20459 WP_003409218.1.20460 WP_003409218.1.20542 WP_003409218.1.20578 WP_003409218.1.20608 WP_003409218.1.20624 WP_003409218.1.20628 WP_003409218.1.2066 WP_003409218.1.20707 WP_003409218.1.20722 WP_003409218.1.20729 WP_003409218.1.20742 WP_003409218.1.20751 WP_003409218.1.20776 WP_003409218.1.20843 WP_003409218.1.20850 WP_003409218.1.2086 WP_003409218.1.20868 WP_003409218.1.20876 WP_003409218.1.20897 WP_003409218.1.20898 WP_003409218.1.2090 WP_003409218.1.20911 WP_003409218.1.20916 WP_003409218.1.20921 WP_003409218.1.20926 WP_003409218.1.20927 WP_003409218.1.20951 WP_003409218.1.20970 WP_003409218.1.2104 WP_003409218.1.21127 WP_003409218.1.21135 WP_003409218.1.21173 WP_003409218.1.21187 WP_003409218.1.212 WP_003409218.1.2120 WP_003409218.1.21218 WP_003409218.1.21219 WP_003409218.1.2123 WP_003409218.1.21231 WP_003409218.1.21234 WP_003409218.1.2126 WP_003409218.1.21292 WP_003409218.1.21307 WP_003409218.1.2131 WP_003409218.1.21311 WP_003409218.1.21321 WP_003409218.1.21365 WP_003409218.1.2137 WP_003409218.1.21392 WP_003409218.1.21397 WP_003409218.1.21403 WP_003409218.1.21415 WP_003409218.1.21418 WP_003409218.1.21430 WP_003409218.1.21434 WP_003409218.1.21444 WP_003409218.1.21468 WP_003409218.1.21498 WP_003409218.1.21509 WP_003409218.1.21513 WP_003409218.1.21560 WP_003409218.1.21565 WP_003409218.1.21586 WP_003409218.1.21591 WP_003409218.1.21594 WP_003409218.1.21602 WP_003409218.1.21615 WP_003409218.1.21638 WP_003409218.1.21639 WP_003409218.1.21655 WP_003409218.1.2168 WP_003409218.1.2174 WP_003409218.1.21741 WP_003409218.1.21742 WP_003409218.1.21777 WP_003409218.1.21786 WP_003409218.1.21795 WP_003409218.1.218 WP_003409218.1.21826 WP_003409218.1.21829 WP_003409218.1.21840 WP_003409218.1.21843 WP_003409218.1.21872 WP_003409218.1.21873 WP_003409218.1.2188 WP_003409218.1.21882 WP_003409218.1.21906 WP_003409218.1.21912 WP_003409218.1.2194 WP_003409218.1.21941 WP_003409218.1.21956 WP_003409218.1.21958 WP_003409218.1.21960 WP_003409218.1.21971 WP_003409218.1.21973 WP_003409218.1.21983 WP_003409218.1.22003 WP_003409218.1.22013 WP_003409218.1.22025 WP_003409218.1.22036 WP_003409218.1.22075 WP_003409218.1.22092 WP_003409218.1.2212 WP_003409218.1.22127 WP_003409218.1.22140 WP_003409218.1.22233 WP_003409218.1.22255 WP_003409218.1.22277 WP_003409218.1.22305 WP_003409218.1.22348 WP_003409218.1.22356 WP_003409218.1.22366 WP_003409218.1.2238 WP_003409218.1.22380 WP_003409218.1.22437 WP_003409218.1.22438 WP_003409218.1.22445 WP_003409218.1.22490 WP_003409218.1.22511 WP_003409218.1.22524 WP_003409218.1.2253 WP_003409218.1.22585 WP_003409218.1.22589 WP_003409218.1.22606 WP_003409218.1.22608 WP_003409218.1.22609 WP_003409218.1.22618 WP_003409218.1.2262 WP_003409218.1.22624 WP_003409218.1.22629 WP_003409218.1.22647 WP_003409218.1.22664 WP_003409218.1.22665 WP_003409218.1.22670 WP_003409218.1.22674 WP_003409218.1.22680 WP_003409218.1.22725 WP_003409218.1.22728 WP_003409218.1.22733 WP_003409218.1.22737 WP_003409218.1.2275 WP_003409218.1.22754 WP_003409218.1.22797 WP_003409218.1.22800 WP_003409218.1.22804 WP_003409218.1.22829 WP_003409218.1.22840 WP_003409218.1.22844 WP_003409218.1.22963 WP_003409218.1.22970 WP_003409218.1.22996 WP_003409218.1.22997 WP_003409218.1.22999 WP_003409218.1.23015 WP_003409218.1.23032 WP_003409218.1.231 WP_003409218.1.23101 WP_003409218.1.2312 WP_003409218.1.23140 WP_003409218.1.23153 WP_003409218.1.23171 WP_003409218.1.23199 WP_003409218.1.2320 WP_003409218.1.23204 WP_003409218.1.23216 WP_003409218.1.23229 WP_003409218.1.23233 WP_003409218.1.2326 WP_003409218.1.23261 WP_003409218.1.23272 WP_003409218.1.23289 WP_003409218.1.2329 WP_003409218.1.23308 WP_003409218.1.23316 WP_003409218.1.23321 WP_003409218.1.23325 WP_003409218.1.2339 WP_003409218.1.23406 WP_003409218.1.23438 WP_003409218.1.23445 WP_003409218.1.23447 WP_003409218.1.23452 WP_003409218.1.23461 WP_003409218.1.2349 WP_003409218.1.23496 WP_003409218.1.23497 WP_003409218.1.23506 WP_003409218.1.23530 WP_003409218.1.23539 WP_003409218.1.23546 WP_003409218.1.23551 WP_003409218.1.23573 WP_003409218.1.23583 WP_003409218.1.23588 WP_003409218.1.23628 WP_003409218.1.23677 WP_003409218.1.23683 WP_003409218.1.23692 WP_003409218.1.23694 WP_003409218.1.23699 WP_003409218.1.2371 WP_003409218.1.23803 WP_003409218.1.23807 WP_003409218.1.23825 WP_003409218.1.23832 WP_003409218.1.2384 WP_003409218.1.23843 WP_003409218.1.23863 WP_003409218.1.2387 WP_003409218.1.23894 WP_003409218.1.23993 WP_003409218.1.2400 WP_003409218.1.24007 WP_003409218.1.24008 WP_003409218.1.24046 WP_003409218.1.24057 WP_003409218.1.24062 WP_003409218.1.24113 WP_003409218.1.24119 WP_003409218.1.24128 WP_003409218.1.24140 WP_003409218.1.24176 WP_003409218.1.24190 WP_003409218.1.24202 WP_003409218.1.24244 WP_003409218.1.24261 WP_003409218.1.24284 WP_003409218.1.24294 WP_003409218.1.24357 WP_003409218.1.24396 WP_003409218.1.24414 WP_003409218.1.24423 WP_003409218.1.2443 WP_003409218.1.24446 WP_003409218.1.24461 WP_003409218.1.24500 WP_003409218.1.24507 WP_003409218.1.24509 WP_003409218.1.24529 WP_003409218.1.24553 WP_003409218.1.24599 WP_003409218.1.24629 WP_003409218.1.24638 WP_003409218.1.24648 WP_003409218.1.2466 WP_003409218.1.24767 WP_003409218.1.24824 WP_003409218.1.24831 WP_003409218.1.24840 WP_003409218.1.24848 WP_003409218.1.24857 WP_003409218.1.2487 WP_003409218.1.24893 WP_003409218.1.24907 WP_003409218.1.24933 WP_003409218.1.24956 WP_003409218.1.24958 WP_003409218.1.24985 WP_003409218.1.2499 WP_003409218.1.25004 WP_003409218.1.2505 WP_003409218.1.25051 WP_003409218.1.2507 WP_003409218.1.25103 WP_003409218.1.25129 WP_003409218.1.25171 WP_003409218.1.25184 WP_003409218.1.25247 WP_003409218.1.25252 WP_003409218.1.25278 WP_003409218.1.25283 WP_003409218.1.25309 WP_003409218.1.25313 WP_003409218.1.25338 WP_003409218.1.25342 WP_003409218.1.25343 WP_003409218.1.25367 WP_003409218.1.25393 WP_003409218.1.25406 WP_003409218.1.25435 WP_003409218.1.25437 WP_003409218.1.25445 WP_003409218.1.25455 WP_003409218.1.25473 WP_003409218.1.25504 WP_003409218.1.25513 WP_003409218.1.25542 WP_003409218.1.25579 WP_003409218.1.25594 WP_003409218.1.25606 WP_003409218.1.25645 WP_003409218.1.2566 WP_003409218.1.25673 WP_003409218.1.25674 WP_003409218.1.25693 WP_003409218.1.25699 WP_003409218.1.25727 WP_003409218.1.25736 WP_003409218.1.25738 WP_003409218.1.25756 WP_003409218.1.25759 WP_003409218.1.2580 WP_003409218.1.25813 WP_003409218.1.25853 WP_003409218.1.25854 WP_003409218.1.25874 WP_003409218.1.25885 WP_003409218.1.25892 WP_003409218.1.25906 WP_003409218.1.25914 WP_003409218.1.25916 WP_003409218.1.2594 WP_003409218.1.25954 WP_003409218.1.25965 WP_003409218.1.25972 WP_003409218.1.26017 WP_003409218.1.26032 WP_003409218.1.26038 WP_003409218.1.26072 WP_003409218.1.26089 WP_003409218.1.26097 WP_003409218.1.26098 WP_003409218.1.26108 WP_003409218.1.26109 WP_003409218.1.26118 WP_003409218.1.26126 WP_003409218.1.2614 WP_003409218.1.26168 WP_003409218.1.26182 WP_003409218.1.26190 WP_003409218.1.2620 WP_003409218.1.26234 WP_003409218.1.26243 WP_003409218.1.26265 WP_003409218.1.26267 WP_003409218.1.26292 WP_003409218.1.26310 WP_003409218.1.26328 WP_003409218.1.26349 WP_003409218.1.26366 WP_003409218.1.26374 WP_003409218.1.26407 WP_003409218.1.26412 WP_003409218.1.26454 WP_003409218.1.26464 WP_003409218.1.2653 WP_003409218.1.26560 WP_003409218.1.26571 WP_003409218.1.2659 WP_003409218.1.26597 WP_003409218.1.26603 WP_003409218.1.26629 WP_003409218.1.26651 WP_003409218.1.26702 WP_003409218.1.26707 WP_003409218.1.26710 WP_003409218.1.26719 WP_003409218.1.26737 WP_003409218.1.26738 WP_003409218.1.26756 WP_003409218.1.2676 WP_003409218.1.2677 WP_003409218.1.26779 WP_003409218.1.26780 WP_003409218.1.26798 WP_003409218.1.26854 WP_003409218.1.26868 WP_003409218.1.26876 WP_003409218.1.26888 WP_003409218.1.26914 WP_003409218.1.26945 WP_003409218.1.26959 WP_003409218.1.26969 WP_003409218.1.26984 WP_003409218.1.26992 WP_003409218.1.27004 WP_003409218.1.27017 WP_003409218.1.27045 WP_003409218.1.27074 WP_003409218.1.27075 WP_003409218.1.27128 WP_003409218.1.27130 WP_003409218.1.27139 WP_003409218.1.27152 WP_003409218.1.27162 WP_003409218.1.27164 WP_003409218.1.27193 WP_003409218.1.27235 WP_003409218.1.27254 WP_003409218.1.27278 WP_003409218.1.27343 WP_003409218.1.27352 WP_003409218.1.27369 WP_003409218.1.27391 WP_003409218.1.27398 WP_003409218.1.27402 WP_003409218.1.27410 WP_003409218.1.27411 WP_003409218.1.27449 WP_003409218.1.27460 WP_003409218.1.27463 WP_003409218.1.2749 WP_003409218.1.27492 WP_003409218.1.27528 WP_003409218.1.27541 WP_003409218.1.27576 WP_003409218.1.27582 WP_003409218.1.27596 WP_003409218.1.27607 WP_003409218.1.2766 WP_003409218.1.277 WP_003409218.1.27724 WP_003409218.1.27730 WP_003409218.1.27736 WP_003409218.1.27743 WP_003409218.1.27750 WP_003409218.1.27771 WP_003409218.1.27779 WP_003409218.1.27795 WP_003409218.1.27803 WP_003409218.1.27819 WP_003409218.1.27835 WP_003409218.1.27915 WP_003409218.1.27935 WP_003409218.1.27962 WP_003409218.1.28053 WP_003409218.1.28092 WP_003409218.1.28106 WP_003409218.1.28131 WP_003409218.1.28142 WP_003409218.1.28159 WP_003409218.1.2816 WP_003409218.1.28161 WP_003409218.1.28192 WP_003409218.1.28202 WP_003409218.1.28241 WP_003409218.1.28251 WP_003409218.1.28255 WP_003409218.1.28269 WP_003409218.1.28276 WP_003409218.1.28293 WP_003409218.1.28331 WP_003409218.1.28367 WP_003409218.1.28378 WP_003409218.1.28391 WP_003409218.1.2842 WP_003409218.1.28448 WP_003409218.1.2847 WP_003409218.1.28471 WP_003409218.1.28473 WP_003409218.1.28493 WP_003409218.1.28497 WP_003409218.1.28530 WP_003409218.1.28545 WP_003409218.1.28561 WP_003409218.1.28567 WP_003409218.1.28585 WP_003409218.1.286 WP_003409218.1.28610 WP_003409218.1.28617 WP_003409218.1.28634 WP_003409218.1.28642 WP_003409218.1.28671 WP_003409218.1.28682 WP_003409218.1.28698 WP_003409218.1.28703 WP_003409218.1.28739 WP_003409218.1.28758 WP_003409218.1.28781 WP_003409218.1.28787 WP_003409218.1.28839 WP_003409218.1.28847 WP_003409218.1.28850 WP_003409218.1.28851 WP_003409218.1.28865 WP_003409218.1.28897 WP_003409218.1.28914 WP_003409218.1.28935 WP_003409218.1.28936 WP_003409218.1.28939 WP_003409218.1.28943 WP_003409218.1.28952 WP_003409218.1.28975 WP_003409218.1.2899 WP_003409218.1.28993 WP_003409218.1.29000 WP_003409218.1.2901 WP_003409218.1.29028 WP_003409218.1.29033 WP_003409218.1.29058 WP_003409218.1.29078 WP_003409218.1.29102 WP_003409218.1.29115 WP_003409218.1.2916 WP_003409218.1.29217 WP_003409218.1.29223 WP_003409218.1.29264 WP_003409218.1.29275 WP_003409218.1.29339 WP_003409218.1.29348 WP_003409218.1.29364 WP_003409218.1.29367 WP_003409218.1.2938 WP_003409218.1.29399 WP_003409218.1.29426 WP_003409218.1.2944 WP_003409218.1.29449 WP_003409218.1.29450 WP_003409218.1.29452 WP_003409218.1.2949 WP_003409218.1.29510 WP_003409218.1.29515 WP_003409218.1.29525 WP_003409218.1.2953 WP_003409218.1.29559 WP_003409218.1.29587 WP_003409218.1.2959 WP_003409218.1.29592 WP_003409218.1.29599 WP_003409218.1.29611 WP_003409218.1.29632 WP_003409218.1.29649 WP_003409218.1.2965 WP_003409218.1.29659 WP_003409218.1.2969 WP_003409218.1.29696 WP_003409218.1.29698 WP_003409218.1.29718 WP_003409218.1.29742 WP_003409218.1.29745 WP_003409218.1.29747 WP_003409218.1.29769 WP_003409218.1.29825 WP_003409218.1.29830 WP_003409218.1.29847 WP_003409218.1.29861 WP_003409218.1.29869 WP_003409218.1.29883 WP_003409218.1.29890 WP_003409218.1.29931 WP_003409218.1.30014 WP_003409218.1.3004 WP_003409218.1.30040 WP_003409218.1.30043 WP_003409218.1.30074 WP_003409218.1.30097 WP_003409218.1.30101 WP_003409218.1.30106 WP_003409218.1.30114 WP_003409218.1.30126 WP_003409218.1.30131 WP_003409218.1.30138 WP_003409218.1.30139 WP_003409218.1.30145 WP_003409218.1.30211 WP_003409218.1.30224 WP_003409218.1.30235 WP_003409218.1.30237 WP_003409218.1.3027 WP_003409218.1.30279 WP_003409218.1.30282 WP_003409218.1.30283 WP_003409218.1.30288 WP_003409218.1.30291 WP_003409218.1.30363 WP_003409218.1.30374 WP_003409218.1.30404 WP_003409218.1.3043 WP_003409218.1.30433 WP_003409218.1.30438 WP_003409218.1.30462 WP_003409218.1.30464 WP_003409218.1.30468 WP_003409218.1.30500 WP_003409218.1.30574 WP_003409218.1.30628 WP_003409218.1.30641 WP_003409218.1.30642 WP_003409218.1.30661 WP_003409218.1.30669 WP_003409218.1.30683 WP_003409218.1.30699 WP_003409218.1.30709 WP_003409218.1.30713 WP_003409218.1.30716 WP_003409218.1.30719 WP_003409218.1.30730 WP_003409218.1.30732 WP_003409218.1.30736 WP_003409218.1.30745 WP_003409218.1.30760 WP_003409218.1.30791 WP_003409218.1.308 WP_003409218.1.30807 WP_003409218.1.30818 WP_003409218.1.30824 WP_003409218.1.30848 WP_003409218.1.30877 WP_003409218.1.30888 WP_003409218.1.30901 WP_003409218.1.30903 WP_003409218.1.30912 WP_003409218.1.30913 WP_003409218.1.30914 WP_003409218.1.30919 WP_003409218.1.30977 WP_003409218.1.3100 WP_003409218.1.31002 WP_003409218.1.3101 WP_003409218.1.31034 WP_003409218.1.31047 WP_003409218.1.31070 WP_003409218.1.31074 WP_003409218.1.31102 WP_003409218.1.31127 WP_003409218.1.31184 WP_003409218.1.31199 WP_003409218.1.31226 WP_003409218.1.31230 WP_003409218.1.31233 WP_003409218.1.31263 WP_003409218.1.31264 WP_003409218.1.31270 WP_003409218.1.31287 WP_003409218.1.31290 WP_003409218.1.31304 WP_003409218.1.31346 WP_003409218.1.31348 WP_003409218.1.31354 WP_003409218.1.31390 WP_003409218.1.31414 WP_003409218.1.31417 WP_003409218.1.31428 WP_003409218.1.3143 WP_003409218.1.31458 WP_003409218.1.31483 WP_003409218.1.3149 WP_003409218.1.31498 WP_003409218.1.31507 WP_003409218.1.31537 WP_003409218.1.31548 WP_003409218.1.31569 WP_003409218.1.31573 WP_003409218.1.316 WP_003409218.1.31629 WP_003409218.1.31666 WP_003409218.1.31693 WP_003409218.1.31703 WP_003409218.1.31744 WP_003409218.1.31745 WP_003409218.1.31770 WP_003409218.1.31776 WP_003409218.1.31783 WP_003409218.1.318 WP_003409218.1.3184 WP_003409218.1.31840 WP_003409218.1.31880 WP_003409218.1.31911 WP_003409218.1.31930 WP_003409218.1.31932 WP_003409218.1.31955 WP_003409218.1.31985 WP_003409218.1.31991 WP_003409218.1.31995 WP_003409218.1.32004 WP_003409218.1.32039 WP_003409218.1.3204 WP_003409218.1.32045 WP_003409218.1.32071 WP_003409218.1.32098 WP_003409218.1.32132 WP_003409218.1.32157 WP_003409218.1.32164 WP_003409218.1.32179 WP_003409218.1.32198 WP_003409218.1.32297 WP_003409218.1.32317 WP_003409218.1.32383 WP_003409218.1.32400 WP_003409218.1.32403 WP_003409218.1.32416 WP_003409218.1.32433 WP_003409218.1.32461 WP_003409218.1.32482 WP_003409218.1.32503 WP_003409218.1.32556 WP_003409218.1.32562 WP_003409218.1.32569 WP_003409218.1.32592 WP_003409218.1.32620 WP_003409218.1.32647 WP_003409218.1.32653 WP_003409218.1.32654 WP_003409218.1.3268 WP_003409218.1.32695 WP_003409218.1.32706 WP_003409218.1.32716 WP_003409218.1.32738 WP_003409218.1.32752 WP_003409218.1.32780 WP_003409218.1.32781 WP_003409218.1.32793 WP_003409218.1.32799 WP_003409218.1.32822 WP_003409218.1.32833 WP_003409218.1.32862 WP_003409218.1.32880 WP_003409218.1.32897 WP_003409218.1.32909 WP_003409218.1.32935 WP_003409218.1.32974 WP_003409218.1.33007 WP_003409218.1.3302 WP_003409218.1.33028 WP_003409218.1.33035 WP_003409218.1.33044 WP_003409218.1.33054 WP_003409218.1.33082 WP_003409218.1.33141 WP_003409218.1.33148 WP_003409218.1.33155 WP_003409218.1.33168 WP_003409218.1.3321 WP_003409218.1.33215 WP_003409218.1.3325 WP_003409218.1.3327 WP_003409218.1.33278 WP_003409218.1.33288 WP_003409218.1.33305 WP_003409218.1.3331 WP_003409218.1.33319 WP_003409218.1.3333 WP_003409218.1.33393 WP_003409218.1.33403 WP_003409218.1.33452 WP_003409218.1.33467 WP_003409218.1.33477 WP_003409218.1.3349 WP_003409218.1.33519 WP_003409218.1.33542 WP_003409218.1.33601 WP_003409218.1.33602 WP_003409218.1.33633 WP_003409218.1.33646 WP_003409218.1.33673 WP_003409218.1.3369 WP_003409218.1.33705 WP_003409218.1.33762 WP_003409218.1.33783 WP_003409218.1.33789 WP_003409218.1.3383 WP_003409218.1.33832 WP_003409218.1.33839 WP_003409218.1.33848 WP_003409218.1.3387 WP_003409218.1.33886 WP_003409218.1.33895 WP_003409218.1.33906 WP_003409218.1.33912 WP_003409218.1.33954 WP_003409218.1.3399 WP_003409218.1.34042 WP_003409218.1.3405 WP_003409218.1.34055 WP_003409218.1.34056 WP_003409218.1.34065 WP_003409218.1.3408 WP_003409218.1.34090 WP_003409218.1.34109 WP_003409218.1.34111 WP_003409218.1.34131 WP_003409218.1.34152 WP_003409218.1.34153 WP_003409218.1.34163 WP_003409218.1.34181 WP_003409218.1.34197 WP_003409218.1.34198 WP_003409218.1.34215 WP_003409218.1.34219 WP_003409218.1.34255 WP_003409218.1.34260 WP_003409218.1.34275 WP_003409218.1.343 WP_003409218.1.34347 WP_003409218.1.34358 WP_003409218.1.34392 WP_003409218.1.344 WP_003409218.1.34428 WP_003409218.1.3443 WP_003409218.1.34435 WP_003409218.1.34446 WP_003409218.1.34499 WP_003409218.1.34505 WP_003409218.1.34516 WP_003409218.1.34529 WP_003409218.1.34551 WP_003409218.1.34563 WP_003409218.1.34576 WP_003409218.1.34581 WP_003409218.1.34588 WP_003409218.1.34596 WP_003409218.1.34599 WP_003409218.1.34639 WP_003409218.1.34673 WP_003409218.1.34724 WP_003409218.1.34740 WP_003409218.1.34755 WP_003409218.1.34777 WP_003409218.1.34783 WP_003409218.1.34841 WP_003409218.1.34908 WP_003409218.1.34919 WP_003409218.1.3492 WP_003409218.1.34933 WP_003409218.1.34945 WP_003409218.1.34946 WP_003409218.1.34954 WP_003409218.1.34960 WP_003409218.1.34961 WP_003409218.1.34963 WP_003409218.1.34965 WP_003409218.1.34968 WP_003409218.1.35023 WP_003409218.1.35069 WP_003409218.1.35072 WP_003409218.1.35078 WP_003409218.1.35100 WP_003409218.1.35146 WP_003409218.1.35156 WP_003409218.1.35160 WP_003409218.1.35162 WP_003409218.1.35173 WP_003409218.1.35176 WP_003409218.1.3520 WP_003409218.1.35213 WP_003409218.1.35221 WP_003409218.1.35246 WP_003409218.1.35278 WP_003409218.1.35301 WP_003409218.1.35311 WP_003409218.1.35312 WP_003409218.1.35317 WP_003409218.1.35319 WP_003409218.1.35347 WP_003409218.1.35363 WP_003409218.1.35382 WP_003409218.1.35385 WP_003409218.1.35397 WP_003409218.1.35426 WP_003409218.1.35439 WP_003409218.1.35455 WP_003409218.1.3548 WP_003409218.1.35484 WP_003409218.1.35492 WP_003409218.1.3553 WP_003409218.1.35553 WP_003409218.1.35555 WP_003409218.1.35561 WP_003409218.1.35602 WP_003409218.1.35610 WP_003409218.1.35635 WP_003409218.1.35657 WP_003409218.1.35680 WP_003409218.1.35687 WP_003409218.1.35689 WP_003409218.1.35707 WP_003409218.1.35732 WP_003409218.1.35754 WP_003409218.1.35767 WP_003409218.1.35770 WP_003409218.1.35771 WP_003409218.1.35780 WP_003409218.1.35805 WP_003409218.1.35811 WP_003409218.1.35821 WP_003409218.1.3584 WP_003409218.1.35848 WP_003409218.1.35864 WP_003409218.1.35874 WP_003409218.1.35876 WP_003409218.1.35897 WP_003409218.1.35899 WP_003409218.1.35923 WP_003409218.1.3593 WP_003409218.1.35954 WP_003409218.1.36005 WP_003409218.1.36014 WP_003409218.1.36023 WP_003409218.1.36051 WP_003409218.1.36053 WP_003409218.1.36075 WP_003409218.1.36089 WP_003409218.1.36097 WP_003409218.1.36098 WP_003409218.1.36145 WP_003409218.1.36156 WP_003409218.1.36205 WP_003409218.1.36228 WP_003409218.1.36246 WP_003409218.1.36252 WP_003409218.1.36260 WP_003409218.1.36270 WP_003409218.1.36271 WP_003409218.1.36303 WP_003409218.1.36309 WP_003409218.1.36315 WP_003409218.1.36319 WP_003409218.1.36321 WP_003409218.1.36326 WP_003409218.1.3634 WP_003409218.1.36356 WP_003409218.1.36357 WP_003409218.1.3636 WP_003409218.1.36385 WP_003409218.1.36399 WP_003409218.1.36436 WP_003409218.1.36465 WP_003409218.1.36469 WP_003409218.1.36473 WP_003409218.1.36485 WP_003409218.1.36508 WP_003409218.1.36540 WP_003409218.1.36561 WP_003409218.1.36571 WP_003409218.1.36573 WP_003409218.1.36578 WP_003409218.1.36585 WP_003409218.1.36597 WP_003409218.1.36614 WP_003409218.1.36657 WP_003409218.1.36674 WP_003409218.1.36720 WP_003409218.1.36727 WP_003409218.1.36733 WP_003409218.1.36810 WP_003409218.1.36844 WP_003409218.1.36851 WP_003409218.1.36862 WP_003409218.1.36893 WP_003409218.1.36901 WP_003409218.1.36921 WP_003409218.1.36935 WP_003409218.1.36941 WP_003409218.1.3695 WP_003409218.1.36951 WP_003409218.1.36968 WP_003409218.1.3700 WP_003409218.1.37004 WP_003409218.1.37012 WP_003409218.1.37071 WP_003409218.1.37088 WP_003409218.1.37131 WP_003409218.1.37157 WP_003409218.1.37175 WP_003409218.1.37188 WP_003409218.1.37213 WP_003409218.1.37229 WP_003409218.1.3724 WP_003409218.1.37277 WP_003409218.1.37305 WP_003409218.1.37330 WP_003409218.1.37389 WP_003409218.1.37400 WP_003409218.1.37440 WP_003409218.1.37459 WP_003409218.1.37468 WP_003409218.1.37475 WP_003409218.1.37484 WP_003409218.1.37601 WP_003409218.1.37612 WP_003409218.1.37632 WP_003409218.1.37643 WP_003409218.1.37655 WP_003409218.1.37660 WP_003409218.1.37674 WP_003409218.1.37700 WP_003409218.1.37701 WP_003409218.1.37709 WP_003409218.1.37711 WP_003409218.1.37721 WP_003409218.1.37722 WP_003409218.1.37747 WP_003409218.1.37765 WP_003409218.1.37772 WP_003409218.1.37804 WP_003409218.1.37809 WP_003409218.1.37859 WP_003409218.1.37877 WP_003409218.1.37912 WP_003409218.1.37913 WP_003409218.1.37943 WP_003409218.1.37950 WP_003409218.1.37973 WP_003409218.1.37975 WP_003409218.1.37983 WP_003409218.1.38 WP_003409218.1.38002 WP_003409218.1.3802 WP_003409218.1.38039 WP_003409218.1.38040 WP_003409218.1.38067 WP_003409218.1.38068 WP_003409218.1.38135 WP_003409218.1.38138 WP_003409218.1.38144 WP_003409218.1.38158 WP_003409218.1.38159 WP_003409218.1.38210 WP_003409218.1.38233 WP_003409218.1.38240 WP_003409218.1.38299 WP_003409218.1.38332 WP_003409218.1.38347 WP_003409218.1.38354 WP_003409218.1.38380 WP_003409218.1.38384 WP_003409218.1.38389 WP_003409218.1.38398 WP_003409218.1.38402 WP_003409218.1.38418 WP_003409218.1.38421 WP_003409218.1.38466 WP_003409218.1.38477 WP_003409218.1.38483 WP_003409218.1.3849 WP_003409218.1.385 WP_003409218.1.38530 WP_003409218.1.38535 WP_003409218.1.38539 WP_003409218.1.38594 WP_003409218.1.38601 WP_003409218.1.38611 WP_003409218.1.38638 WP_003409218.1.38639 WP_003409218.1.38646 WP_003409218.1.38648 WP_003409218.1.38654 WP_003409218.1.38659 WP_003409218.1.38660 WP_003409218.1.38666 WP_003409218.1.38671 WP_003409218.1.38672 WP_003409218.1.38677 WP_003409218.1.38750 WP_003409218.1.38772 WP_003409218.1.38812 WP_003409218.1.38821 WP_003409218.1.38844 WP_003409218.1.38863 WP_003409218.1.38873 WP_003409218.1.3889 WP_003409218.1.38894 WP_003409218.1.38909 WP_003409218.1.38939 WP_003409218.1.38974 WP_003409218.1.38975 WP_003409218.1.38991 WP_003409218.1.39025 WP_003409218.1.39070 WP_003409218.1.39072 WP_003409218.1.39095 WP_003409218.1.39106 WP_003409218.1.39165 WP_003409218.1.39174 WP_003409218.1.39176 WP_003409218.1.39178 WP_003409218.1.39190 WP_003409218.1.39201 WP_003409218.1.39207 WP_003409218.1.39211 WP_003409218.1.39236 WP_003409218.1.39239 WP_003409218.1.39252 WP_003409218.1.39288 WP_003409218.1.39306 WP_003409218.1.39359 WP_003409218.1.39364 WP_003409218.1.39400 WP_003409218.1.39447 WP_003409218.1.3945 WP_003409218.1.39450 WP_003409218.1.39455 WP_003409218.1.3949 WP_003409218.1.39521 WP_003409218.1.39560 WP_003409218.1.39592 WP_003409218.1.39593 WP_003409218.1.396 WP_003409218.1.3960 WP_003409218.1.39616 WP_003409218.1.39654 WP_003409218.1.39657 WP_003409218.1.39661 WP_003409218.1.39674 WP_003409218.1.39678 WP_003409218.1.3968 WP_003409218.1.39694 WP_003409218.1.3971 WP_003409218.1.39718 WP_003409218.1.39728 WP_003409218.1.39739 WP_003409218.1.39748 WP_003409218.1.39751 WP_003409218.1.39759 WP_003409218.1.39801 WP_003409218.1.39804 WP_003409218.1.39848 WP_003409218.1.39877 WP_003409218.1.39925 WP_003409218.1.3994 WP_003409218.1.39959 WP_003409218.1.3996 WP_003409218.1.39960 WP_003409218.1.3997 WP_003409218.1.39980 WP_003409218.1.40000 WP_003409218.1.40028 WP_003409218.1.40029 WP_003409218.1.4003 WP_003409218.1.40094 WP_003409218.1.40096 WP_003409218.1.40150 WP_003409218.1.40156 WP_003409218.1.40174 WP_003409218.1.40186 WP_003409218.1.40276 WP_003409218.1.40277 WP_003409218.1.40323 WP_003409218.1.40336 WP_003409218.1.40353 WP_003409218.1.4036 WP_003409218.1.40372 WP_003409218.1.40402 WP_003409218.1.40413 WP_003409218.1.40440 WP_003409218.1.40446 WP_003409218.1.40451 WP_003409218.1.40455 WP_003409218.1.40523 WP_003409218.1.40543 WP_003409218.1.40641 WP_003409218.1.40646 WP_003409218.1.40651 WP_003409218.1.40653 WP_003409218.1.40705 WP_003409218.1.40723 WP_003409218.1.40731 WP_003409218.1.40735 WP_003409218.1.40795 WP_003409218.1.40799 WP_003409218.1.40852 WP_003409218.1.40876 WP_003409218.1.40881 WP_003409218.1.40922 WP_003409218.1.40948 WP_003409218.1.4095 WP_003409218.1.40956 WP_003409218.1.40957 WP_003409218.1.40964 WP_003409218.1.4097 WP_003409218.1.410 WP_003409218.1.41000 WP_003409218.1.41055 WP_003409218.1.41108 WP_003409218.1.41123 WP_003409218.1.41177 WP_003409218.1.41202 WP_003409218.1.41219 WP_003409218.1.41231 WP_003409218.1.41249 WP_003409218.1.4127 WP_003409218.1.41296 WP_003409218.1.41355 WP_003409218.1.41376 WP_003409218.1.41430 WP_003409218.1.41447 WP_003409218.1.41469 WP_003409218.1.41504 WP_003409218.1.41553 WP_003409218.1.41564 WP_003409218.1.41583 WP_003409218.1.41616 WP_003409218.1.41632 WP_003409218.1.41635 WP_003409218.1.41636 WP_003409218.1.41648 WP_003409218.1.41660 WP_003409218.1.41685 WP_003409218.1.41695 WP_003409218.1.41704 WP_003409218.1.4171 WP_003409218.1.41719 WP_003409218.1.41733 WP_003409218.1.41744 WP_003409218.1.41774 WP_003409218.1.41791 WP_003409218.1.41803 WP_003409218.1.41820 WP_003409218.1.41828 WP_003409218.1.41829 WP_003409218.1.41860 WP_003409218.1.41912 WP_003409218.1.41921 WP_003409218.1.41933 WP_003409218.1.41944 WP_003409218.1.42043 WP_003409218.1.42075 WP_003409218.1.42078 WP_003409218.1.42094 WP_003409218.1.42112 WP_003409218.1.4212 WP_003409218.1.42122 WP_003409218.1.42134 WP_003409218.1.42183 WP_003409218.1.42188 WP_003409218.1.42201 WP_003409218.1.42202 WP_003409218.1.42208 WP_003409218.1.42247 WP_003409218.1.42255 WP_003409218.1.42273 WP_003409218.1.42278 WP_003409218.1.42304 WP_003409218.1.42309 WP_003409218.1.42370 WP_003409218.1.42385 WP_003409218.1.42400 WP_003409218.1.42409 WP_003409218.1.42414 WP_003409218.1.42417 WP_003409218.1.42430 WP_003409218.1.42461 WP_003409218.1.42465 WP_003409218.1.42467 WP_003409218.1.42473 WP_003409218.1.42474 WP_003409218.1.4248 WP_003409218.1.42494 WP_003409218.1.42519 WP_003409218.1.42524 WP_003409218.1.42534 WP_003409218.1.4255 WP_003409218.1.42562 WP_003409218.1.42568 WP_003409218.1.42570 WP_003409218.1.42618 WP_003409218.1.42695 WP_003409218.1.42704 WP_003409218.1.42705 WP_003409218.1.42722 WP_003409218.1.42777 WP_003409218.1.42782 WP_003409218.1.42835 WP_003409218.1.42839 WP_003409218.1.42842 WP_003409218.1.42916 WP_003409218.1.42930 WP_003409218.1.42971 WP_003409218.1.43005 WP_003409218.1.43009 WP_003409218.1.43053 WP_003409218.1.43082 WP_003409218.1.43087 WP_003409218.1.43098 WP_003409218.1.43208 WP_003409218.1.43236 WP_003409218.1.43246 WP_003409218.1.43255 WP_003409218.1.43266 WP_003409218.1.43269 WP_003409218.1.43273 WP_003409218.1.43296 WP_003409218.1.4335 WP_003409218.1.43368 WP_003409218.1.43395 WP_003409218.1.43457 WP_003409218.1.43475 WP_003409218.1.43478 WP_003409218.1.43484 WP_003409218.1.43557 WP_003409218.1.43578 WP_003409218.1.43588 WP_003409218.1.43643 WP_003409218.1.43664 WP_003409218.1.43684 WP_003409218.1.43686 WP_003409218.1.43706 WP_003409218.1.43716 WP_003409218.1.4377 WP_003409218.1.43781 WP_003409218.1.43794 WP_003409218.1.43815 WP_003409218.1.43846 WP_003409218.1.43861 WP_003409218.1.43863 WP_003409218.1.43866 WP_003409218.1.43872 WP_003409218.1.43885 WP_003409218.1.43897 WP_003409218.1.4390 WP_003409218.1.43902 WP_003409218.1.43921 WP_003409218.1.43936 WP_003409218.1.43937 WP_003409218.1.43960 WP_003409218.1.43965 WP_003409218.1.4399 WP_003409218.1.43993 WP_003409218.1.43996 WP_003409218.1.44 WP_003409218.1.44001 WP_003409218.1.44008 WP_003409218.1.44016 WP_003409218.1.44033 WP_003409218.1.44037 WP_003409218.1.44041 WP_003409218.1.44070 WP_003409218.1.44071 WP_003409218.1.44076 WP_003409218.1.44104 WP_003409218.1.44111 WP_003409218.1.44124 WP_003409218.1.44169 WP_003409218.1.44219 WP_003409218.1.44237 WP_003409218.1.44279 WP_003409218.1.44336 WP_003409218.1.44355 WP_003409218.1.44358 WP_003409218.1.4438 WP_003409218.1.44390 WP_003409218.1.44392 WP_003409218.1.4441 WP_003409218.1.44415 WP_003409218.1.44464 WP_003409218.1.44466 WP_003409218.1.44489 WP_003409218.1.44492 WP_003409218.1.44494 WP_003409218.1.44500 WP_003409218.1.44519 WP_003409218.1.44526 WP_003409218.1.44532 WP_003409218.1.44534 WP_003409218.1.44562 WP_003409218.1.44589 WP_003409218.1.44597 WP_003409218.1.44600 WP_003409218.1.44602 WP_003409218.1.44615 WP_003409218.1.4464 WP_003409218.1.44651 WP_003409218.1.44659 WP_003409218.1.44665 WP_003409218.1.44694 WP_003409218.1.44700 WP_003409218.1.44713 WP_003409218.1.44735 WP_003409218.1.44740 WP_003409218.1.44757 WP_003409218.1.4476 WP_003409218.1.44761 WP_003409218.1.44767 WP_003409218.1.44776 WP_003409218.1.44779 WP_003409218.1.44786 WP_003409218.1.44808 WP_003409218.1.44864 WP_003409218.1.44901 WP_003409218.1.44908 WP_003409218.1.44913 WP_003409218.1.4492 WP_003409218.1.44939 WP_003409218.1.44979 WP_003409218.1.44981 WP_003409218.1.45002 WP_003409218.1.45011 WP_003409218.1.4504 WP_003409218.1.45066 WP_003409218.1.45081 WP_003409218.1.45113 WP_003409218.1.45129 WP_003409218.1.45135 WP_003409218.1.45147 WP_003409218.1.45168 WP_003409218.1.4517 WP_003409218.1.45181 WP_003409218.1.45185 WP_003409218.1.45192 WP_003409218.1.45200 WP_003409218.1.45205 WP_003409218.1.45211 WP_003409218.1.45249 WP_003409218.1.4526 WP_003409218.1.45286 WP_003409218.1.45326 WP_003409218.1.45347 WP_003409218.1.45374 WP_003409218.1.45390 WP_003409218.1.454 WP_003409218.1.45407 WP_003409218.1.45451 WP_003409218.1.45453 WP_003409218.1.45460 WP_003409218.1.45463 WP_003409218.1.45470 WP_003409218.1.45474 WP_003409218.1.45491 WP_003409218.1.45510 WP_003409218.1.45563 WP_003409218.1.45584 WP_003409218.1.45590 WP_003409218.1.45619 WP_003409218.1.45626 WP_003409218.1.45631 WP_003409218.1.45666 WP_003409218.1.45697 WP_003409218.1.4571 WP_003409218.1.45731 WP_003409218.1.45743 WP_003409218.1.45776 WP_003409218.1.45783 WP_003409218.1.45805 WP_003409218.1.45815 WP_003409218.1.45849 WP_003409218.1.45867 WP_003409218.1.45884 WP_003409218.1.4590 WP_003409218.1.45923 WP_003409218.1.45926 WP_003409218.1.45963 WP_003409218.1.45989 WP_003409218.1.45992 WP_003409218.1.46025 WP_003409218.1.46083 WP_003409218.1.46090 WP_003409218.1.46092 WP_003409218.1.46100 WP_003409218.1.46101 WP_003409218.1.46103 WP_003409218.1.46107 WP_003409218.1.46127 WP_003409218.1.46128 WP_003409218.1.46129 WP_003409218.1.46141 WP_003409218.1.46150 WP_003409218.1.46201 WP_003409218.1.46226 WP_003409218.1.4624 WP_003409218.1.46253 WP_003409218.1.46268 WP_003409218.1.46285 WP_003409218.1.46300 WP_003409218.1.46313 WP_003409218.1.46336 WP_003409218.1.46365 WP_003409218.1.46370 WP_003409218.1.46381 WP_003409218.1.46402 WP_003409218.1.46411 WP_003409218.1.4644 WP_003409218.1.46442 WP_003409218.1.46453 WP_003409218.1.46463 WP_003409218.1.46478 WP_003409218.1.46492 WP_003409218.1.46521 WP_003409218.1.4653 WP_003409218.1.46532 WP_003409218.1.46539 WP_003409218.1.46568 WP_003409218.1.46585 WP_003409218.1.46609 WP_003409218.1.46613 WP_003409218.1.46625 WP_003409218.1.46642 WP_003409218.1.46647 WP_003409218.1.46674 WP_003409218.1.46724 WP_003409218.1.46758 WP_003409218.1.46773 WP_003409218.1.46777 WP_003409218.1.46786 WP_003409218.1.46792 WP_003409218.1.46847 WP_003409218.1.46851 WP_003409218.1.4687 WP_003409218.1.46897 WP_003409218.1.46936 WP_003409218.1.46980 WP_003409218.1.47011 WP_003409218.1.47012 WP_003409218.1.47066 WP_003409218.1.47077 WP_003409218.1.47083 WP_003409218.1.47106 WP_003409218.1.47142 WP_003409218.1.47147 WP_003409218.1.47166 WP_003409218.1.47178 WP_003409218.1.47179 WP_003409218.1.47194 WP_003409218.1.47207 WP_003409218.1.47210 WP_003409218.1.47261 WP_003409218.1.47262 WP_003409218.1.47402 WP_003409218.1.47423 WP_003409218.1.47467 WP_003409218.1.47502 WP_003409218.1.4751 WP_003409218.1.47511 WP_003409218.1.47537 WP_003409218.1.47540 WP_003409218.1.47568 WP_003409218.1.47572 WP_003409218.1.47588 WP_003409218.1.47636 WP_003409218.1.4764 WP_003409218.1.47653 WP_003409218.1.47679 WP_003409218.1.47681 WP_003409218.1.47690 WP_003409218.1.4771 WP_003409218.1.47717 WP_003409218.1.47743 WP_003409218.1.47754 WP_003409218.1.47773 WP_003409218.1.47776 WP_003409218.1.47780 WP_003409218.1.47832 WP_003409218.1.47847 WP_003409218.1.47858 WP_003409218.1.47861 WP_003409218.1.47868 WP_003409218.1.47893 WP_003409218.1.47899 WP_003409218.1.479 WP_003409218.1.47912 WP_003409218.1.47913 WP_003409218.1.47926 WP_003409218.1.4794 WP_003409218.1.47943 WP_003409218.1.47944 WP_003409218.1.47959 WP_003409218.1.47974 WP_003409218.1.47993 WP_003409218.1.48004 WP_003409218.1.48039 WP_003409218.1.48050 WP_003409218.1.48084 WP_003409218.1.48097 WP_003409218.1.48101 WP_003409218.1.48109 WP_003409218.1.4813 WP_003409218.1.48130 WP_003409218.1.48135 WP_003409218.1.48152 WP_003409218.1.48155 WP_003409218.1.48170 WP_003409218.1.48173 WP_003409218.1.48177 WP_003409218.1.48185 WP_003409218.1.48204 WP_003409218.1.48219 WP_003409218.1.4823 WP_003409218.1.48240 WP_003409218.1.48256 WP_003409218.1.48264 WP_003409218.1.48287 WP_003409218.1.48330 WP_003409218.1.48333 WP_003409218.1.48348 WP_003409218.1.48354 WP_003409218.1.48372 WP_003409218.1.48383 WP_003409218.1.48388 WP_003409218.1.48419 WP_003409218.1.48423 WP_003409218.1.48443 WP_003409218.1.48450 WP_003409218.1.48462 WP_003409218.1.48543 WP_003409218.1.48550 WP_003409218.1.48605 WP_003409218.1.4863 WP_003409218.1.48648 WP_003409218.1.48658 WP_003409218.1.48666 WP_003409218.1.48687 WP_003409218.1.48779 WP_003409218.1.48798 WP_003409218.1.48802 WP_003409218.1.48826 WP_003409218.1.48831 WP_003409218.1.48843 WP_003409218.1.48857 WP_003409218.1.4890 WP_003409218.1.48946 WP_003409218.1.48979 WP_003409218.1.49017 WP_003409218.1.49048 WP_003409218.1.49059 WP_003409218.1.4906 WP_003409218.1.4907 WP_003409218.1.49103 WP_003409218.1.49110 WP_003409218.1.49111 WP_003409218.1.49112 WP_003409218.1.4919 WP_003409218.1.49251 WP_003409218.1.49254 WP_003409218.1.49263 WP_003409218.1.49291 WP_003409218.1.49296 WP_003409218.1.49335 WP_003409218.1.49337 WP_003409218.1.49419 WP_003409218.1.49426 WP_003409218.1.49437 WP_003409218.1.49439 WP_003409218.1.49474 WP_003409218.1.49506 WP_003409218.1.49516 WP_003409218.1.49523 WP_003409218.1.49526 WP_003409218.1.4959 WP_003409218.1.49678 WP_003409218.1.49687 WP_003409218.1.49699 WP_003409218.1.49709 WP_003409218.1.4971 WP_003409218.1.4972 WP_003409218.1.49736 WP_003409218.1.49746 WP_003409218.1.49764 WP_003409218.1.49773 WP_003409218.1.49814 WP_003409218.1.49815 WP_003409218.1.49816 WP_003409218.1.49839 WP_003409218.1.49857 WP_003409218.1.49878 WP_003409218.1.49880 WP_003409218.1.49944 WP_003409218.1.4999 WP_003409218.1.49990 WP_003409218.1.50068 WP_003409218.1.50077 WP_003409218.1.5008 WP_003409218.1.50081 WP_003409218.1.50122 WP_003409218.1.50126 WP_003409218.1.50149 WP_003409218.1.50162 WP_003409218.1.5018 WP_003409218.1.50194 WP_003409218.1.50235 WP_003409218.1.50249 WP_003409218.1.50265 WP_003409218.1.50271 WP_003409218.1.50324 WP_003409218.1.50347 WP_003409218.1.50372 WP_003409218.1.50398 WP_003409218.1.50444 WP_003409218.1.50466 WP_003409218.1.50472 WP_003409218.1.5048 WP_003409218.1.50498 WP_003409218.1.5050 WP_003409218.1.50540 WP_003409218.1.50554 WP_003409218.1.50557 WP_003409218.1.50601 WP_003409218.1.50610 WP_003409218.1.50632 WP_003409218.1.50633 WP_003409218.1.50642 WP_003409218.1.50655 WP_003409218.1.50659 WP_003409218.1.50683 WP_003409218.1.50689 WP_003409218.1.50692 WP_003409218.1.50714 WP_003409218.1.50729 WP_003409218.1.50756 WP_003409218.1.50784 WP_003409218.1.50794 WP_003409218.1.50841 WP_003409218.1.50860 WP_003409218.1.50868 WP_003409218.1.50877 WP_003409218.1.5096 WP_003409218.1.50981 WP_003409218.1.50987 WP_003409218.1.51003 WP_003409218.1.51009 WP_003409218.1.51037 WP_003409218.1.51082 WP_003409218.1.51101 WP_003409218.1.51116 WP_003409218.1.51149 WP_003409218.1.51156 WP_003409218.1.51157 WP_003409218.1.51213 WP_003409218.1.51232 WP_003409218.1.51239 WP_003409218.1.51247 WP_003409218.1.51266 WP_003409218.1.51279 WP_003409218.1.51291 WP_003409218.1.51294 WP_003409218.1.51301 WP_003409218.1.51329 WP_003409218.1.51391 WP_003409218.1.51422 WP_003409218.1.51445 WP_003409218.1.51455 WP_003409218.1.51466 WP_003409218.1.51468 WP_003409218.1.51478 WP_003409218.1.51497 WP_003409218.1.51520 WP_003409218.1.51593 WP_003409218.1.51628 WP_003409218.1.5164 WP_003409218.1.51647 WP_003409218.1.51660 WP_003409218.1.51696 WP_003409218.1.51721 WP_003409218.1.51788 WP_003409218.1.51795 WP_003409218.1.51801 WP_003409218.1.51817 WP_003409218.1.51819 WP_003409218.1.51854 WP_003409218.1.51923 WP_003409218.1.51942 WP_003409218.1.51948 WP_003409218.1.51963 WP_003409218.1.51969 WP_003409218.1.52000 WP_003409218.1.52001 WP_003409218.1.52003 WP_003409218.1.52006 WP_003409218.1.52036 WP_003409218.1.52038 WP_003409218.1.52046 WP_003409218.1.52059 WP_003409218.1.52069 WP_003409218.1.52082 WP_003409218.1.52102 WP_003409218.1.52106 WP_003409218.1.52166 WP_003409218.1.52168 WP_003409218.1.52173 WP_003409218.1.52178 WP_003409218.1.52206 WP_003409218.1.52216 WP_003409218.1.52238 WP_003409218.1.52241 WP_003409218.1.52280 WP_003409218.1.52314 WP_003409218.1.52385 WP_003409218.1.52390 WP_003409218.1.524 WP_003409218.1.52460 WP_003409218.1.52485 WP_003409218.1.52486 WP_003409218.1.52495 WP_003409218.1.52504 WP_003409218.1.52522 WP_003409218.1.52531 WP_003409218.1.52533 WP_003409218.1.52545 WP_003409218.1.52553 WP_003409218.1.52563 WP_003409218.1.52564 WP_003409218.1.52574 WP_003409218.1.52641 WP_003409218.1.52673 WP_003409218.1.52674 WP_003409218.1.52708 WP_003409218.1.52713 WP_003409218.1.52761 WP_003409218.1.52778 WP_003409218.1.52791 WP_003409218.1.52797 WP_003409218.1.52818 WP_003409218.1.52872 WP_003409218.1.52873 WP_003409218.1.52891 WP_003409218.1.52892 WP_003409218.1.52909 WP_003409218.1.52970 WP_003409218.1.52998 WP_003409218.1.53053 WP_003409218.1.53056 WP_003409218.1.5306 WP_003409218.1.53088 WP_003409218.1.5309 WP_003409218.1.531 WP_003409218.1.53117 WP_003409218.1.53118 WP_003409218.1.53142 WP_003409218.1.53143 WP_003409218.1.53157 WP_003409218.1.53167 WP_003409218.1.53200 WP_003409218.1.53204 WP_003409218.1.53213 WP_003409218.1.53217 WP_003409218.1.53226 WP_003409218.1.53229 WP_003409218.1.53230 WP_003409218.1.53237 WP_003409218.1.53254 WP_003409218.1.53257 WP_003409218.1.5327 WP_003409218.1.53276 WP_003409218.1.53278 WP_003409218.1.533 WP_003409218.1.53302 WP_003409218.1.53306 WP_003409218.1.5334 WP_003409218.1.5335 WP_003409218.1.53353 WP_003409218.1.53381 WP_003409218.1.53413 WP_003409218.1.53458 WP_003409218.1.53460 WP_003409218.1.53480 WP_003409218.1.53517 WP_003409218.1.53522 WP_003409218.1.53525 WP_003409218.1.53526 WP_003409218.1.53553 WP_003409218.1.53606 WP_003409218.1.53609 WP_003409218.1.53628 WP_003409218.1.53643 WP_003409218.1.53667 WP_003409218.1.53679 WP_003409218.1.53715 WP_003409218.1.53730 WP_003409218.1.53742 WP_003409218.1.53743 WP_003409218.1.53754 WP_003409218.1.53775 WP_003409218.1.53787 WP_003409218.1.53803 WP_003409218.1.53818 WP_003409218.1.53822 WP_003409218.1.53853 WP_003409218.1.53865 WP_003409218.1.53888 WP_003409218.1.53900 WP_003409218.1.53912 WP_003409218.1.53952 WP_003409218.1.5398 WP_003409218.1.5408 WP_003409218.1.54089 WP_003409218.1.54093 WP_003409218.1.54099 WP_003409218.1.54125 WP_003409218.1.54141 WP_003409218.1.54162 WP_003409218.1.54179 WP_003409218.1.54206 WP_003409218.1.54218 WP_003409218.1.54225 WP_003409218.1.54227 WP_003409218.1.54232 WP_003409218.1.54241 WP_003409218.1.54247 WP_003409218.1.54260 WP_003409218.1.54275 WP_003409218.1.54280 WP_003409218.1.5429 WP_003409218.1.54294 WP_003409218.1.54314 WP_003409218.1.54347 WP_003409218.1.54351 WP_003409218.1.54428 WP_003409218.1.54449 WP_003409218.1.54494 WP_003409218.1.54502 WP_003409218.1.54514 WP_003409218.1.54519 WP_003409218.1.5452 WP_003409218.1.54531 WP_003409218.1.54537 WP_003409218.1.54553 WP_003409218.1.54555 WP_003409218.1.54575 WP_003409218.1.54633 WP_003409218.1.54686 WP_003409218.1.54687 WP_003409218.1.54705 WP_003409218.1.54730 WP_003409218.1.54732 WP_003409218.1.5475 WP_003409218.1.54797 WP_003409218.1.54807 WP_003409218.1.54836 WP_003409218.1.54838 WP_003409218.1.54860 WP_003409218.1.54888 WP_003409218.1.54897 WP_003409218.1.54905 WP_003409218.1.54909 WP_003409218.1.54937 WP_003409218.1.54939 WP_003409218.1.54944 WP_003409218.1.54945 WP_003409218.1.54953 WP_003409218.1.54964 WP_003409218.1.55015 WP_003409218.1.55022 WP_003409218.1.55023 WP_003409218.1.55051 WP_003409218.1.55072 WP_003409218.1.55088 WP_003409218.1.55106 WP_003409218.1.55126 WP_003409218.1.55128 WP_003409218.1.55140 WP_003409218.1.55150 WP_003409218.1.55210 WP_003409218.1.55227 WP_003409218.1.55248 WP_003409218.1.55257 WP_003409218.1.55258 WP_003409218.1.55279 WP_003409218.1.55307 WP_003409218.1.55326 WP_003409218.1.55328 WP_003409218.1.5533 WP_003409218.1.55345 WP_003409218.1.55396 WP_003409218.1.55398 WP_003409218.1.55441 WP_003409218.1.55459 WP_003409218.1.55501 WP_003409218.1.55504 WP_003409218.1.55626 WP_003409218.1.55641 WP_003409218.1.5569 WP_003409218.1.55723 WP_003409218.1.55735 WP_003409218.1.5574 WP_003409218.1.55772 WP_003409218.1.55802 WP_003409218.1.55807 WP_003409218.1.55819 WP_003409218.1.55821 WP_003409218.1.5583 WP_003409218.1.55849 WP_003409218.1.55856 WP_003409218.1.55860 WP_003409218.1.55882 WP_003409218.1.55883 WP_003409218.1.55894 WP_003409218.1.55902 WP_003409218.1.55908 WP_003409218.1.55909 WP_003409218.1.5591 WP_003409218.1.55961 WP_003409218.1.55977 WP_003409218.1.55983 WP_003409218.1.56028 WP_003409218.1.56057 WP_003409218.1.56060 WP_003409218.1.56107 WP_003409218.1.56132 WP_003409218.1.56163 WP_003409218.1.56167 WP_003409218.1.56178 WP_003409218.1.56287 WP_003409218.1.56292 WP_003409218.1.56327 WP_003409218.1.56341 WP_003409218.1.56359 WP_003409218.1.56365 WP_003409218.1.56394 WP_003409218.1.56443 WP_003409218.1.56473 WP_003409218.1.56500 WP_003409218.1.56517 WP_003409218.1.56534 WP_003409218.1.5656 WP_003409218.1.56577 WP_003409218.1.56593 WP_003409218.1.56625 WP_003409218.1.56637 WP_003409218.1.56670 WP_003409218.1.56697 WP_003409218.1.567 WP_003409218.1.56701 WP_003409218.1.56709 WP_003409218.1.56729 WP_003409218.1.56743 WP_003409218.1.56755 WP_003409218.1.56764 WP_003409218.1.56769 WP_003409218.1.56770 WP_003409218.1.56795 WP_003409218.1.5681 WP_003409218.1.56827 WP_003409218.1.56839 WP_003409218.1.56863 WP_003409218.1.56868 WP_003409218.1.56869 WP_003409218.1.56915 WP_003409218.1.56926 WP_003409218.1.56961 WP_003409218.1.56971 WP_003409218.1.56972 WP_003409218.1.57023 WP_003409218.1.57035 WP_003409218.1.57077 WP_003409218.1.57087 WP_003409218.1.57094 WP_003409218.1.57134 WP_003409218.1.57151 WP_003409218.1.57169 WP_003409218.1.57208 WP_003409218.1.57212 WP_003409218.1.57230 WP_003409218.1.5724 WP_003409218.1.5725 WP_003409218.1.5727 WP_003409218.1.57273 WP_003409218.1.573 WP_003409218.1.57314 WP_003409218.1.57326 WP_003409218.1.57328 WP_003409218.1.57331 WP_003409218.1.57340 WP_003409218.1.57351 WP_003409218.1.57352 WP_003409218.1.57380 WP_003409218.1.57430 WP_003409218.1.5744 WP_003409218.1.57440 WP_003409218.1.5745 WP_003409218.1.57461 WP_003409218.1.57469 WP_003409218.1.57489 WP_003409218.1.575 WP_003409218.1.57509 WP_003409218.1.57519 WP_003409218.1.57525 WP_003409218.1.57551 WP_003409218.1.5758 WP_003409218.1.57596 WP_003409218.1.57604 WP_003409218.1.57616 WP_003409218.1.57617 WP_003409218.1.57619 WP_003409218.1.57627 WP_003409218.1.57642 WP_003409218.1.57658 WP_003409218.1.57667 WP_003409218.1.57675 WP_003409218.1.57689 WP_003409218.1.57708 WP_003409218.1.57794 WP_003409218.1.57821 WP_003409218.1.57825 WP_003409218.1.57843 WP_003409218.1.57906 WP_003409218.1.57924 WP_003409218.1.57926 WP_003409218.1.57930 WP_003409218.1.57957 WP_003409218.1.57960 WP_003409218.1.57964 WP_003409218.1.57991 WP_003409218.1.58000 WP_003409218.1.58086 WP_003409218.1.58101 WP_003409218.1.58103 WP_003409218.1.58108 WP_003409218.1.5811 WP_003409218.1.58121 WP_003409218.1.58145 WP_003409218.1.58164 WP_003409218.1.58174 WP_003409218.1.582 WP_003409218.1.58202 WP_003409218.1.58209 WP_003409218.1.58215 WP_003409218.1.5824 WP_003409218.1.58250 WP_003409218.1.58259 WP_003409218.1.58283 WP_003409218.1.5830 WP_003409218.1.58303 WP_003409218.1.58311 WP_003409218.1.58330 WP_003409218.1.58359 WP_003409218.1.58386 WP_003409218.1.58393 WP_003409218.1.58431 WP_003409218.1.5844 WP_003409218.1.58457 WP_003409218.1.58488 WP_003409218.1.58518 WP_003409218.1.58534 WP_003409218.1.58559 WP_003409218.1.58567 WP_003409218.1.58573 WP_003409218.1.58602 WP_003409218.1.58612 WP_003409218.1.58619 WP_003409218.1.58630 WP_003409218.1.5865 WP_003409218.1.58671 WP_003409218.1.58690 WP_003409218.1.58702 WP_003409218.1.58743 WP_003409218.1.58754 WP_003409218.1.5879 WP_003409218.1.5881 WP_003409218.1.58824 WP_003409218.1.58848 WP_003409218.1.58857 WP_003409218.1.58891 WP_003409218.1.58892 WP_003409218.1.5890 WP_003409218.1.58904 WP_003409218.1.58921 WP_003409218.1.58930 WP_003409218.1.58939 WP_003409218.1.58941 WP_003409218.1.58953 WP_003409218.1.58961 WP_003409218.1.5898 WP_003409218.1.59025 WP_003409218.1.59029 WP_003409218.1.59037 WP_003409218.1.59044 WP_003409218.1.59085 WP_003409218.1.59088 WP_003409218.1.59112 WP_003409218.1.59130 WP_003409218.1.59147 WP_003409218.1.59166 WP_003409218.1.59205 WP_003409218.1.59209 WP_003409218.1.59237 WP_003409218.1.59240 WP_003409218.1.59253 WP_003409218.1.59254 WP_003409218.1.59262 WP_003409218.1.59270 WP_003409218.1.5928 WP_003409218.1.59304 WP_003409218.1.59305 WP_003409218.1.59309 WP_003409218.1.59316 WP_003409218.1.59326 WP_003409218.1.59328 WP_003409218.1.59333 WP_003409218.1.59338 WP_003409218.1.59388 WP_003409218.1.59487 WP_003409218.1.59537 WP_003409218.1.59561 WP_003409218.1.59677 WP_003409218.1.59722 WP_003409218.1.59727 WP_003409218.1.59732 WP_003409218.1.59738 WP_003409218.1.59750 WP_003409218.1.59757 WP_003409218.1.59761 WP_003409218.1.59808 WP_003409218.1.59850 WP_003409218.1.59856 WP_003409218.1.59860 WP_003409218.1.59861 WP_003409218.1.5987 WP_003409218.1.59878 WP_003409218.1.59888 WP_003409218.1.59952 WP_003409218.1.5996 WP_003409218.1.59961 WP_003409218.1.59974 WP_003409218.1.6000 WP_003409218.1.60007 WP_003409218.1.60016 WP_003409218.1.6003 WP_003409218.1.60047 WP_003409218.1.6007 WP_003409218.1.60121 WP_003409218.1.60125 WP_003409218.1.60135 WP_003409218.1.60139 WP_003409218.1.60152 WP_003409218.1.60171 WP_003409218.1.60197 WP_003409218.1.6020 WP_003409218.1.60205 WP_003409218.1.60207 WP_003409218.1.60215 WP_003409218.1.60217 WP_003409218.1.60267 WP_003409218.1.60288 WP_003409218.1.60291 WP_003409218.1.60301 WP_003409218.1.60305 WP_003409218.1.60312 WP_003409218.1.60313 WP_003409218.1.60314 WP_003409218.1.60367 WP_003409218.1.60376 WP_003409218.1.60403 WP_003409218.1.60413 WP_003409218.1.60421 WP_003409218.1.60451 WP_003409218.1.60460 WP_003409218.1.60479 WP_003409218.1.60487 WP_003409218.1.60512 WP_003409218.1.60573 WP_003409218.1.60632 WP_003409218.1.60657 WP_003409218.1.60687 WP_003409218.1.60689 WP_003409218.1.60727 WP_003409218.1.60738 WP_003409218.1.60763 WP_003409218.1.6077 WP_003409218.1.60791 WP_003409218.1.60834 WP_003409218.1.60870 WP_003409218.1.60878 WP_003409218.1.60879 WP_003409218.1.60913 WP_003409218.1.60978 WP_003409218.1.61000 WP_003409218.1.61001 WP_003409218.1.61012 WP_003409218.1.61015 WP_003409218.1.61037 WP_003409218.1.61052 WP_003409218.1.61065 WP_003409218.1.61100 WP_003409218.1.61101 WP_003409218.1.61138 WP_003409218.1.61142 WP_003409218.1.61198 WP_003409218.1.612 WP_003409218.1.61234 WP_003409218.1.61256 WP_003409218.1.61281 WP_003409218.1.61314 WP_003409218.1.61321 WP_003409218.1.61326 WP_003409218.1.61328 WP_003409218.1.61368 WP_003409218.1.61391 WP_003409218.1.61406 WP_003409218.1.61409 WP_003409218.1.61420 WP_003409218.1.61422 WP_003409218.1.61425 WP_003409218.1.61428 WP_003409218.1.61469 WP_003409218.1.61494 WP_003409218.1.61522 WP_003409218.1.61552 WP_003409218.1.61557 WP_003409218.1.61567 WP_003409218.1.61571 WP_003409218.1.61584 WP_003409218.1.61586 WP_003409218.1.6159 WP_003409218.1.61592 WP_003409218.1.6160 WP_003409218.1.61614 WP_003409218.1.6163 WP_003409218.1.61655 WP_003409218.1.61665 WP_003409218.1.61669 WP_003409218.1.61682 WP_003409218.1.61692 WP_003409218.1.61719 WP_003409218.1.61728 WP_003409218.1.61750 WP_003409218.1.61754 WP_003409218.1.61755 WP_003409218.1.61757 WP_003409218.1.61778 WP_003409218.1.6179 WP_003409218.1.61793 WP_003409218.1.61816 WP_003409218.1.61842 WP_003409218.1.61850 WP_003409218.1.61862 WP_003409218.1.61865 WP_003409218.1.61868 WP_003409218.1.61911 WP_003409218.1.61925 WP_003409218.1.61941 WP_003409218.1.61953 WP_003409218.1.61979 WP_003409218.1.61986 WP_003409218.1.61987 WP_003409218.1.62021 WP_003409218.1.62087 WP_003409218.1.62089 WP_003409218.1.62101 WP_003409218.1.62104 WP_003409218.1.6211 WP_003409218.1.62132 WP_003409218.1.62162 WP_003409218.1.62225 WP_003409218.1.62230 WP_003409218.1.62249 WP_003409218.1.62270 WP_003409218.1.62281 WP_003409218.1.62307 WP_003409218.1.6231 WP_003409218.1.62359 WP_003409218.1.62360 WP_003409218.1.62371 WP_003409218.1.62379 WP_003409218.1.62395 WP_003409218.1.62408 WP_003409218.1.62449 WP_003409218.1.62468 WP_003409218.1.6248 WP_003409218.1.62508 WP_003409218.1.62565 WP_003409218.1.62594 WP_003409218.1.62606 WP_003409218.1.62616 WP_003409218.1.62666 WP_003409218.1.62687 WP_003409218.1.62715 WP_003409218.1.62730 WP_003409218.1.62738 WP_003409218.1.62761 WP_003409218.1.62766 WP_003409218.1.62786 WP_003409218.1.62813 WP_003409218.1.62839 WP_003409218.1.62841 WP_003409218.1.62909 WP_003409218.1.62936 WP_003409218.1.6294 WP_003409218.1.6295 WP_003409218.1.62962 WP_003409218.1.63007 WP_003409218.1.63019 WP_003409218.1.63032 WP_003409218.1.63037 WP_003409218.1.63064 WP_003409218.1.63066 WP_003409218.1.63072 WP_003409218.1.6308 WP_003409218.1.63081 WP_003409218.1.63096 WP_003409218.1.63106 WP_003409218.1.6314 WP_003409218.1.63144 WP_003409218.1.63154 WP_003409218.1.63160 WP_003409218.1.63161 WP_003409218.1.63166 WP_003409218.1.63175 WP_003409218.1.63194 WP_003409218.1.6322 WP_003409218.1.63222 WP_003409218.1.63247 WP_003409218.1.6328 WP_003409218.1.63291 WP_003409218.1.63317 WP_003409218.1.63331 WP_003409218.1.63373 WP_003409218.1.63384 WP_003409218.1.63403 WP_003409218.1.63424 WP_003409218.1.63428 WP_003409218.1.6345 WP_003409218.1.63464 WP_003409218.1.63483 WP_003409218.1.63502 WP_003409218.1.63504 WP_003409218.1.63522 WP_003409218.1.63530 WP_003409218.1.63538 WP_003409218.1.63564 WP_003409218.1.63567 WP_003409218.1.63596 WP_003409218.1.63600 WP_003409218.1.63623 WP_003409218.1.63624 WP_003409218.1.63625 WP_003409218.1.63627 WP_003409218.1.63654 WP_003409218.1.63662 WP_003409218.1.63711 WP_003409218.1.63734 WP_003409218.1.63807 WP_003409218.1.63844 WP_003409218.1.63888 WP_003409218.1.63913 WP_003409218.1.63915 WP_003409218.1.63918 WP_003409218.1.63961 WP_003409218.1.63970 WP_003409218.1.64000 WP_003409218.1.64027 WP_003409218.1.64058 WP_003409218.1.64065 WP_003409218.1.6407 WP_003409218.1.64082 WP_003409218.1.64091 WP_003409218.1.64102 WP_003409218.1.64104 WP_003409218.1.64119 WP_003409218.1.64169 WP_003409218.1.64219 WP_003409218.1.6422 WP_003409218.1.64222 WP_003409218.1.64223 WP_003409218.1.64228 WP_003409218.1.64235 WP_003409218.1.64249 WP_003409218.1.6427 WP_003409218.1.64278 WP_003409218.1.64287 WP_003409218.1.64414 WP_003409218.1.64419 WP_003409218.1.6443 WP_003409218.1.64463 WP_003409218.1.64480 WP_003409218.1.64497 WP_003409218.1.64506 WP_003409218.1.64511 WP_003409218.1.64513 WP_003409218.1.64514 WP_003409218.1.64515 WP_003409218.1.64522 WP_003409218.1.64543 WP_003409218.1.6456 WP_003409218.1.64567 WP_003409218.1.64588 WP_003409218.1.64589 WP_003409218.1.64594 WP_003409218.1.64595 WP_003409218.1.64608 WP_003409218.1.64619 WP_003409218.1.64629 WP_003409218.1.6464 WP_003409218.1.64664 WP_003409218.1.64669 WP_003409218.1.64672 WP_003409218.1.64680 WP_003409218.1.64682 WP_003409218.1.64727 WP_003409218.1.64729 WP_003409218.1.64774 WP_003409218.1.64776 WP_003409218.1.64802 WP_003409218.1.64832 WP_003409218.1.6486 WP_003409218.1.64870 WP_003409218.1.64898 WP_003409218.1.64922 WP_003409218.1.64924 WP_003409218.1.6493 WP_003409218.1.64937 WP_003409218.1.64941 WP_003409218.1.64966 WP_003409218.1.65001 WP_003409218.1.65026 WP_003409218.1.65053 WP_003409218.1.65070 WP_003409218.1.65079 WP_003409218.1.65102 WP_003409218.1.65157 WP_003409218.1.65181 WP_003409218.1.65212 WP_003409218.1.65229 WP_003409218.1.6523 WP_003409218.1.65253 WP_003409218.1.65289 WP_003409218.1.65291 WP_003409218.1.65315 WP_003409218.1.65329 WP_003409218.1.65359 WP_003409218.1.6536 WP_003409218.1.65374 WP_003409218.1.65414 WP_003409218.1.65416 WP_003409218.1.65433 WP_003409218.1.65455 WP_003409218.1.65467 WP_003409218.1.65488 WP_003409218.1.65529 WP_003409218.1.65539 WP_003409218.1.65583 WP_003409218.1.65612 WP_003409218.1.65623 WP_003409218.1.65635 WP_003409218.1.65637 WP_003409218.1.65648 WP_003409218.1.65683 WP_003409218.1.65686 WP_003409218.1.65688 WP_003409218.1.65707 WP_003409218.1.65733 WP_003409218.1.65746 WP_003409218.1.65747 WP_003409218.1.65759 WP_003409218.1.65816 WP_003409218.1.65830 WP_003409218.1.65858 WP_003409218.1.65862 WP_003409218.1.65869 WP_003409218.1.65893 WP_003409218.1.65929 WP_003409218.1.65932 WP_003409218.1.65958 WP_003409218.1.65974 WP_003409218.1.66004 WP_003409218.1.66013 WP_003409218.1.6606 WP_003409218.1.66089 WP_003409218.1.66149 WP_003409218.1.66151 WP_003409218.1.66229 WP_003409218.1.66276 WP_003409218.1.66293 WP_003409218.1.66297 WP_003409218.1.66323 WP_003409218.1.66325 WP_003409218.1.6633 WP_003409218.1.66334 WP_003409218.1.66355 WP_003409218.1.66367 WP_003409218.1.66394 WP_003409218.1.66396 WP_003409218.1.66451 WP_003409218.1.66455 WP_003409218.1.66457 WP_003409218.1.66460 WP_003409218.1.66464 WP_003409218.1.66466 WP_003409218.1.66487 WP_003409218.1.66504 WP_003409218.1.66544 WP_003409218.1.66558 WP_003409218.1.66580 WP_003409218.1.66582 WP_003409218.1.66612 WP_003409218.1.66615 WP_003409218.1.66617 WP_003409218.1.66635 WP_003409218.1.66656 WP_003409218.1.66663 WP_003409218.1.66675 WP_003409218.1.66715 WP_003409218.1.66718 WP_003409218.1.66762 WP_003409218.1.66776 WP_003409218.1.66808 WP_003409218.1.66817 WP_003409218.1.66819 WP_003409218.1.66826 WP_003409218.1.66830 WP_003409218.1.66842 WP_003409218.1.66868 WP_003409218.1.66878 WP_003409218.1.66880 WP_003409218.1.66893 WP_003409218.1.66961 WP_003409218.1.67005 WP_003409218.1.6704 WP_003409218.1.67044 WP_003409218.1.67061 WP_003409218.1.67089 WP_003409218.1.67098 WP_003409218.1.67146 WP_003409218.1.67198 WP_003409218.1.6720 WP_003409218.1.67207 WP_003409218.1.67218 WP_003409218.1.67220 WP_003409218.1.67225 WP_003409218.1.67231 WP_003409218.1.6724 WP_003409218.1.67257 WP_003409218.1.67298 WP_003409218.1.67307 WP_003409218.1.67324 WP_003409218.1.67332 WP_003409218.1.67354 WP_003409218.1.67360 WP_003409218.1.67381 WP_003409218.1.67396 WP_003409218.1.67417 WP_003409218.1.67422 WP_003409218.1.67453 WP_003409218.1.67459 WP_003409218.1.6746 WP_003409218.1.67473 WP_003409218.1.67481 WP_003409218.1.67482 WP_003409218.1.67496 WP_003409218.1.67499 WP_003409218.1.67516 WP_003409218.1.67523 WP_003409218.1.67536 WP_003409218.1.67575 WP_003409218.1.67587 WP_003409218.1.67598 WP_003409218.1.67600 WP_003409218.1.67602 WP_003409218.1.67630 WP_003409218.1.67679 WP_003409218.1.67692 WP_003409218.1.67744 WP_003409218.1.6775 WP_003409218.1.67750 WP_003409218.1.6777 WP_003409218.1.67809 WP_003409218.1.67816 WP_003409218.1.67848 WP_003409218.1.67870 WP_003409218.1.67888 WP_003409218.1.67915 WP_003409218.1.67945 WP_003409218.1.67949 WP_003409218.1.67980 WP_003409218.1.67982 WP_003409218.1.68022 WP_003409218.1.68029 WP_003409218.1.68037 WP_003409218.1.68038 WP_003409218.1.68045 WP_003409218.1.68057 WP_003409218.1.68083 WP_003409218.1.68088 WP_003409218.1.68106 WP_003409218.1.68110 WP_003409218.1.68153 WP_003409218.1.68164 WP_003409218.1.68169 WP_003409218.1.68193 WP_003409218.1.68212 WP_003409218.1.68227 WP_003409218.1.68243 WP_003409218.1.6825 WP_003409218.1.68297 WP_003409218.1.68309 WP_003409218.1.68325 WP_003409218.1.68329 WP_003409218.1.68340 WP_003409218.1.68384 WP_003409218.1.68388 WP_003409218.1.68429 WP_003409218.1.6843 WP_003409218.1.68433 WP_003409218.1.68444 WP_003409218.1.68465 WP_003409218.1.68484 WP_003409218.1.68518 WP_003409218.1.68569 WP_003409218.1.68576 WP_003409218.1.68580 WP_003409218.1.68586 WP_003409218.1.68623 WP_003409218.1.68624 WP_003409218.1.68637 WP_003409218.1.68646 WP_003409218.1.68667 WP_003409218.1.68669 WP_003409218.1.68672 WP_003409218.1.68684 WP_003409218.1.68704 WP_003409218.1.68708 WP_003409218.1.6872 WP_003409218.1.68730 WP_003409218.1.68734 WP_003409218.1.68748 WP_003409218.1.68754 WP_003409218.1.6876 WP_003409218.1.68761 WP_003409218.1.68763 WP_003409218.1.68766 WP_003409218.1.68774 WP_003409218.1.68796 WP_003409218.1.68824 WP_003409218.1.68832 WP_003409218.1.68833 WP_003409218.1.68841 WP_003409218.1.68859 WP_003409218.1.68876 WP_003409218.1.68906 WP_003409218.1.68923 WP_003409218.1.68945 WP_003409218.1.6896 WP_003409218.1.68981 WP_003409218.1.68984 WP_003409218.1.68997 WP_003409218.1.69008 WP_003409218.1.69076 WP_003409218.1.69079 WP_003409218.1.6908 WP_003409218.1.69082 WP_003409218.1.69178 WP_003409218.1.69208 WP_003409218.1.69231 WP_003409218.1.69256 WP_003409218.1.69311 WP_003409218.1.69315 WP_003409218.1.69322 WP_003409218.1.69342 WP_003409218.1.6935 WP_003409218.1.6936 WP_003409218.1.69369 WP_003409218.1.69374 WP_003409218.1.69398 WP_003409218.1.69401 WP_003409218.1.69426 WP_003409218.1.69427 WP_003409218.1.69429 WP_003409218.1.6949 WP_003409218.1.6951 WP_003409218.1.69511 WP_003409218.1.69526 WP_003409218.1.69528 WP_003409218.1.69547 WP_003409218.1.69573 WP_003409218.1.69581 WP_003409218.1.6960 WP_003409218.1.69617 WP_003409218.1.69634 WP_003409218.1.69647 WP_003409218.1.69659 WP_003409218.1.69673 WP_003409218.1.69682 WP_003409218.1.69684 WP_003409218.1.69686 WP_003409218.1.69709 WP_003409218.1.69723 WP_003409218.1.69736 WP_003409218.1.69778 WP_003409218.1.69800 WP_003409218.1.69802 WP_003409218.1.69845 WP_003409218.1.69870 WP_003409218.1.69873 WP_003409218.1.69898 WP_003409218.1.69913 WP_003409218.1.69931 WP_003409218.1.69938 WP_003409218.1.69955 WP_003409218.1.69957 WP_003409218.1.69981 WP_003409218.1.69990 WP_003409218.1.70 WP_003409218.1.70000 WP_003409218.1.70017 WP_003409218.1.70032 WP_003409218.1.70055 WP_003409218.1.70062 WP_003409218.1.70072 WP_003409218.1.70131 WP_003409218.1.70132 WP_003409218.1.7022 WP_003409218.1.70227 WP_003409218.1.70255 WP_003409218.1.70271 WP_003409218.1.70274 WP_003409218.1.7029 WP_003409218.1.70325 WP_003409218.1.70328 WP_003409218.1.70356 WP_003409218.1.70364 WP_003409218.1.70368 WP_003409218.1.70369 WP_003409218.1.70418 WP_003409218.1.70422 WP_003409218.1.70435 WP_003409218.1.70444 WP_003409218.1.70463 WP_003409218.1.70471 WP_003409218.1.70480 WP_003409218.1.70494 WP_003409218.1.70498 WP_003409218.1.70505 WP_003409218.1.70525 WP_003409218.1.70573 WP_003409218.1.70577 WP_003409218.1.70610 WP_003409218.1.70615 WP_003409218.1.70618 WP_003409218.1.70622 WP_003409218.1.70626 WP_003409218.1.70668 WP_003409218.1.70699 WP_003409218.1.70704 WP_003409218.1.70729 WP_003409218.1.70757 WP_003409218.1.70782 WP_003409218.1.70796 WP_003409218.1.70830 WP_003409218.1.70834 WP_003409218.1.7084 WP_003409218.1.70840 WP_003409218.1.70864 WP_003409218.1.70871 WP_003409218.1.70915 WP_003409218.1.70955 WP_003409218.1.70958 WP_003409218.1.70964 WP_003409218.1.70976 WP_003409218.1.71015 WP_003409218.1.71026 WP_003409218.1.71063 WP_003409218.1.71076 WP_003409218.1.71083 WP_003409218.1.7111 WP_003409218.1.71118 WP_003409218.1.71128 WP_003409218.1.7113 WP_003409218.1.71187 WP_003409218.1.71191 WP_003409218.1.71255 WP_003409218.1.71258 WP_003409218.1.71259 WP_003409218.1.71289 WP_003409218.1.71326 WP_003409218.1.71329 WP_003409218.1.71331 WP_003409218.1.71344 WP_003409218.1.71390 WP_003409218.1.71414 WP_003409218.1.71440 WP_003409218.1.71457 WP_003409218.1.7146 WP_003409218.1.71464 WP_003409218.1.71490 WP_003409218.1.71492 WP_003409218.1.71509 WP_003409218.1.71516 WP_003409218.1.71527 WP_003409218.1.71532 WP_003409218.1.71545 WP_003409218.1.71546 WP_003409218.1.71569 WP_003409218.1.71604 WP_003409218.1.71621 WP_003409218.1.71630 WP_003409218.1.71638 WP_003409218.1.71654 WP_003409218.1.71664 WP_003409218.1.71665 WP_003409218.1.71683 WP_003409218.1.71701 WP_003409218.1.71718 WP_003409218.1.71731 WP_003409218.1.71778 WP_003409218.1.71781 WP_003409218.1.71803 WP_003409218.1.71847 WP_003409218.1.71851 WP_003409218.1.71871 WP_003409218.1.71909 WP_003409218.1.71957 WP_003409218.1.71970 WP_003409218.1.72047 WP_003409218.1.72061 WP_003409218.1.72062 WP_003409218.1.72072 WP_003409218.1.72111 WP_003409218.1.72122 WP_003409218.1.72128 WP_003409218.1.72143 WP_003409218.1.7216 WP_003409218.1.72168 WP_003409218.1.72179 WP_003409218.1.72209 WP_003409218.1.72218 WP_003409218.1.72219 WP_003409218.1.72227 WP_003409218.1.7224 WP_003409218.1.72268 WP_003409218.1.72332 WP_003409218.1.72380 WP_003409218.1.72401 WP_003409218.1.72405 WP_003409218.1.72420 WP_003409218.1.72441 WP_003409218.1.72451 WP_003409218.1.72452 WP_003409218.1.72457 WP_003409218.1.72459 WP_003409218.1.72460 WP_003409218.1.72466 WP_003409218.1.72487 WP_003409218.1.72488 WP_003409218.1.72492 WP_003409218.1.72506 WP_003409218.1.72543 WP_003409218.1.7256 WP_003409218.1.72576 WP_003409218.1.72578 WP_003409218.1.72585 WP_003409218.1.72591 WP_003409218.1.72592 WP_003409218.1.72640 WP_003409218.1.7266 WP_003409218.1.72661 WP_003409218.1.72684 WP_003409218.1.72739 WP_003409218.1.72744 WP_003409218.1.72755 WP_003409218.1.72759 WP_003409218.1.72784 WP_003409218.1.72792 WP_003409218.1.72826 WP_003409218.1.72831 WP_003409218.1.72852 WP_003409218.1.72853 WP_003409218.1.72879 WP_003409218.1.72880 WP_003409218.1.72938 WP_003409218.1.72954 WP_003409218.1.72957 WP_003409218.1.72959 WP_003409218.1.72973 WP_003409218.1.7298 WP_003409218.1.72982 WP_003409218.1.72988 WP_003409218.1.72993 WP_003409218.1.73006 WP_003409218.1.73013 WP_003409218.1.73025 WP_003409218.1.73028 WP_003409218.1.73042 WP_003409218.1.73045 WP_003409218.1.73092 WP_003409218.1.73118 WP_003409218.1.7312 WP_003409218.1.73127 WP_003409218.1.73134 WP_003409218.1.73150 WP_003409218.1.73154 WP_003409218.1.73163 WP_003409218.1.73182 WP_003409218.1.73205 WP_003409218.1.7321 WP_003409218.1.73310 WP_003409218.1.73315 WP_003409218.1.73365 WP_003409218.1.73391 WP_003409218.1.73404 WP_003409218.1.73424 WP_003409218.1.73436 WP_003409218.1.73445 WP_003409218.1.73453 WP_003409218.1.73465 WP_003409218.1.73466 WP_003409218.1.73470 WP_003409218.1.73471 WP_003409218.1.73478 WP_003409218.1.73482 WP_003409218.1.73507 WP_003409218.1.73532 WP_003409218.1.73550 WP_003409218.1.73564 WP_003409218.1.73623 WP_003409218.1.73629 WP_003409218.1.7366 WP_003409218.1.73661 WP_003409218.1.7368 WP_003409218.1.73688 WP_003409218.1.73744 WP_003409218.1.73750 WP_003409218.1.73760 WP_003409218.1.73774 WP_003409218.1.7379 WP_003409218.1.73813 WP_003409218.1.73840 WP_003409218.1.73876 WP_003409218.1.7389 WP_003409218.1.73986 WP_003409218.1.74016 WP_003409218.1.74039 WP_003409218.1.74083 WP_003409218.1.74101 WP_003409218.1.74107 WP_003409218.1.74120 WP_003409218.1.74129 WP_003409218.1.74144 WP_003409218.1.7417 WP_003409218.1.74190 WP_003409218.1.74210 WP_003409218.1.7423 WP_003409218.1.74259 WP_003409218.1.74262 WP_003409218.1.74269 WP_003409218.1.74282 WP_003409218.1.74291 WP_003409218.1.74296 WP_003409218.1.74304 WP_003409218.1.7432 WP_003409218.1.74347 WP_003409218.1.7436 WP_003409218.1.74378 WP_003409218.1.74382 WP_003409218.1.74395 WP_003409218.1.74400 WP_003409218.1.74401 WP_003409218.1.74432 WP_003409218.1.74442 WP_003409218.1.74487 WP_003409218.1.74499 WP_003409218.1.74504 WP_003409218.1.74511 WP_003409218.1.74523 WP_003409218.1.74551 WP_003409218.1.74555 WP_003409218.1.74628 WP_003409218.1.74641 WP_003409218.1.74653 WP_003409218.1.74660 WP_003409218.1.74683 WP_003409218.1.7469 WP_003409218.1.74725 WP_003409218.1.74760 WP_003409218.1.74786 WP_003409218.1.74809 WP_003409218.1.74820 WP_003409218.1.74870 WP_003409218.1.74881 WP_003409218.1.74888 WP_003409218.1.74952 WP_003409218.1.7496 WP_003409218.1.74988 WP_003409218.1.75043 WP_003409218.1.75045 WP_003409218.1.75055 WP_003409218.1.75078 WP_003409218.1.75081 WP_003409218.1.75120 WP_003409218.1.75163 WP_003409218.1.75188 WP_003409218.1.75200 WP_003409218.1.75202 WP_003409218.1.75234 WP_003409218.1.75239 WP_003409218.1.75250 WP_003409218.1.75263 WP_003409218.1.75281 WP_003409218.1.75342 WP_003409218.1.7535 WP_003409218.1.75376 WP_003409218.1.75391 WP_003409218.1.75395 WP_003409218.1.75441 WP_003409218.1.75510 WP_003409218.1.75581 WP_003409218.1.75598 WP_003409218.1.75635 WP_003409218.1.75645 WP_003409218.1.75665 WP_003409218.1.75671 WP_003409218.1.75741 WP_003409218.1.75749 WP_003409218.1.75772 WP_003409218.1.75774 WP_003409218.1.75811 WP_003409218.1.75833 WP_003409218.1.7585 WP_003409218.1.75864 WP_003409218.1.75868 WP_003409218.1.75878 WP_003409218.1.75927 WP_003409218.1.75946 WP_003409218.1.75968 WP_003409218.1.75974 WP_003409218.1.76007 WP_003409218.1.76016 WP_003409218.1.76032 WP_003409218.1.76037 WP_003409218.1.7604 WP_003409218.1.76045 WP_003409218.1.76052 WP_003409218.1.76058 WP_003409218.1.76064 WP_003409218.1.76110 WP_003409218.1.76126 WP_003409218.1.76133 WP_003409218.1.76138 WP_003409218.1.76157 WP_003409218.1.76172 WP_003409218.1.76177 WP_003409218.1.76183 WP_003409218.1.76209 WP_003409218.1.76239 WP_003409218.1.76272 WP_003409218.1.76277 WP_003409218.1.76280 WP_003409218.1.76281 WP_003409218.1.76291 WP_003409218.1.76297 WP_003409218.1.76360 WP_003409218.1.76379 WP_003409218.1.76403 WP_003409218.1.76413 WP_003409218.1.76414 WP_003409218.1.76427 WP_003409218.1.76436 WP_003409218.1.76442 WP_003409218.1.76443 WP_003409218.1.76456 WP_003409218.1.76521 WP_003409218.1.76533 WP_003409218.1.76625 WP_003409218.1.76629 WP_003409218.1.76635 WP_003409218.1.76638 WP_003409218.1.76639 WP_003409218.1.76640 WP_003409218.1.76644 WP_003409218.1.76677 WP_003409218.1.76678 WP_003409218.1.76679 WP_003409218.1.76734 WP_003409218.1.76744 WP_003409218.1.76750 WP_003409218.1.76754 WP_003409218.1.76757 WP_003409218.1.76781 WP_003409218.1.76818 WP_003409218.1.76824 WP_003409218.1.76835 WP_003409218.1.76873 WP_003409218.1.76881 WP_003409218.1.76888 WP_003409218.1.76900 WP_003409218.1.7691 WP_003409218.1.76947 WP_003409218.1.76954 WP_003409218.1.76955 WP_003409218.1.76963 WP_003409218.1.770 WP_003409218.1.77000 WP_003409218.1.77008 WP_003409218.1.77021 WP_003409218.1.77056 WP_003409218.1.77065 WP_003409218.1.77075 WP_003409218.1.77093 WP_003409218.1.77107 WP_003409218.1.77115 WP_003409218.1.77118 WP_003409218.1.77125 WP_003409218.1.77141 WP_003409218.1.77142 WP_003409218.1.77166 WP_003409218.1.77250 WP_003409218.1.77252 WP_003409218.1.77260 WP_003409218.1.77266 WP_003409218.1.77280 WP_003409218.1.77285 WP_003409218.1.77312 WP_003409218.1.77348 WP_003409218.1.77351 WP_003409218.1.77352 WP_003409218.1.77361 WP_003409218.1.774 WP_003409218.1.7740 WP_003409218.1.77404 WP_003409218.1.77425 WP_003409218.1.77463 WP_003409218.1.77474 WP_003409218.1.7748 WP_003409218.1.77484 WP_003409218.1.77491 WP_003409218.1.77499 WP_003409218.1.77510 WP_003409218.1.77530 WP_003409218.1.77554 WP_003409218.1.77559 WP_003409218.1.77599 WP_003409218.1.77605 WP_003409218.1.7762 WP_003409218.1.77627 WP_003409218.1.77649 WP_003409218.1.77654 WP_003409218.1.7766 WP_003409218.1.77667 WP_003409218.1.77704 WP_003409218.1.77706 WP_003409218.1.77726 WP_003409218.1.77774 WP_003409218.1.7778 WP_003409218.1.77790 WP_003409218.1.77809 WP_003409218.1.77820 WP_003409218.1.77843 WP_003409218.1.77855 WP_003409218.1.77865 WP_003409218.1.77868 WP_003409218.1.77879 WP_003409218.1.77890 WP_003409218.1.77909 WP_003409218.1.77911 WP_003409218.1.77931 WP_003409218.1.77984 WP_003409218.1.78020 WP_003409218.1.78024 WP_003409218.1.78075 WP_003409218.1.78086 WP_003409218.1.7809 WP_003409218.1.78098 WP_003409218.1.78105 WP_003409218.1.78113 WP_003409218.1.78136 WP_003409218.1.78162 WP_003409218.1.7817 WP_003409218.1.78200 WP_003409218.1.78216 WP_003409218.1.78236 WP_003409218.1.78238 WP_003409218.1.78322 WP_003409218.1.78338 WP_003409218.1.7836 WP_003409218.1.78360 WP_003409218.1.78386 WP_003409218.1.78429 WP_003409218.1.78435 WP_003409218.1.7844 WP_003409218.1.78459 WP_003409218.1.78488 WP_003409218.1.7849 WP_003409218.1.78499 WP_003409218.1.785 WP_003409218.1.78516 WP_003409218.1.78524 WP_003409218.1.78526 WP_003409218.1.78538 WP_003409218.1.78544 WP_003409218.1.78545 WP_003409218.1.78547 WP_003409218.1.78574 WP_003409218.1.78580 WP_003409218.1.7860 WP_003409218.1.78620 WP_003409218.1.78648 WP_003409218.1.78649 WP_003409218.1.78655 WP_003409218.1.78657 WP_003409218.1.78659 WP_003409218.1.7869 WP_003409218.1.78692 WP_003409218.1.78760 WP_003409218.1.78766 WP_003409218.1.78778 WP_003409218.1.78784 WP_003409218.1.78788 WP_003409218.1.78790 WP_003409218.1.78793 WP_003409218.1.78848 WP_003409218.1.78860 WP_003409218.1.7887 WP_003409218.1.78884 WP_003409218.1.78969 WP_003409218.1.78977 WP_003409218.1.78980 WP_003409218.1.79005 WP_003409218.1.79016 WP_003409218.1.79033 WP_003409218.1.79064 WP_003409218.1.79066 WP_003409218.1.79068 WP_003409218.1.79077 WP_003409218.1.79095 WP_003409218.1.79112 WP_003409218.1.79122 WP_003409218.1.79145 WP_003409218.1.79152 WP_003409218.1.79163 WP_003409218.1.79182 WP_003409218.1.79198 WP_003409218.1.79213 WP_003409218.1.79218 WP_003409218.1.79268 WP_003409218.1.79273 WP_003409218.1.79278 WP_003409218.1.79290 WP_003409218.1.79319 WP_003409218.1.79325 WP_003409218.1.79326 WP_003409218.1.7933 WP_003409218.1.79330 WP_003409218.1.79339 WP_003409218.1.79394 WP_003409218.1.79413 WP_003409218.1.79422 WP_003409218.1.79445 WP_003409218.1.79447 WP_003409218.1.79455 WP_003409218.1.79471 WP_003409218.1.79480 WP_003409218.1.79482 WP_003409218.1.79488 WP_003409218.1.79502 WP_003409218.1.79508 WP_003409218.1.79514 WP_003409218.1.79561 WP_003409218.1.79565 WP_003409218.1.79578 WP_003409218.1.79588 WP_003409218.1.79598 WP_003409218.1.79615 WP_003409218.1.79684 WP_003409218.1.797 WP_003409218.1.79744 WP_003409218.1.79784 WP_003409218.1.79802 WP_003409218.1.79806 WP_003409218.1.79819 WP_003409218.1.79826 WP_003409218.1.79828 WP_003409218.1.79851 WP_003409218.1.79853 WP_003409218.1.79863 WP_003409218.1.79881 WP_003409218.1.79885 WP_003409218.1.79898 WP_003409218.1.7990 WP_003409218.1.79900 WP_003409218.1.79913 WP_003409218.1.79918 WP_003409218.1.79947 WP_003409218.1.79948 WP_003409218.1.7995 WP_003409218.1.7997 WP_003409218.1.80004 WP_003409218.1.80015 WP_003409218.1.80022 WP_003409218.1.80030 WP_003409218.1.80054 WP_003409218.1.80084 WP_003409218.1.80099 WP_003409218.1.80129 WP_003409218.1.80177 WP_003409218.1.80234 WP_003409218.1.8026 WP_003409218.1.80275 WP_003409218.1.8029 WP_003409218.1.80299 WP_003409218.1.80300 WP_003409218.1.80304 WP_003409218.1.80326 WP_003409218.1.80351 WP_003409218.1.8037 WP_003409218.1.80370 WP_003409218.1.80399 WP_003409218.1.8044 WP_003409218.1.80451 WP_003409218.1.80458 WP_003409218.1.80461 WP_003409218.1.80490 WP_003409218.1.80503 WP_003409218.1.80507 WP_003409218.1.80552 WP_003409218.1.80576 WP_003409218.1.80588 WP_003409218.1.80599 WP_003409218.1.8060 WP_003409218.1.80624 WP_003409218.1.80636 WP_003409218.1.80669 WP_003409218.1.80673 WP_003409218.1.80711 WP_003409218.1.80714 WP_003409218.1.80743 WP_003409218.1.80784 WP_003409218.1.80815 WP_003409218.1.80853 WP_003409218.1.80918 WP_003409218.1.8093 WP_003409218.1.80967 WP_003409218.1.8097 WP_003409218.1.80988 WP_003409218.1.81007 WP_003409218.1.81013 WP_003409218.1.8105 WP_003409218.1.81059 WP_003409218.1.81063 WP_003409218.1.81066 WP_003409218.1.81075 WP_003409218.1.81091 WP_003409218.1.81119 WP_003409218.1.81125 WP_003409218.1.81136 WP_003409218.1.8114 WP_003409218.1.81189 WP_003409218.1.81192 WP_003409218.1.812 WP_003409218.1.81230 WP_003409218.1.81249 WP_003409218.1.81250 WP_003409218.1.81264 WP_003409218.1.8128 WP_003409218.1.81287 WP_003409218.1.81297 WP_003409218.1.8138 WP_003409218.1.81407 WP_003409218.1.8143 WP_003409218.1.81439 WP_003409218.1.81465 WP_003409218.1.81505 WP_003409218.1.81529 WP_003409218.1.81541 WP_003409218.1.81560 WP_003409218.1.81561 WP_003409218.1.81567 WP_003409218.1.81583 WP_003409218.1.81686 WP_003409218.1.81712 WP_003409218.1.81720 WP_003409218.1.81731 WP_003409218.1.81774 WP_003409218.1.81788 WP_003409218.1.81809 WP_003409218.1.81820 WP_003409218.1.81850 WP_003409218.1.81883 WP_003409218.1.81891 WP_003409218.1.81911 WP_003409218.1.81918 WP_003409218.1.82011 WP_003409218.1.82048 WP_003409218.1.82069 WP_003409218.1.82071 WP_003409218.1.82108 WP_003409218.1.82136 WP_003409218.1.82142 WP_003409218.1.8215 WP_003409218.1.82158 WP_003409218.1.82209 WP_003409218.1.82210 WP_003409218.1.82228 WP_003409218.1.82236 WP_003409218.1.82251 WP_003409218.1.82271 WP_003409218.1.82305 WP_003409218.1.82307 WP_003409218.1.82309 WP_003409218.1.82317 WP_003409218.1.8232 WP_003409218.1.82346 WP_003409218.1.82374 WP_003409218.1.82385 WP_003409218.1.82429 WP_003409218.1.82460 WP_003409218.1.82462 WP_003409218.1.82483 WP_003409218.1.82494 WP_003409218.1.82531 WP_003409218.1.82546 WP_003409218.1.82547 WP_003409218.1.82549 WP_003409218.1.82577 WP_003409218.1.82592 WP_003409218.1.82597 WP_003409218.1.82598 WP_003409218.1.82625 WP_003409218.1.82642 WP_003409218.1.82651 WP_003409218.1.82653 WP_003409218.1.82681 WP_003409218.1.82685 WP_003409218.1.8271 WP_003409218.1.82712 WP_003409218.1.8273 WP_003409218.1.82757 WP_003409218.1.82774 WP_003409218.1.82803 WP_003409218.1.82836 WP_003409218.1.82860 WP_003409218.1.82871 WP_003409218.1.82892 WP_003409218.1.82935 WP_003409218.1.82957 WP_003409218.1.82973 WP_003409218.1.82981 WP_003409218.1.82983 WP_003409218.1.83004 WP_003409218.1.83009 WP_003409218.1.83044 WP_003409218.1.83065 WP_003409218.1.83074 WP_003409218.1.83110 WP_003409218.1.83146 WP_003409218.1.83149 WP_003409218.1.83159 WP_003409218.1.8317 WP_003409218.1.83173 WP_003409218.1.83181 WP_003409218.1.83191 WP_003409218.1.83197 WP_003409218.1.83212 WP_003409218.1.8326 WP_003409218.1.83262 WP_003409218.1.83268 WP_003409218.1.83273 WP_003409218.1.83309 WP_003409218.1.83332 WP_003409218.1.83334 WP_003409218.1.83341 WP_003409218.1.83349 WP_003409218.1.8335 WP_003409218.1.83353 WP_003409218.1.83367 WP_003409218.1.83380 WP_003409218.1.83381 WP_003409218.1.83389 WP_003409218.1.83408 WP_003409218.1.83409 WP_003409218.1.83435 WP_003409218.1.83470 WP_003409218.1.83524 WP_003409218.1.83526 WP_003409218.1.8358 WP_003409218.1.83589 WP_003409218.1.83601 WP_003409218.1.83611 WP_003409218.1.83638 WP_003409218.1.83648 WP_003409218.1.83656 WP_003409218.1.83667 WP_003409218.1.83689 WP_003409218.1.83692 WP_003409218.1.83705 WP_003409218.1.83766 WP_003409218.1.83793 WP_003409218.1.83794 WP_003409218.1.83802 WP_003409218.1.83805 WP_003409218.1.83839 WP_003409218.1.83842 WP_003409218.1.83850 WP_003409218.1.83861 WP_003409218.1.83884 WP_003409218.1.83920 WP_003409218.1.83929 WP_003409218.1.83930 WP_003409218.1.83975 WP_003409218.1.83991 WP_003409218.1.8400 WP_003409218.1.84027 WP_003409218.1.8404 WP_003409218.1.84057 WP_003409218.1.84070 WP_003409218.1.8409 WP_003409218.1.84112 WP_003409218.1.84146 WP_003409218.1.8415 WP_003409218.1.84176 WP_003409218.1.84186 WP_003409218.1.84192 WP_003409218.1.84228 WP_003409218.1.8424 WP_003409218.1.84244 WP_003409218.1.84259 WP_003409218.1.8426 WP_003409218.1.84277 WP_003409218.1.84287 WP_003409218.1.8434 WP_003409218.1.84388 WP_003409218.1.84408 WP_003409218.1.84409 WP_003409218.1.84438 WP_003409218.1.84460 WP_003409218.1.84488 WP_003409218.1.84504 WP_003409218.1.84525 WP_003409218.1.84620 WP_003409218.1.84623 WP_003409218.1.84641 WP_003409218.1.84655 WP_003409218.1.84666 WP_003409218.1.84670 WP_003409218.1.84739 WP_003409218.1.84748 WP_003409218.1.84766 WP_003409218.1.84772 WP_003409218.1.84774 WP_003409218.1.848 WP_003409218.1.84812 WP_003409218.1.84836 WP_003409218.1.84839 WP_003409218.1.84846 WP_003409218.1.84873 WP_003409218.1.84911 WP_003409218.1.84938 WP_003409218.1.84968 WP_003409218.1.84973 WP_003409218.1.84981 WP_003409218.1.84985 WP_003409218.1.8503 WP_003409218.1.85038 WP_003409218.1.85041 WP_003409218.1.85043 WP_003409218.1.8505 WP_003409218.1.85074 WP_003409218.1.8509 WP_003409218.1.8512 WP_003409218.1.85148 WP_003409218.1.8518 WP_003409218.1.8522 WP_003409218.1.85242 WP_003409218.1.85276 WP_003409218.1.85281 WP_003409218.1.85284 WP_003409218.1.85314 WP_003409218.1.85319 WP_003409218.1.85330 WP_003409218.1.85341 WP_003409218.1.85346 WP_003409218.1.8535 WP_003409218.1.85363 WP_003409218.1.85371 WP_003409218.1.85377 WP_003409218.1.85387 WP_003409218.1.85458 WP_003409218.1.8546 WP_003409218.1.85464 WP_003409218.1.85478 WP_003409218.1.85480 WP_003409218.1.85488 WP_003409218.1.85495 WP_003409218.1.85551 WP_003409218.1.85557 WP_003409218.1.85577 WP_003409218.1.85597 WP_003409218.1.85599 WP_003409218.1.85610 WP_003409218.1.8563 WP_003409218.1.85648 WP_003409218.1.85679 WP_003409218.1.85704 WP_003409218.1.85727 WP_003409218.1.85737 WP_003409218.1.85808 WP_003409218.1.85819 WP_003409218.1.85820 WP_003409218.1.85823 WP_003409218.1.85832 WP_003409218.1.8586 WP_003409218.1.85872 WP_003409218.1.85894 WP_003409218.1.85909 WP_003409218.1.85913 WP_003409218.1.85953 WP_003409218.1.86000 WP_003409218.1.86024 WP_003409218.1.86025 WP_003409218.1.86032 WP_003409218.1.86048 WP_003409218.1.86052 WP_003409218.1.86067 WP_003409218.1.86103 WP_003409218.1.86122 WP_003409218.1.86124 WP_003409218.1.86160 WP_003409218.1.86164 WP_003409218.1.86168 WP_003409218.1.86190 WP_003409218.1.86204 WP_003409218.1.86208 WP_003409218.1.86235 WP_003409218.1.86249 WP_003409218.1.86260 WP_003409218.1.86290 WP_003409218.1.863 WP_003409218.1.86327 WP_003409218.1.86334 WP_003409218.1.86337 WP_003409218.1.86368 WP_003409218.1.86377 WP_003409218.1.86425 WP_003409218.1.86459 WP_003409218.1.8649 WP_003409218.1.86499 WP_003409218.1.86520 WP_003409218.1.86561 WP_003409218.1.86568 WP_003409218.1.86575 WP_003409218.1.86584 WP_003409218.1.86605 WP_003409218.1.86626 WP_003409218.1.86648 WP_003409218.1.8666 WP_003409218.1.86684 WP_003409218.1.86696 WP_003409218.1.86705 WP_003409218.1.86718 WP_003409218.1.86725 WP_003409218.1.86757 WP_003409218.1.86766 WP_003409218.1.86801 WP_003409218.1.86814 WP_003409218.1.86820 WP_003409218.1.86825 WP_003409218.1.86834 WP_003409218.1.8685 WP_003409218.1.86855 WP_003409218.1.86867 WP_003409218.1.86877 WP_003409218.1.86883 WP_003409218.1.8689 WP_003409218.1.86892 WP_003409218.1.86933 WP_003409218.1.86941 WP_003409218.1.86950 WP_003409218.1.86962 WP_003409218.1.86963 WP_003409218.1.8700 WP_003409218.1.87001 WP_003409218.1.87002 WP_003409218.1.87031 WP_003409218.1.87116 WP_003409218.1.87117 WP_003409218.1.8714 WP_003409218.1.87162 WP_003409218.1.87178 WP_003409218.1.87191 WP_003409218.1.87201 WP_003409218.1.87209 WP_003409218.1.87240 WP_003409218.1.87266 WP_003409218.1.87273 WP_003409218.1.87275 WP_003409218.1.8733 WP_003409218.1.87345 WP_003409218.1.87369 WP_003409218.1.8737 WP_003409218.1.87401 WP_003409218.1.87404 WP_003409218.1.87406 WP_003409218.1.87409 WP_003409218.1.87444 WP_003409218.1.87446 WP_003409218.1.87459 WP_003409218.1.87472 WP_003409218.1.87489 WP_003409218.1.87494 WP_003409218.1.87496 WP_003409218.1.87582 WP_003409218.1.87588 WP_003409218.1.87617 WP_003409218.1.87619 WP_003409218.1.87620 WP_003409218.1.87634 WP_003409218.1.87643 WP_003409218.1.8765 WP_003409218.1.87650 WP_003409218.1.87654 WP_003409218.1.87658 WP_003409218.1.87665 WP_003409218.1.87676 WP_003409218.1.87677 WP_003409218.1.87684 WP_003409218.1.87707 WP_003409218.1.87732 WP_003409218.1.87784 WP_003409218.1.87796 WP_003409218.1.87809 WP_003409218.1.87817 WP_003409218.1.87827 WP_003409218.1.87831 WP_003409218.1.87835 WP_003409218.1.87837 WP_003409218.1.87866 WP_003409218.1.8789 WP_003409218.1.87911 WP_003409218.1.87924 WP_003409218.1.87951 WP_003409218.1.87955 WP_003409218.1.87956 WP_003409218.1.87991 WP_003409218.1.88 WP_003409218.1.88002 WP_003409218.1.88037 WP_003409218.1.88039 WP_003409218.1.88072 WP_003409218.1.88077 WP_003409218.1.88121 WP_003409218.1.88180 WP_003409218.1.88191 WP_003409218.1.88205 WP_003409218.1.88217 WP_003409218.1.88219 WP_003409218.1.88245 WP_003409218.1.88253 WP_003409218.1.88294 WP_003409218.1.88316 WP_003409218.1.88320 WP_003409218.1.88338 WP_003409218.1.8840 WP_003409218.1.88437 WP_003409218.1.88453 WP_003409218.1.88469 WP_003409218.1.88489 WP_003409218.1.88507 WP_003409218.1.88521 WP_003409218.1.88530 WP_003409218.1.88537 WP_003409218.1.88541 WP_003409218.1.88592 WP_003409218.1.88616 WP_003409218.1.88618 WP_003409218.1.8862 WP_003409218.1.88625 WP_003409218.1.88632 WP_003409218.1.88634 WP_003409218.1.88649 WP_003409218.1.8870 WP_003409218.1.88737 WP_003409218.1.88756 WP_003409218.1.888 WP_003409218.1.88824 WP_003409218.1.88886 WP_003409218.1.88965 WP_003409218.1.88985 WP_003409218.1.8902 WP_003409218.1.89025 WP_003409218.1.89041 WP_003409218.1.89046 WP_003409218.1.89082 WP_003409218.1.89162 WP_003409218.1.89168 WP_003409218.1.8917 WP_003409218.1.89193 WP_003409218.1.89205 WP_003409218.1.89207 WP_003409218.1.89225 WP_003409218.1.8925 WP_003409218.1.89277 WP_003409218.1.89286 WP_003409218.1.89293 WP_003409218.1.89320 WP_003409218.1.8935 WP_003409218.1.89371 WP_003409218.1.89378 WP_003409218.1.89392 WP_003409218.1.89406 WP_003409218.1.8943 WP_003409218.1.89451 WP_003409218.1.89453 WP_003409218.1.89473 WP_003409218.1.89475 WP_003409218.1.89483 WP_003409218.1.895 WP_003409218.1.89513 WP_003409218.1.89517 WP_003409218.1.89522 WP_003409218.1.8954 WP_003409218.1.89543 WP_003409218.1.89567 WP_003409218.1.8957 WP_003409218.1.89572 WP_003409218.1.89589 WP_003409218.1.89607 WP_003409218.1.89613 WP_003409218.1.89625 WP_003409218.1.89648 WP_003409218.1.8967 WP_003409218.1.89670 WP_003409218.1.89676 WP_003409218.1.89729 WP_003409218.1.89739 WP_003409218.1.89762 WP_003409218.1.8977 WP_003409218.1.89802 WP_003409218.1.89808 WP_003409218.1.8982 WP_003409218.1.89829 WP_003409218.1.89831 WP_003409218.1.89844 WP_003409218.1.89849 WP_003409218.1.8989 WP_003409218.1.89901 WP_003409218.1.89903 WP_003409218.1.89909 WP_003409218.1.8992 WP_003409218.1.89922 WP_003409218.1.89926 WP_003409218.1.89963 WP_003409218.1.89971 WP_003409218.1.8998 WP_003409218.1.89987 WP_003409218.1.900 WP_003409218.1.90048 WP_003409218.1.9007 WP_003409218.1.90080 WP_003409218.1.90130 WP_003409218.1.90134 WP_003409218.1.90137 WP_003409218.1.90157 WP_003409218.1.90184 WP_003409218.1.90199 WP_003409218.1.90231 WP_003409218.1.90245 WP_003409218.1.90308 WP_003409218.1.90322 WP_003409218.1.90328 WP_003409218.1.90372 WP_003409218.1.90439 WP_003409218.1.90481 WP_003409218.1.90499 WP_003409218.1.9050 WP_003409218.1.90527 WP_003409218.1.90550 WP_003409218.1.90560 WP_003409218.1.90612 WP_003409218.1.90640 WP_003409218.1.90672 WP_003409218.1.90687 WP_003409218.1.90691 WP_003409218.1.90711 WP_003409218.1.90722 WP_003409218.1.90744 WP_003409218.1.9075 WP_003409218.1.90756 WP_003409218.1.90767 WP_003409218.1.90771 WP_003409218.1.90785 WP_003409218.1.90788 WP_003409218.1.90800 WP_003409218.1.90810 WP_003409218.1.90816 WP_003409218.1.90819 WP_003409218.1.9082 WP_003409218.1.90831 WP_003409218.1.90884 WP_003409218.1.90899 WP_003409218.1.90906 WP_003409218.1.90958 WP_003409218.1.90976 WP_003409218.1.90977 WP_003409218.1.90987 WP_003409218.1.9102 WP_003409218.1.91026 WP_003409218.1.91032 WP_003409218.1.91043 WP_003409218.1.91053 WP_003409218.1.91082 WP_003409218.1.91106 WP_003409218.1.91112 WP_003409218.1.91144 WP_003409218.1.91151 WP_003409218.1.91157 WP_003409218.1.91167 WP_003409218.1.91169 WP_003409218.1.91192 WP_003409218.1.91201 WP_003409218.1.91207 WP_003409218.1.91208 WP_003409218.1.91211 WP_003409218.1.91214 WP_003409218.1.91230 WP_003409218.1.91244 WP_003409218.1.91251 WP_003409218.1.91260 WP_003409218.1.91265 WP_003409218.1.9128 WP_003409218.1.91284 WP_003409218.1.91294 WP_003409218.1.91303 WP_003409218.1.91322 WP_003409218.1.91352 WP_003409218.1.91386 WP_003409218.1.9139 WP_003409218.1.91398 WP_003409218.1.91411 WP_003409218.1.91430 WP_003409218.1.91436 WP_003409218.1.91483 WP_003409218.1.91496 WP_003409218.1.91508 WP_003409218.1.91576 WP_003409218.1.91589 WP_003409218.1.91694 WP_003409218.1.91695 WP_003409218.1.91713 WP_003409218.1.91716 WP_003409218.1.91717 WP_003409218.1.91728 WP_003409218.1.91743 WP_003409218.1.91759 WP_003409218.1.91784 WP_003409218.1.91785 WP_003409218.1.91786 WP_003409218.1.91802 WP_003409218.1.91822 WP_003409218.1.91828 WP_003409218.1.9189 WP_003409218.1.91896 WP_003409218.1.9190 WP_003409218.1.91915 WP_003409218.1.91931 WP_003409218.1.91937 WP_003409218.1.91944 WP_003409218.1.91953 WP_003409218.1.91957 WP_003409218.1.91978 WP_003409218.1.92021 WP_003409218.1.92083 WP_003409218.1.92127 WP_003409218.1.92144 WP_003409218.1.92153 WP_003409218.1.92190 WP_003409218.1.92192 WP_003409218.1.92200 WP_003409218.1.92220 WP_003409218.1.92221 WP_003409218.1.92222 WP_003409218.1.92273 WP_003409218.1.92289 WP_003409218.1.9229 WP_003409218.1.92294 WP_003409218.1.92300 WP_003409218.1.92317 WP_003409218.1.92338 WP_003409218.1.92345 WP_003409218.1.92356 WP_003409218.1.92364 WP_003409218.1.92380 WP_003409218.1.92416 WP_003409218.1.92428 WP_003409218.1.92447 WP_003409218.1.92456 WP_003409218.1.92467 WP_003409218.1.92471 WP_003409218.1.92508 WP_003409218.1.9251 WP_003409218.1.92511 WP_003409218.1.92523 WP_003409218.1.92527 WP_003409218.1.92536 WP_003409218.1.92592 WP_003409218.1.92597 WP_003409218.1.92603 WP_003409218.1.92606 WP_003409218.1.92610 WP_003409218.1.92613 WP_003409218.1.9263 WP_003409218.1.9265 WP_003409218.1.92650 WP_003409218.1.92660 WP_003409218.1.92677 WP_003409218.1.92685 WP_003409218.1.92689 WP_003409218.1.92690 WP_003409218.1.92706 WP_003409218.1.92714 WP_003409218.1.92736 WP_003409218.1.9274 WP_003409218.1.92752 WP_003409218.1.92760 WP_003409218.1.92777 WP_003409218.1.92803 WP_003409218.1.92833 WP_003409218.1.92856 WP_003409218.1.92892 WP_003409218.1.92907 WP_003409218.1.92908 WP_003409218.1.9291 WP_003409218.1.92917 WP_003409218.1.92996 WP_003409218.1.93006 WP_003409218.1.93008 WP_003409218.1.93009 WP_003409218.1.93015 WP_003409218.1.93043 WP_003409218.1.9307 WP_003409218.1.93083 WP_003409218.1.93097 WP_003409218.1.93137 WP_003409218.1.93192 WP_003409218.1.93203 WP_003409218.1.93212 WP_003409218.1.93234 WP_003409218.1.93245 WP_003409218.1.93257 WP_003409218.1.93265 WP_003409218.1.93297 WP_003409218.1.93320 WP_003409218.1.93328 WP_003409218.1.93337 WP_003409218.1.93343 WP_003409218.1.93349 WP_003409218.1.93363 WP_003409218.1.93377 WP_003409218.1.9338 WP_003409218.1.93407 WP_003409218.1.93417 WP_003409218.1.93419 WP_003409218.1.93426 WP_003409218.1.9344 WP_003409218.1.93443 WP_003409218.1.93447 WP_003409218.1.93470 WP_003409218.1.93483 WP_003409218.1.93487 WP_003409218.1.93495 WP_003409218.1.93499 WP_003409218.1.93516 WP_003409218.1.93536 WP_003409218.1.93544 WP_003409218.1.93555 WP_003409218.1.93560 WP_003409218.1.93564 WP_003409218.1.9357 WP_003409218.1.93573 WP_003409218.1.93576 WP_003409218.1.93588 WP_003409218.1.9363 WP_003409218.1.93645 WP_003409218.1.93649 WP_003409218.1.93659 WP_003409218.1.93677 WP_003409218.1.9368 WP_003409218.1.93689 WP_003409218.1.93693 WP_003409218.1.93698 WP_003409218.1.93706 WP_003409218.1.9371 WP_003409218.1.93792 WP_003409218.1.93823 WP_003409218.1.93871 WP_003409218.1.9388 WP_003409218.1.93894 WP_003409218.1.93903 WP_003409218.1.93907 WP_003409218.1.93913 WP_003409218.1.93946 WP_003409218.1.93950 WP_003409218.1.93953 WP_003409218.1.93954 WP_003409218.1.93988 WP_003409218.1.9407 WP_003409218.1.94143 WP_003409218.1.94154 WP_003409218.1.94184 WP_003409218.1.94204 WP_003409218.1.94226 WP_003409218.1.94231 WP_003409218.1.94256 WP_003409218.1.94261 WP_003409218.1.94281 WP_003409218.1.94292 WP_003409218.1.94297 WP_003409218.1.9431 WP_003409218.1.94326 WP_003409218.1.94339 WP_003409218.1.94392 WP_003409218.1.94416 WP_003409218.1.94421 WP_003409218.1.94456 WP_003409218.1.94470 WP_003409218.1.94480 WP_003409218.1.94495 WP_003409218.1.94511 WP_003409218.1.94512 WP_003409218.1.94525 WP_003409218.1.94528 WP_003409218.1.94564 WP_003409218.1.94602 WP_003409218.1.94623 WP_003409218.1.94629 WP_003409218.1.9465 WP_003409218.1.94673 WP_003409218.1.94714 WP_003409218.1.94730 WP_003409218.1.94776 WP_003409218.1.9478 WP_003409218.1.94834 WP_003409218.1.94852 WP_003409218.1.94872 WP_003409218.1.9488 WP_003409218.1.94902 WP_003409218.1.94916 WP_003409218.1.94979 WP_003409218.1.94994 WP_003409218.1.94996 WP_003409218.1.94998 WP_003409218.1.95007 WP_003409218.1.95010 WP_003409218.1.95015 WP_003409218.1.95034 WP_003409218.1.95068 WP_003409218.1.9509 WP_003409218.1.95096 WP_003409218.1.95112 WP_003409218.1.95138 WP_003409218.1.9514 WP_003409218.1.95179 WP_003409218.1.95188 WP_003409218.1.95190 WP_003409218.1.95234 WP_003409218.1.95241 WP_003409218.1.95245 WP_003409218.1.95257 WP_003409218.1.95279 WP_003409218.1.9531 WP_003409218.1.95335 WP_003409218.1.95344 WP_003409218.1.9535 WP_003409218.1.95370 WP_003409218.1.95392 WP_003409218.1.95416 WP_003409218.1.95417 WP_003409218.1.95454 WP_003409218.1.95455 WP_003409218.1.95491 WP_003409218.1.95508 WP_003409218.1.95509 WP_003409218.1.95529 WP_003409218.1.95556 WP_003409218.1.95557 WP_003409218.1.95565 WP_003409218.1.95578 WP_003409218.1.95580 WP_003409218.1.95585 WP_003409218.1.95643 WP_003409218.1.95679 WP_003409218.1.95685 WP_003409218.1.957 WP_003409218.1.95724 WP_003409218.1.95727 WP_003409218.1.95730 WP_003409218.1.95735 WP_003409218.1.95758 WP_003409218.1.95772 WP_003409218.1.95797 WP_003409218.1.95839 WP_003409218.1.9585 WP_003409218.1.9590 WP_003409218.1.95902 WP_003409218.1.95908 WP_003409218.1.95924 WP_003409218.1.95926 WP_003409218.1.95953 WP_003409218.1.95958 WP_003409218.1.95964 WP_003409218.1.96006 WP_003409218.1.9602 WP_003409218.1.96036 WP_003409218.1.96062 WP_003409218.1.96065 WP_003409218.1.96098 WP_003409218.1.96146 WP_003409218.1.96166 WP_003409218.1.96171 WP_003409218.1.96182 WP_003409218.1.96204 WP_003409218.1.96230 WP_003409218.1.96235 WP_003409218.1.96242 WP_003409218.1.96245 WP_003409218.1.96254 WP_003409218.1.96259 WP_003409218.1.96286 WP_003409218.1.96313 WP_003409218.1.96318 WP_003409218.1.96345 WP_003409218.1.96360 WP_003409218.1.96373 WP_003409218.1.96456 WP_003409218.1.96486 WP_003409218.1.96569 WP_003409218.1.96573 WP_003409218.1.96575 WP_003409218.1.96576 WP_003409218.1.96611 WP_003409218.1.96621 WP_003409218.1.9667 WP_003409218.1.96681 WP_003409218.1.96726 WP_003409218.1.96733 WP_003409218.1.96742 WP_003409218.1.96754 WP_003409218.1.9678 WP_003409218.1.96832 WP_003409218.1.97008 WP_003409218.1.97009 WP_003409218.1.97056 WP_003409218.1.97084 WP_003409218.1.97087 WP_003409218.1.97094 WP_003409218.1.97096 WP_003409218.1.97099 WP_003409218.1.97108 WP_003409218.1.97113 WP_003409218.1.97122 WP_003409218.1.97127 WP_003409218.1.97129 WP_003409218.1.97136 WP_003409218.1.9716 WP_003409218.1.97176 WP_003409218.1.97222 WP_003409218.1.97223 WP_003409218.1.97237 WP_003409218.1.97242 WP_003409218.1.97270 WP_003409218.1.97283 WP_003409218.1.97296 WP_003409218.1.97321 WP_003409218.1.97325 WP_003409218.1.97330 WP_003409218.1.97366 WP_003409218.1.97376 WP_003409218.1.97380 WP_003409218.1.9739 WP_003409218.1.97462 WP_003409218.1.97517 WP_003409218.1.97519 WP_003409218.1.97535 WP_003409218.1.97540 WP_003409218.1.97545 WP_003409218.1.97546 WP_003409218.1.97550 WP_003409218.1.97568 WP_003409218.1.97577 WP_003409218.1.97584 WP_003409218.1.9759 WP_003409218.1.97591 WP_003409218.1.97596 WP_003409218.1.97609 WP_003409218.1.97618 WP_003409218.1.9763 WP_003409218.1.97669 WP_003409218.1.97673 WP_003409218.1.97700 WP_003409218.1.97701 WP_003409218.1.9773 WP_003409218.1.97730 WP_003409218.1.97740 WP_003409218.1.97751 WP_003409218.1.97754 WP_003409218.1.97797 WP_003409218.1.9782 WP_003409218.1.9784 WP_003409218.1.97888 WP_003409218.1.9790 WP_003409218.1.9795 WP_003409218.1.97951 WP_003409218.1.97958 WP_003409218.1.97966 WP_003409218.1.97977 WP_003409218.1.97979 WP_003409218.1.97995 WP_003409218.1.98018 WP_003409218.1.98034 WP_003409218.1.98052 WP_003409218.1.98071 WP_003409218.1.98072 WP_003409218.1.98113 WP_003409218.1.98114 WP_003409218.1.98128 WP_003409218.1.98181 WP_003409218.1.98188 WP_003409218.1.98189 WP_003409218.1.98213 WP_003409218.1.98225 WP_003409218.1.98291 WP_003409218.1.98335 WP_003409218.1.98350 WP_003409218.1.98395 WP_003409218.1.98412 WP_003409218.1.98441 WP_003409218.1.98443 WP_003409218.1.98462 WP_003409218.1.9848 WP_003409218.1.98482 WP_003409218.1.98486 WP_003409218.1.98488 WP_003409218.1.98503 WP_003409218.1.98516 WP_003409218.1.98524 WP_003409218.1.98536 WP_003409218.1.98541 WP_003409218.1.98566 WP_003409218.1.98576 WP_003409218.1.98590 WP_003409218.1.98594 WP_003409218.1.98599 WP_003409218.1.98629 WP_003409218.1.98645 WP_003409218.1.98649 WP_003409218.1.98656 WP_003409218.1.9867 WP_003409218.1.98674 WP_003409218.1.98697 WP_003409218.1.98701 WP_003409218.1.98739 WP_003409218.1.98749 WP_003409218.1.98765 WP_003409218.1.98770 WP_003409218.1.98777 WP_003409218.1.98778 WP_003409218.1.98802 WP_003409218.1.98838 WP_003409218.1.98906 WP_003409218.1.98935 WP_003409218.1.98948 WP_003409218.1.98953 WP_003409218.1.98984 WP_003409218.1.99000 WP_003409218.1.99023 WP_003409218.1.99030 WP_003409218.1.99037 WP_003409218.1.99055 WP_003409218.1.99062 WP_003409218.1.99086 WP_003409218.1.99115 WP_003409218.1.99161 WP_003409218.1.99176 WP_003409218.1.99205 WP_003409218.1.99211 WP_003409218.1.99216 WP_003409218.1.99222 WP_003409218.1.99251 WP_003409218.1.99269 WP_003409218.1.99294 WP_003409218.1.99312 WP_003409218.1.99315 WP_003409218.1.99316 WP_003409218.1.99322 WP_003409218.1.99328 WP_003409218.1.99365 WP_003409218.1.99368 WP_003409218.1.99379 WP_003409218.1.99396 WP_003409218.1.99402 WP_003409218.1.99404 WP_003409218.1.99419 WP_003409218.1.99438 WP_003409218.1.99460 WP_003409218.1.99468 WP_003409218.1.99513 WP_003409218.1.99529 WP_003409218.1.99548 WP_003409218.1.99572 WP_003409218.1.99575 WP_003409218.1.99578 WP_003409218.1.99605 WP_003409218.1.99609 WP_003409218.1.99617 WP_003409218.1.99635 WP_003409218.1.99650 WP_003409218.1.99672 WP_003409218.1.99701 WP_003409218.1.99711 WP_003409218.1.99716 WP_003409218.1.99740 WP_003409218.1.99745 WP_003409218.1.99749 WP_003409218.1.9976 WP_003409218.1.99798 WP_003409218.1.99817 WP_003409218.1.99832 WP_003409218.1.99847 WP_003409218.1.99852 WP_003409218.1.99886 WP_003409218.1.99897 WP_003409218.1.99899 WP_003409218.1.99915 WP_003409218.1.9993 WP_003409218.1.99982 WP_003409218.1.99991 NYSGXRC-13552a Rv1820 gi|224990207|ref|YP_002644894.1| gi|375296386|ref|YP_005100653.1| gi|479314735|ref|YP_007854787.1| gi|385991191|ref|YP_005909489.1| gi|15608957|ref|NP_216336.1| gi|392386476|ref|YP_005308105.1| gi|197740464|ref|YP_002161778.1| gi|525674486|ref|YP_008225923.1| gi|31793010|ref|NP_855503.1| gi|121637723|ref|YP_977946.1| gi|253799136|ref|YP_003032137.1| gi|385998596|ref|YP_005916894.1| gi|449063881|ref|YP_007430964.1| gi|15841290|ref|NP_336327.1| gi|148823033|ref|YP_001287787.1| gi|378771566|ref|YP_005171299.1| gi|383307642|ref|YP_005360453.1| gi|392432599|ref|YP_006473643.1| gi|15608957|ref|NP_216336.1| 233413.Mb1851 336982.TBFG_11850 410289.BCG_1855 419947.MRA_1832 478434.TBMG_02173 561275.JTY_1839 83331.MT1868 83332.Rv1820 gi|433641952|ref|YP_007287711.1| gi|148661626|ref|YP_001283149.1| gi|386004779|ref|YP_005923058.1| gi|494700234|ref|YP_007965716.1| gi|471337767|ref|YP_007610480.1| gi|506926298|ref|YP_008006748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]