SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378772233|ref|YP_005171966.1| from Mycobacterium bovis BCG str. Mexico

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378772233|ref|YP_005171966.1|
Domain Number 1 Region: 38-361
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.33e-103
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378772233|ref|YP_005171966.1|
Sequence length 367
Comment Pyruvate dehydrogenase E1 component subunit alpha [Mycobacterium bovis BCG str. Mexico]
Sequence
MGEGSRRPSGMLMSVDLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTE
FVNLQRQGELALYTPCRGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAW
RGTWHGGLQFTTKCCAPMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVH
EALNFAAVFTTPCVFYVQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACY
AVMAEAAARARAGDGPTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYL
QDQGLWSQRLEEQVTARAKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQREQLR
AELARTD
Download sequence
Identical sequences A0A045GXI6 A0A083W0T0 A0A0H3M8U9 A0A197IWF6 A0A1R3Y1D9 A0A1S1BF13 A5U5J4 F8M271 G0TPX4 I6YDK3 M8DEI6 P9WIS2 P9WIS3 R4MAV7
Rv2497c gi|385999277|ref|YP_005917576.1| gi|494696878|ref|YP_007962381.1| 233413.Mb2525c 336982.TBFG_12519 410289.BCG_2517c 419947.MRA_2523 478434.TBMG_01474 561275.JTY_2511 83331.MT2572 83332.Rv2497c gi|378772233|ref|YP_005171966.1| gi|506927031|ref|YP_008007481.1| gi|197737521|ref|YP_002158839.1| gi|479315446|ref|YP_007855498.1| NP_217013.1.84033 WP_003412761.1.100000 WP_003412761.1.100021 WP_003412761.1.100069 WP_003412761.1.100087 WP_003412761.1.10015 WP_003412761.1.100208 WP_003412761.1.100216 WP_003412761.1.10022 WP_003412761.1.100255 WP_003412761.1.100260 WP_003412761.1.100270 WP_003412761.1.100279 WP_003412761.1.100286 WP_003412761.1.100308 WP_003412761.1.100309 WP_003412761.1.100318 WP_003412761.1.100337 WP_003412761.1.100338 WP_003412761.1.10037 WP_003412761.1.100383 WP_003412761.1.100395 WP_003412761.1.100396 WP_003412761.1.1004 WP_003412761.1.100401 WP_003412761.1.100459 WP_003412761.1.100460 WP_003412761.1.100552 WP_003412761.1.100581 WP_003412761.1.100600 WP_003412761.1.100625 WP_003412761.1.10064 WP_003412761.1.100666 WP_003412761.1.100671 WP_003412761.1.100677 WP_003412761.1.100682 WP_003412761.1.100697 WP_003412761.1.100703 WP_003412761.1.100716 WP_003412761.1.100722 WP_003412761.1.100754 WP_003412761.1.100757 WP_003412761.1.100772 WP_003412761.1.1008 WP_003412761.1.100812 WP_003412761.1.100845 WP_003412761.1.100866 WP_003412761.1.10088 WP_003412761.1.100889 WP_003412761.1.10090 WP_003412761.1.100910 WP_003412761.1.100915 WP_003412761.1.100918 WP_003412761.1.100935 WP_003412761.1.100984 WP_003412761.1.100992 WP_003412761.1.100998 WP_003412761.1.101 WP_003412761.1.101025 WP_003412761.1.101028 WP_003412761.1.10104 WP_003412761.1.101048 WP_003412761.1.101054 WP_003412761.1.101075 WP_003412761.1.101143 WP_003412761.1.101146 WP_003412761.1.10116 WP_003412761.1.10117 WP_003412761.1.101209 WP_003412761.1.10125 WP_003412761.1.101290 WP_003412761.1.101323 WP_003412761.1.101324 WP_003412761.1.101350 WP_003412761.1.101367 WP_003412761.1.101398 WP_003412761.1.101403 WP_003412761.1.101421 WP_003412761.1.10144 WP_003412761.1.101442 WP_003412761.1.10145 WP_003412761.1.101452 WP_003412761.1.101456 WP_003412761.1.101481 WP_003412761.1.101493 WP_003412761.1.101496 WP_003412761.1.101525 WP_003412761.1.101533 WP_003412761.1.101535 WP_003412761.1.101553 WP_003412761.1.101558 WP_003412761.1.10156 WP_003412761.1.101573 WP_003412761.1.101576 WP_003412761.1.10159 WP_003412761.1.101592 WP_003412761.1.101604 WP_003412761.1.101607 WP_003412761.1.101622 WP_003412761.1.101644 WP_003412761.1.101659 WP_003412761.1.101671 WP_003412761.1.101687 WP_003412761.1.101698 WP_003412761.1.10170 WP_003412761.1.101713 WP_003412761.1.101722 WP_003412761.1.101733 WP_003412761.1.101743 WP_003412761.1.101753 WP_003412761.1.101764 WP_003412761.1.101773 WP_003412761.1.101795 WP_003412761.1.101797 WP_003412761.1.101798 WP_003412761.1.101802 WP_003412761.1.101826 WP_003412761.1.101836 WP_003412761.1.101858 WP_003412761.1.101859 WP_003412761.1.101862 WP_003412761.1.101888 WP_003412761.1.101894 WP_003412761.1.101899 WP_003412761.1.1019 WP_003412761.1.101923 WP_003412761.1.101925 WP_003412761.1.10193 WP_003412761.1.101996 WP_003412761.1.102 WP_003412761.1.102008 WP_003412761.1.102017 WP_003412761.1.102053 WP_003412761.1.102055 WP_003412761.1.102063 WP_003412761.1.102099 WP_003412761.1.1021 WP_003412761.1.10211 WP_003412761.1.102119 WP_003412761.1.102121 WP_003412761.1.102143 WP_003412761.1.10216 WP_003412761.1.10224 WP_003412761.1.10253 WP_003412761.1.10262 WP_003412761.1.10272 WP_003412761.1.10277 WP_003412761.1.1033 WP_003412761.1.10350 WP_003412761.1.10362 WP_003412761.1.10366 WP_003412761.1.10376 WP_003412761.1.10396 WP_003412761.1.10410 WP_003412761.1.10414 WP_003412761.1.10421 WP_003412761.1.10430 WP_003412761.1.1044 WP_003412761.1.10440 WP_003412761.1.10445 WP_003412761.1.10471 WP_003412761.1.10472 WP_003412761.1.10489 WP_003412761.1.105 WP_003412761.1.10518 WP_003412761.1.10523 WP_003412761.1.10545 WP_003412761.1.1057 WP_003412761.1.10594 WP_003412761.1.10603 WP_003412761.1.10606 WP_003412761.1.10615 WP_003412761.1.10623 WP_003412761.1.10635 WP_003412761.1.10643 WP_003412761.1.10648 WP_003412761.1.10662 WP_003412761.1.10709 WP_003412761.1.10735 WP_003412761.1.10740 WP_003412761.1.10756 WP_003412761.1.1078 WP_003412761.1.10791 WP_003412761.1.10799 WP_003412761.1.10825 WP_003412761.1.10848 WP_003412761.1.10863 WP_003412761.1.10879 WP_003412761.1.10912 WP_003412761.1.10916 WP_003412761.1.10923 WP_003412761.1.10927 WP_003412761.1.1095 WP_003412761.1.10956 WP_003412761.1.10958 WP_003412761.1.10962 WP_003412761.1.10980 WP_003412761.1.10981 WP_003412761.1.10993 WP_003412761.1.1100 WP_003412761.1.11040 WP_003412761.1.11061 WP_003412761.1.11070 WP_003412761.1.11171 WP_003412761.1.11175 WP_003412761.1.11176 WP_003412761.1.11222 WP_003412761.1.11236 WP_003412761.1.11329 WP_003412761.1.1133 WP_003412761.1.11373 WP_003412761.1.11376 WP_003412761.1.11390 WP_003412761.1.11402 WP_003412761.1.11481 WP_003412761.1.11487 WP_003412761.1.11489 WP_003412761.1.11491 WP_003412761.1.11514 WP_003412761.1.11587 WP_003412761.1.11589 WP_003412761.1.11596 WP_003412761.1.11604 WP_003412761.1.11610 WP_003412761.1.11697 WP_003412761.1.11707 WP_003412761.1.11752 WP_003412761.1.11758 WP_003412761.1.11761 WP_003412761.1.11775 WP_003412761.1.11804 WP_003412761.1.11822 WP_003412761.1.11826 WP_003412761.1.11856 WP_003412761.1.11898 WP_003412761.1.11939 WP_003412761.1.11960 WP_003412761.1.11961 WP_003412761.1.11972 WP_003412761.1.11984 WP_003412761.1.120 WP_003412761.1.12001 WP_003412761.1.12049 WP_003412761.1.12052 WP_003412761.1.12100 WP_003412761.1.12116 WP_003412761.1.12130 WP_003412761.1.12161 WP_003412761.1.12165 WP_003412761.1.12184 WP_003412761.1.12187 WP_003412761.1.12190 WP_003412761.1.12216 WP_003412761.1.12265 WP_003412761.1.12275 WP_003412761.1.12293 WP_003412761.1.12294 WP_003412761.1.123 WP_003412761.1.1231 WP_003412761.1.12314 WP_003412761.1.12327 WP_003412761.1.12338 WP_003412761.1.1236 WP_003412761.1.12371 WP_003412761.1.12372 WP_003412761.1.12389 WP_003412761.1.12406 WP_003412761.1.1241 WP_003412761.1.12421 WP_003412761.1.12424 WP_003412761.1.12446 WP_003412761.1.12464 WP_003412761.1.12479 WP_003412761.1.12519 WP_003412761.1.12523 WP_003412761.1.12526 WP_003412761.1.1255 WP_003412761.1.12550 WP_003412761.1.12551 WP_003412761.1.12563 WP_003412761.1.12611 WP_003412761.1.12669 WP_003412761.1.1267 WP_003412761.1.12672 WP_003412761.1.12692 WP_003412761.1.1271 WP_003412761.1.12710 WP_003412761.1.12768 WP_003412761.1.1279 WP_003412761.1.12794 WP_003412761.1.12801 WP_003412761.1.12804 WP_003412761.1.12821 WP_003412761.1.12841 WP_003412761.1.12854 WP_003412761.1.12871 WP_003412761.1.12901 WP_003412761.1.12941 WP_003412761.1.12947 WP_003412761.1.12957 WP_003412761.1.12972 WP_003412761.1.13028 WP_003412761.1.13043 WP_003412761.1.13086 WP_003412761.1.13087 WP_003412761.1.13090 WP_003412761.1.13096 WP_003412761.1.13163 WP_003412761.1.13175 WP_003412761.1.13183 WP_003412761.1.132 WP_003412761.1.13249 WP_003412761.1.13282 WP_003412761.1.13284 WP_003412761.1.13296 WP_003412761.1.13298 WP_003412761.1.13302 WP_003412761.1.13306 WP_003412761.1.13312 WP_003412761.1.13313 WP_003412761.1.13321 WP_003412761.1.13345 WP_003412761.1.13358 WP_003412761.1.13370 WP_003412761.1.13375 WP_003412761.1.13420 WP_003412761.1.13435 WP_003412761.1.13438 WP_003412761.1.13461 WP_003412761.1.13466 WP_003412761.1.13489 WP_003412761.1.13526 WP_003412761.1.13551 WP_003412761.1.13564 WP_003412761.1.13579 WP_003412761.1.13647 WP_003412761.1.13667 WP_003412761.1.13687 WP_003412761.1.13697 WP_003412761.1.13719 WP_003412761.1.13763 WP_003412761.1.1377 WP_003412761.1.13774 WP_003412761.1.13786 WP_003412761.1.13793 WP_003412761.1.13794 WP_003412761.1.13817 WP_003412761.1.13834 WP_003412761.1.13866 WP_003412761.1.13880 WP_003412761.1.13899 WP_003412761.1.13909 WP_003412761.1.13910 WP_003412761.1.13919 WP_003412761.1.13920 WP_003412761.1.13952 WP_003412761.1.13953 WP_003412761.1.13962 WP_003412761.1.1398 WP_003412761.1.13988 WP_003412761.1.14027 WP_003412761.1.14046 WP_003412761.1.14115 WP_003412761.1.1415 WP_003412761.1.14152 WP_003412761.1.14158 WP_003412761.1.14162 WP_003412761.1.14175 WP_003412761.1.14178 WP_003412761.1.14194 WP_003412761.1.14195 WP_003412761.1.14208 WP_003412761.1.14238 WP_003412761.1.14266 WP_003412761.1.14273 WP_003412761.1.14303 WP_003412761.1.14306 WP_003412761.1.14307 WP_003412761.1.14310 WP_003412761.1.14341 WP_003412761.1.14382 WP_003412761.1.14416 WP_003412761.1.14428 WP_003412761.1.14441 WP_003412761.1.14469 WP_003412761.1.14504 WP_003412761.1.14514 WP_003412761.1.1452 WP_003412761.1.14527 WP_003412761.1.1454 WP_003412761.1.14544 WP_003412761.1.14548 WP_003412761.1.14551 WP_003412761.1.14561 WP_003412761.1.14573 WP_003412761.1.1462 WP_003412761.1.14658 WP_003412761.1.14667 WP_003412761.1.14668 WP_003412761.1.14675 WP_003412761.1.14694 WP_003412761.1.14695 WP_003412761.1.14709 WP_003412761.1.14766 WP_003412761.1.14783 WP_003412761.1.14865 WP_003412761.1.14872 WP_003412761.1.14905 WP_003412761.1.14926 WP_003412761.1.14951 WP_003412761.1.14955 WP_003412761.1.15003 WP_003412761.1.15009 WP_003412761.1.15028 WP_003412761.1.15040 WP_003412761.1.15052 WP_003412761.1.15065 WP_003412761.1.15072 WP_003412761.1.15089 WP_003412761.1.1509 WP_003412761.1.15126 WP_003412761.1.15131 WP_003412761.1.15168 WP_003412761.1.15172 WP_003412761.1.15187 WP_003412761.1.15196 WP_003412761.1.15210 WP_003412761.1.15216 WP_003412761.1.15217 WP_003412761.1.1523 WP_003412761.1.15232 WP_003412761.1.15238 WP_003412761.1.15240 WP_003412761.1.15253 WP_003412761.1.15267 WP_003412761.1.1527 WP_003412761.1.15292 WP_003412761.1.15299 WP_003412761.1.15302 WP_003412761.1.15322 WP_003412761.1.1534 WP_003412761.1.15345 WP_003412761.1.15365 WP_003412761.1.15372 WP_003412761.1.15386 WP_003412761.1.15387 WP_003412761.1.15442 WP_003412761.1.15449 WP_003412761.1.15477 WP_003412761.1.15481 WP_003412761.1.15492 WP_003412761.1.15511 WP_003412761.1.15512 WP_003412761.1.15558 WP_003412761.1.15566 WP_003412761.1.15599 WP_003412761.1.1560 WP_003412761.1.15611 WP_003412761.1.1563 WP_003412761.1.15633 WP_003412761.1.15643 WP_003412761.1.15688 WP_003412761.1.15755 WP_003412761.1.15763 WP_003412761.1.15774 WP_003412761.1.1578 WP_003412761.1.15780 WP_003412761.1.15827 WP_003412761.1.15834 WP_003412761.1.15842 WP_003412761.1.15848 WP_003412761.1.15853 WP_003412761.1.15870 WP_003412761.1.15877 WP_003412761.1.15893 WP_003412761.1.15896 WP_003412761.1.15926 WP_003412761.1.15933 WP_003412761.1.15946 WP_003412761.1.15958 WP_003412761.1.15973 WP_003412761.1.15987 WP_003412761.1.15993 WP_003412761.1.16009 WP_003412761.1.16025 WP_003412761.1.16043 WP_003412761.1.16055 WP_003412761.1.16066 WP_003412761.1.16069 WP_003412761.1.16077 WP_003412761.1.16106 WP_003412761.1.16108 WP_003412761.1.16110 WP_003412761.1.16130 WP_003412761.1.16139 WP_003412761.1.16141 WP_003412761.1.16143 WP_003412761.1.1630 WP_003412761.1.16318 WP_003412761.1.1632 WP_003412761.1.16327 WP_003412761.1.16334 WP_003412761.1.16341 WP_003412761.1.16345 WP_003412761.1.16374 WP_003412761.1.16384 WP_003412761.1.16386 WP_003412761.1.164 WP_003412761.1.1642 WP_003412761.1.16421 WP_003412761.1.16424 WP_003412761.1.16426 WP_003412761.1.16431 WP_003412761.1.16438 WP_003412761.1.1644 WP_003412761.1.16442 WP_003412761.1.16448 WP_003412761.1.16451 WP_003412761.1.16476 WP_003412761.1.16480 WP_003412761.1.16494 WP_003412761.1.1652 WP_003412761.1.16549 WP_003412761.1.16560 WP_003412761.1.16598 WP_003412761.1.16609 WP_003412761.1.16619 WP_003412761.1.16620 WP_003412761.1.16622 WP_003412761.1.16637 WP_003412761.1.1669 WP_003412761.1.16707 WP_003412761.1.16724 WP_003412761.1.16731 WP_003412761.1.16743 WP_003412761.1.1683 WP_003412761.1.16837 WP_003412761.1.16852 WP_003412761.1.16937 WP_003412761.1.16940 WP_003412761.1.16950 WP_003412761.1.16959 WP_003412761.1.16968 WP_003412761.1.1697 WP_003412761.1.16973 WP_003412761.1.16977 WP_003412761.1.16987 WP_003412761.1.17005 WP_003412761.1.17006 WP_003412761.1.17010 WP_003412761.1.17015 WP_003412761.1.17019 WP_003412761.1.17039 WP_003412761.1.17041 WP_003412761.1.17052 WP_003412761.1.17057 WP_003412761.1.17062 WP_003412761.1.1707 WP_003412761.1.17094 WP_003412761.1.17130 WP_003412761.1.17138 WP_003412761.1.17147 WP_003412761.1.17167 WP_003412761.1.17224 WP_003412761.1.17251 WP_003412761.1.17288 WP_003412761.1.17304 WP_003412761.1.17314 WP_003412761.1.17345 WP_003412761.1.17381 WP_003412761.1.17391 WP_003412761.1.17412 WP_003412761.1.1743 WP_003412761.1.17440 WP_003412761.1.17466 WP_003412761.1.17477 WP_003412761.1.17483 WP_003412761.1.17505 WP_003412761.1.17527 WP_003412761.1.17535 WP_003412761.1.17540 WP_003412761.1.17553 WP_003412761.1.17558 WP_003412761.1.17599 WP_003412761.1.17635 WP_003412761.1.17655 WP_003412761.1.17679 WP_003412761.1.1768 WP_003412761.1.17687 WP_003412761.1.17700 WP_003412761.1.17710 WP_003412761.1.17713 WP_003412761.1.17722 WP_003412761.1.17746 WP_003412761.1.17788 WP_003412761.1.17798 WP_003412761.1.17803 WP_003412761.1.17816 WP_003412761.1.17821 WP_003412761.1.17830 WP_003412761.1.17868 WP_003412761.1.17878 WP_003412761.1.1792 WP_003412761.1.17923 WP_003412761.1.1795 WP_003412761.1.17955 WP_003412761.1.17973 WP_003412761.1.18009 WP_003412761.1.18013 WP_003412761.1.18033 WP_003412761.1.18057 WP_003412761.1.18065 WP_003412761.1.18070 WP_003412761.1.18116 WP_003412761.1.18120 WP_003412761.1.18126 WP_003412761.1.1817 WP_003412761.1.18170 WP_003412761.1.18206 WP_003412761.1.18216 WP_003412761.1.18240 WP_003412761.1.18257 WP_003412761.1.18297 WP_003412761.1.18306 WP_003412761.1.18364 WP_003412761.1.18399 WP_003412761.1.18411 WP_003412761.1.18444 WP_003412761.1.18448 WP_003412761.1.18467 WP_003412761.1.18476 WP_003412761.1.18522 WP_003412761.1.18580 WP_003412761.1.18582 WP_003412761.1.18587 WP_003412761.1.186 WP_003412761.1.18601 WP_003412761.1.18639 WP_003412761.1.18646 WP_003412761.1.18647 WP_003412761.1.1868 WP_003412761.1.18694 WP_003412761.1.18710 WP_003412761.1.18751 WP_003412761.1.18781 WP_003412761.1.18793 WP_003412761.1.18804 WP_003412761.1.18816 WP_003412761.1.18823 WP_003412761.1.18827 WP_003412761.1.18838 WP_003412761.1.18849 WP_003412761.1.18856 WP_003412761.1.18945 WP_003412761.1.1898 WP_003412761.1.19005 WP_003412761.1.19056 WP_003412761.1.19063 WP_003412761.1.19066 WP_003412761.1.19071 WP_003412761.1.19085 WP_003412761.1.19094 WP_003412761.1.19144 WP_003412761.1.19159 WP_003412761.1.19193 WP_003412761.1.19231 WP_003412761.1.19243 WP_003412761.1.19264 WP_003412761.1.19295 WP_003412761.1.19307 WP_003412761.1.19326 WP_003412761.1.1933 WP_003412761.1.19364 WP_003412761.1.19382 WP_003412761.1.19400 WP_003412761.1.19426 WP_003412761.1.19429 WP_003412761.1.19464 WP_003412761.1.19480 WP_003412761.1.19512 WP_003412761.1.19553 WP_003412761.1.19562 WP_003412761.1.19564 WP_003412761.1.19568 WP_003412761.1.19572 WP_003412761.1.19595 WP_003412761.1.19596 WP_003412761.1.19600 WP_003412761.1.19630 WP_003412761.1.1967 WP_003412761.1.19694 WP_003412761.1.1970 WP_003412761.1.19707 WP_003412761.1.19742 WP_003412761.1.19785 WP_003412761.1.19820 WP_003412761.1.19868 WP_003412761.1.19874 WP_003412761.1.19890 WP_003412761.1.19900 WP_003412761.1.19922 WP_003412761.1.19936 WP_003412761.1.19946 WP_003412761.1.19949 WP_003412761.1.19960 WP_003412761.1.19964 WP_003412761.1.20007 WP_003412761.1.20016 WP_003412761.1.20028 WP_003412761.1.2003 WP_003412761.1.20037 WP_003412761.1.20039 WP_003412761.1.20082 WP_003412761.1.20085 WP_003412761.1.20097 WP_003412761.1.20116 WP_003412761.1.20130 WP_003412761.1.20141 WP_003412761.1.20142 WP_003412761.1.20158 WP_003412761.1.20239 WP_003412761.1.20243 WP_003412761.1.20262 WP_003412761.1.20268 WP_003412761.1.20272 WP_003412761.1.20273 WP_003412761.1.20280 WP_003412761.1.20294 WP_003412761.1.20300 WP_003412761.1.20309 WP_003412761.1.20322 WP_003412761.1.2037 WP_003412761.1.20372 WP_003412761.1.20381 WP_003412761.1.204 WP_003412761.1.20427 WP_003412761.1.20432 WP_003412761.1.20457 WP_003412761.1.20459 WP_003412761.1.20460 WP_003412761.1.20542 WP_003412761.1.20578 WP_003412761.1.20608 WP_003412761.1.20624 WP_003412761.1.20628 WP_003412761.1.2066 WP_003412761.1.20707 WP_003412761.1.20722 WP_003412761.1.20729 WP_003412761.1.20742 WP_003412761.1.20751 WP_003412761.1.20776 WP_003412761.1.20843 WP_003412761.1.20850 WP_003412761.1.2086 WP_003412761.1.20868 WP_003412761.1.20876 WP_003412761.1.20897 WP_003412761.1.20898 WP_003412761.1.2090 WP_003412761.1.20911 WP_003412761.1.20916 WP_003412761.1.20921 WP_003412761.1.20926 WP_003412761.1.20927 WP_003412761.1.20951 WP_003412761.1.20970 WP_003412761.1.2104 WP_003412761.1.21070 WP_003412761.1.21127 WP_003412761.1.21135 WP_003412761.1.21173 WP_003412761.1.21187 WP_003412761.1.212 WP_003412761.1.2120 WP_003412761.1.21218 WP_003412761.1.21219 WP_003412761.1.2123 WP_003412761.1.21231 WP_003412761.1.21234 WP_003412761.1.2126 WP_003412761.1.21292 WP_003412761.1.21307 WP_003412761.1.2131 WP_003412761.1.21311 WP_003412761.1.21321 WP_003412761.1.21365 WP_003412761.1.2137 WP_003412761.1.21392 WP_003412761.1.21397 WP_003412761.1.21403 WP_003412761.1.21415 WP_003412761.1.21418 WP_003412761.1.21430 WP_003412761.1.21434 WP_003412761.1.21444 WP_003412761.1.21468 WP_003412761.1.21498 WP_003412761.1.21509 WP_003412761.1.21513 WP_003412761.1.21560 WP_003412761.1.21565 WP_003412761.1.21586 WP_003412761.1.21591 WP_003412761.1.21594 WP_003412761.1.21602 WP_003412761.1.21615 WP_003412761.1.21638 WP_003412761.1.21639 WP_003412761.1.21655 WP_003412761.1.21658 WP_003412761.1.2168 WP_003412761.1.2174 WP_003412761.1.21741 WP_003412761.1.21777 WP_003412761.1.21786 WP_003412761.1.21795 WP_003412761.1.218 WP_003412761.1.21826 WP_003412761.1.21829 WP_003412761.1.21840 WP_003412761.1.21843 WP_003412761.1.21872 WP_003412761.1.21873 WP_003412761.1.2188 WP_003412761.1.21882 WP_003412761.1.21906 WP_003412761.1.21912 WP_003412761.1.2194 WP_003412761.1.21941 WP_003412761.1.21956 WP_003412761.1.21958 WP_003412761.1.21960 WP_003412761.1.21971 WP_003412761.1.21973 WP_003412761.1.21983 WP_003412761.1.22003 WP_003412761.1.22013 WP_003412761.1.22025 WP_003412761.1.22036 WP_003412761.1.22075 WP_003412761.1.22092 WP_003412761.1.2212 WP_003412761.1.22127 WP_003412761.1.22140 WP_003412761.1.22233 WP_003412761.1.22255 WP_003412761.1.22277 WP_003412761.1.22305 WP_003412761.1.22348 WP_003412761.1.22356 WP_003412761.1.22366 WP_003412761.1.2238 WP_003412761.1.22380 WP_003412761.1.22437 WP_003412761.1.22438 WP_003412761.1.22445 WP_003412761.1.22490 WP_003412761.1.22511 WP_003412761.1.22524 WP_003412761.1.2253 WP_003412761.1.22585 WP_003412761.1.22589 WP_003412761.1.22606 WP_003412761.1.22608 WP_003412761.1.22609 WP_003412761.1.22618 WP_003412761.1.2262 WP_003412761.1.22624 WP_003412761.1.22629 WP_003412761.1.22647 WP_003412761.1.22664 WP_003412761.1.22665 WP_003412761.1.22670 WP_003412761.1.22674 WP_003412761.1.22680 WP_003412761.1.22725 WP_003412761.1.22728 WP_003412761.1.22733 WP_003412761.1.22737 WP_003412761.1.2275 WP_003412761.1.22754 WP_003412761.1.22797 WP_003412761.1.22800 WP_003412761.1.22804 WP_003412761.1.22829 WP_003412761.1.22840 WP_003412761.1.22844 WP_003412761.1.22963 WP_003412761.1.22970 WP_003412761.1.22996 WP_003412761.1.22997 WP_003412761.1.22999 WP_003412761.1.23015 WP_003412761.1.23032 WP_003412761.1.231 WP_003412761.1.23101 WP_003412761.1.2312 WP_003412761.1.23140 WP_003412761.1.23153 WP_003412761.1.23171 WP_003412761.1.23199 WP_003412761.1.2320 WP_003412761.1.23204 WP_003412761.1.23216 WP_003412761.1.23229 WP_003412761.1.23233 WP_003412761.1.2326 WP_003412761.1.23261 WP_003412761.1.23272 WP_003412761.1.23289 WP_003412761.1.2329 WP_003412761.1.23308 WP_003412761.1.23316 WP_003412761.1.23321 WP_003412761.1.23325 WP_003412761.1.2339 WP_003412761.1.23406 WP_003412761.1.23438 WP_003412761.1.23445 WP_003412761.1.23447 WP_003412761.1.23452 WP_003412761.1.23461 WP_003412761.1.2349 WP_003412761.1.23496 WP_003412761.1.23497 WP_003412761.1.23506 WP_003412761.1.23530 WP_003412761.1.23539 WP_003412761.1.23546 WP_003412761.1.23551 WP_003412761.1.23573 WP_003412761.1.23583 WP_003412761.1.23588 WP_003412761.1.23628 WP_003412761.1.23677 WP_003412761.1.23683 WP_003412761.1.23692 WP_003412761.1.23694 WP_003412761.1.23699 WP_003412761.1.2371 WP_003412761.1.23803 WP_003412761.1.23807 WP_003412761.1.23825 WP_003412761.1.23832 WP_003412761.1.2384 WP_003412761.1.23843 WP_003412761.1.23863 WP_003412761.1.2387 WP_003412761.1.23894 WP_003412761.1.23993 WP_003412761.1.2400 WP_003412761.1.24007 WP_003412761.1.24008 WP_003412761.1.24046 WP_003412761.1.24057 WP_003412761.1.24062 WP_003412761.1.24113 WP_003412761.1.24119 WP_003412761.1.24128 WP_003412761.1.24140 WP_003412761.1.24176 WP_003412761.1.24190 WP_003412761.1.24202 WP_003412761.1.24244 WP_003412761.1.24261 WP_003412761.1.24284 WP_003412761.1.24294 WP_003412761.1.24357 WP_003412761.1.24396 WP_003412761.1.24414 WP_003412761.1.24423 WP_003412761.1.2443 WP_003412761.1.24446 WP_003412761.1.24461 WP_003412761.1.24500 WP_003412761.1.24507 WP_003412761.1.24509 WP_003412761.1.24529 WP_003412761.1.24553 WP_003412761.1.24629 WP_003412761.1.24638 WP_003412761.1.24648 WP_003412761.1.2466 WP_003412761.1.24767 WP_003412761.1.24824 WP_003412761.1.24831 WP_003412761.1.24840 WP_003412761.1.24848 WP_003412761.1.24857 WP_003412761.1.2487 WP_003412761.1.24893 WP_003412761.1.24907 WP_003412761.1.24933 WP_003412761.1.24956 WP_003412761.1.24958 WP_003412761.1.24985 WP_003412761.1.2499 WP_003412761.1.25004 WP_003412761.1.2505 WP_003412761.1.25051 WP_003412761.1.2507 WP_003412761.1.25096 WP_003412761.1.25103 WP_003412761.1.25129 WP_003412761.1.25171 WP_003412761.1.25184 WP_003412761.1.25247 WP_003412761.1.25252 WP_003412761.1.25278 WP_003412761.1.25283 WP_003412761.1.25309 WP_003412761.1.25313 WP_003412761.1.25338 WP_003412761.1.25342 WP_003412761.1.25343 WP_003412761.1.25367 WP_003412761.1.25393 WP_003412761.1.25406 WP_003412761.1.25435 WP_003412761.1.25437 WP_003412761.1.25445 WP_003412761.1.25455 WP_003412761.1.25473 WP_003412761.1.25504 WP_003412761.1.25513 WP_003412761.1.25542 WP_003412761.1.25579 WP_003412761.1.25594 WP_003412761.1.25606 WP_003412761.1.25645 WP_003412761.1.2566 WP_003412761.1.25673 WP_003412761.1.25674 WP_003412761.1.25693 WP_003412761.1.25699 WP_003412761.1.25727 WP_003412761.1.25736 WP_003412761.1.25738 WP_003412761.1.25756 WP_003412761.1.25759 WP_003412761.1.2580 WP_003412761.1.25813 WP_003412761.1.25853 WP_003412761.1.25854 WP_003412761.1.25874 WP_003412761.1.25885 WP_003412761.1.25892 WP_003412761.1.25906 WP_003412761.1.25914 WP_003412761.1.25916 WP_003412761.1.2594 WP_003412761.1.25954 WP_003412761.1.25965 WP_003412761.1.25972 WP_003412761.1.26017 WP_003412761.1.26032 WP_003412761.1.26038 WP_003412761.1.26072 WP_003412761.1.26089 WP_003412761.1.26097 WP_003412761.1.26098 WP_003412761.1.26108 WP_003412761.1.26109 WP_003412761.1.26118 WP_003412761.1.26126 WP_003412761.1.2614 WP_003412761.1.26168 WP_003412761.1.26182 WP_003412761.1.26190 WP_003412761.1.2620 WP_003412761.1.26234 WP_003412761.1.26243 WP_003412761.1.26265 WP_003412761.1.26267 WP_003412761.1.26292 WP_003412761.1.26310 WP_003412761.1.26328 WP_003412761.1.26349 WP_003412761.1.26366 WP_003412761.1.26374 WP_003412761.1.26407 WP_003412761.1.26412 WP_003412761.1.26454 WP_003412761.1.26464 WP_003412761.1.2653 WP_003412761.1.26560 WP_003412761.1.26571 WP_003412761.1.2659 WP_003412761.1.26597 WP_003412761.1.26603 WP_003412761.1.26629 WP_003412761.1.26651 WP_003412761.1.26702 WP_003412761.1.26707 WP_003412761.1.26710 WP_003412761.1.26737 WP_003412761.1.26738 WP_003412761.1.26745 WP_003412761.1.26756 WP_003412761.1.2676 WP_003412761.1.2677 WP_003412761.1.26779 WP_003412761.1.26780 WP_003412761.1.26854 WP_003412761.1.26868 WP_003412761.1.26876 WP_003412761.1.26888 WP_003412761.1.26914 WP_003412761.1.26945 WP_003412761.1.26959 WP_003412761.1.26969 WP_003412761.1.26984 WP_003412761.1.26992 WP_003412761.1.27004 WP_003412761.1.27017 WP_003412761.1.27045 WP_003412761.1.27074 WP_003412761.1.27075 WP_003412761.1.27128 WP_003412761.1.27130 WP_003412761.1.27139 WP_003412761.1.27152 WP_003412761.1.27162 WP_003412761.1.27164 WP_003412761.1.27193 WP_003412761.1.27235 WP_003412761.1.27254 WP_003412761.1.27278 WP_003412761.1.27343 WP_003412761.1.27352 WP_003412761.1.27369 WP_003412761.1.27391 WP_003412761.1.27398 WP_003412761.1.27402 WP_003412761.1.27410 WP_003412761.1.27411 WP_003412761.1.27449 WP_003412761.1.27460 WP_003412761.1.27463 WP_003412761.1.2749 WP_003412761.1.27492 WP_003412761.1.27528 WP_003412761.1.27541 WP_003412761.1.27576 WP_003412761.1.27582 WP_003412761.1.27596 WP_003412761.1.27607 WP_003412761.1.2766 WP_003412761.1.277 WP_003412761.1.27724 WP_003412761.1.27730 WP_003412761.1.27736 WP_003412761.1.27743 WP_003412761.1.27750 WP_003412761.1.27771 WP_003412761.1.27779 WP_003412761.1.27795 WP_003412761.1.27803 WP_003412761.1.27819 WP_003412761.1.27835 WP_003412761.1.27915 WP_003412761.1.27935 WP_003412761.1.27962 WP_003412761.1.28053 WP_003412761.1.28092 WP_003412761.1.28106 WP_003412761.1.28131 WP_003412761.1.28142 WP_003412761.1.28159 WP_003412761.1.2816 WP_003412761.1.28161 WP_003412761.1.28192 WP_003412761.1.28202 WP_003412761.1.28241 WP_003412761.1.28242 WP_003412761.1.28251 WP_003412761.1.28255 WP_003412761.1.28269 WP_003412761.1.28276 WP_003412761.1.28293 WP_003412761.1.28331 WP_003412761.1.28367 WP_003412761.1.28378 WP_003412761.1.28391 WP_003412761.1.2842 WP_003412761.1.2847 WP_003412761.1.28471 WP_003412761.1.28473 WP_003412761.1.28493 WP_003412761.1.28497 WP_003412761.1.28530 WP_003412761.1.28545 WP_003412761.1.28561 WP_003412761.1.28567 WP_003412761.1.28585 WP_003412761.1.286 WP_003412761.1.28610 WP_003412761.1.28617 WP_003412761.1.28634 WP_003412761.1.28642 WP_003412761.1.28671 WP_003412761.1.28682 WP_003412761.1.28698 WP_003412761.1.28739 WP_003412761.1.28758 WP_003412761.1.28781 WP_003412761.1.28787 WP_003412761.1.28827 WP_003412761.1.28839 WP_003412761.1.28847 WP_003412761.1.28850 WP_003412761.1.28851 WP_003412761.1.28865 WP_003412761.1.28897 WP_003412761.1.28914 WP_003412761.1.28935 WP_003412761.1.28936 WP_003412761.1.28939 WP_003412761.1.28943 WP_003412761.1.28952 WP_003412761.1.28975 WP_003412761.1.2899 WP_003412761.1.28993 WP_003412761.1.29000 WP_003412761.1.2901 WP_003412761.1.29028 WP_003412761.1.29033 WP_003412761.1.29058 WP_003412761.1.29078 WP_003412761.1.29102 WP_003412761.1.29115 WP_003412761.1.2916 WP_003412761.1.29217 WP_003412761.1.29223 WP_003412761.1.29234 WP_003412761.1.29264 WP_003412761.1.29275 WP_003412761.1.29306 WP_003412761.1.29339 WP_003412761.1.29348 WP_003412761.1.29364 WP_003412761.1.29367 WP_003412761.1.2938 WP_003412761.1.29399 WP_003412761.1.29426 WP_003412761.1.2944 WP_003412761.1.29449 WP_003412761.1.29450 WP_003412761.1.29452 WP_003412761.1.2949 WP_003412761.1.29510 WP_003412761.1.29515 WP_003412761.1.29525 WP_003412761.1.2953 WP_003412761.1.29559 WP_003412761.1.29587 WP_003412761.1.2959 WP_003412761.1.29592 WP_003412761.1.29599 WP_003412761.1.29611 WP_003412761.1.29632 WP_003412761.1.29649 WP_003412761.1.2965 WP_003412761.1.29659 WP_003412761.1.2969 WP_003412761.1.29696 WP_003412761.1.29698 WP_003412761.1.29718 WP_003412761.1.29742 WP_003412761.1.29745 WP_003412761.1.29747 WP_003412761.1.29769 WP_003412761.1.29825 WP_003412761.1.29830 WP_003412761.1.29847 WP_003412761.1.29861 WP_003412761.1.29869 WP_003412761.1.29883 WP_003412761.1.29890 WP_003412761.1.299 WP_003412761.1.29931 WP_003412761.1.29960 WP_003412761.1.30014 WP_003412761.1.3004 WP_003412761.1.30040 WP_003412761.1.30074 WP_003412761.1.30097 WP_003412761.1.30101 WP_003412761.1.30106 WP_003412761.1.30114 WP_003412761.1.30126 WP_003412761.1.30131 WP_003412761.1.30138 WP_003412761.1.30139 WP_003412761.1.30145 WP_003412761.1.30211 WP_003412761.1.30224 WP_003412761.1.30235 WP_003412761.1.30237 WP_003412761.1.3027 WP_003412761.1.30279 WP_003412761.1.30282 WP_003412761.1.30283 WP_003412761.1.30288 WP_003412761.1.30291 WP_003412761.1.30363 WP_003412761.1.30374 WP_003412761.1.30404 WP_003412761.1.30433 WP_003412761.1.30438 WP_003412761.1.30462 WP_003412761.1.30464 WP_003412761.1.30468 WP_003412761.1.30500 WP_003412761.1.3057 WP_003412761.1.30574 WP_003412761.1.30628 WP_003412761.1.30641 WP_003412761.1.30642 WP_003412761.1.30661 WP_003412761.1.30669 WP_003412761.1.30683 WP_003412761.1.30699 WP_003412761.1.30709 WP_003412761.1.30713 WP_003412761.1.30716 WP_003412761.1.30719 WP_003412761.1.30730 WP_003412761.1.30732 WP_003412761.1.30736 WP_003412761.1.30745 WP_003412761.1.30760 WP_003412761.1.30791 WP_003412761.1.308 WP_003412761.1.30807 WP_003412761.1.30818 WP_003412761.1.30824 WP_003412761.1.30848 WP_003412761.1.30877 WP_003412761.1.30888 WP_003412761.1.30901 WP_003412761.1.30903 WP_003412761.1.30912 WP_003412761.1.30913 WP_003412761.1.30914 WP_003412761.1.30919 WP_003412761.1.30977 WP_003412761.1.3100 WP_003412761.1.31002 WP_003412761.1.3101 WP_003412761.1.31034 WP_003412761.1.31047 WP_003412761.1.31070 WP_003412761.1.31074 WP_003412761.1.31102 WP_003412761.1.31127 WP_003412761.1.31184 WP_003412761.1.31199 WP_003412761.1.31226 WP_003412761.1.31230 WP_003412761.1.31233 WP_003412761.1.31263 WP_003412761.1.31264 WP_003412761.1.31270 WP_003412761.1.31287 WP_003412761.1.31290 WP_003412761.1.31304 WP_003412761.1.31346 WP_003412761.1.31348 WP_003412761.1.31354 WP_003412761.1.31390 WP_003412761.1.31414 WP_003412761.1.31417 WP_003412761.1.31428 WP_003412761.1.3143 WP_003412761.1.31458 WP_003412761.1.31483 WP_003412761.1.3149 WP_003412761.1.31498 WP_003412761.1.31507 WP_003412761.1.31537 WP_003412761.1.31548 WP_003412761.1.31569 WP_003412761.1.31573 WP_003412761.1.316 WP_003412761.1.31629 WP_003412761.1.31666 WP_003412761.1.31693 WP_003412761.1.31703 WP_003412761.1.31744 WP_003412761.1.31745 WP_003412761.1.31770 WP_003412761.1.31776 WP_003412761.1.31783 WP_003412761.1.318 WP_003412761.1.3184 WP_003412761.1.31880 WP_003412761.1.31911 WP_003412761.1.31930 WP_003412761.1.31932 WP_003412761.1.31955 WP_003412761.1.31985 WP_003412761.1.31991 WP_003412761.1.31995 WP_003412761.1.32004 WP_003412761.1.32039 WP_003412761.1.3204 WP_003412761.1.32045 WP_003412761.1.32071 WP_003412761.1.32098 WP_003412761.1.32132 WP_003412761.1.32157 WP_003412761.1.32164 WP_003412761.1.32179 WP_003412761.1.32198 WP_003412761.1.32297 WP_003412761.1.32317 WP_003412761.1.32383 WP_003412761.1.32400 WP_003412761.1.32403 WP_003412761.1.32416 WP_003412761.1.32421 WP_003412761.1.32433 WP_003412761.1.32461 WP_003412761.1.32482 WP_003412761.1.32503 WP_003412761.1.32556 WP_003412761.1.32562 WP_003412761.1.32569 WP_003412761.1.32592 WP_003412761.1.32620 WP_003412761.1.32647 WP_003412761.1.32653 WP_003412761.1.32654 WP_003412761.1.3268 WP_003412761.1.32695 WP_003412761.1.32706 WP_003412761.1.32716 WP_003412761.1.32738 WP_003412761.1.32752 WP_003412761.1.32780 WP_003412761.1.32781 WP_003412761.1.32793 WP_003412761.1.32799 WP_003412761.1.32822 WP_003412761.1.32833 WP_003412761.1.32862 WP_003412761.1.32880 WP_003412761.1.32897 WP_003412761.1.32935 WP_003412761.1.32974 WP_003412761.1.33007 WP_003412761.1.3302 WP_003412761.1.33028 WP_003412761.1.33035 WP_003412761.1.33044 WP_003412761.1.33054 WP_003412761.1.33082 WP_003412761.1.33141 WP_003412761.1.33148 WP_003412761.1.33155 WP_003412761.1.33168 WP_003412761.1.3321 WP_003412761.1.33215 WP_003412761.1.3325 WP_003412761.1.3327 WP_003412761.1.33278 WP_003412761.1.33288 WP_003412761.1.33305 WP_003412761.1.3331 WP_003412761.1.33319 WP_003412761.1.3333 WP_003412761.1.33393 WP_003412761.1.33403 WP_003412761.1.33452 WP_003412761.1.33467 WP_003412761.1.33477 WP_003412761.1.3349 WP_003412761.1.33519 WP_003412761.1.33542 WP_003412761.1.33601 WP_003412761.1.33602 WP_003412761.1.33633 WP_003412761.1.33646 WP_003412761.1.33673 WP_003412761.1.3369 WP_003412761.1.33705 WP_003412761.1.33762 WP_003412761.1.33783 WP_003412761.1.33789 WP_003412761.1.3383 WP_003412761.1.33832 WP_003412761.1.33839 WP_003412761.1.33848 WP_003412761.1.3387 WP_003412761.1.33886 WP_003412761.1.33895 WP_003412761.1.33906 WP_003412761.1.33912 WP_003412761.1.33954 WP_003412761.1.3399 WP_003412761.1.34042 WP_003412761.1.3405 WP_003412761.1.34055 WP_003412761.1.34056 WP_003412761.1.34065 WP_003412761.1.3408 WP_003412761.1.34090 WP_003412761.1.34109 WP_003412761.1.34111 WP_003412761.1.34131 WP_003412761.1.34152 WP_003412761.1.34153 WP_003412761.1.34163 WP_003412761.1.34181 WP_003412761.1.34197 WP_003412761.1.34198 WP_003412761.1.34215 WP_003412761.1.34219 WP_003412761.1.34255 WP_003412761.1.34260 WP_003412761.1.34275 WP_003412761.1.343 WP_003412761.1.34347 WP_003412761.1.34358 WP_003412761.1.34392 WP_003412761.1.344 WP_003412761.1.34428 WP_003412761.1.3443 WP_003412761.1.34435 WP_003412761.1.34446 WP_003412761.1.34499 WP_003412761.1.34505 WP_003412761.1.34516 WP_003412761.1.34529 WP_003412761.1.34551 WP_003412761.1.34563 WP_003412761.1.34576 WP_003412761.1.34581 WP_003412761.1.34588 WP_003412761.1.34596 WP_003412761.1.34599 WP_003412761.1.34639 WP_003412761.1.34673 WP_003412761.1.34724 WP_003412761.1.34740 WP_003412761.1.34755 WP_003412761.1.34777 WP_003412761.1.34783 WP_003412761.1.34841 WP_003412761.1.34908 WP_003412761.1.34919 WP_003412761.1.3492 WP_003412761.1.34933 WP_003412761.1.34945 WP_003412761.1.34946 WP_003412761.1.34954 WP_003412761.1.34960 WP_003412761.1.34961 WP_003412761.1.34963 WP_003412761.1.34965 WP_003412761.1.34968 WP_003412761.1.35023 WP_003412761.1.35069 WP_003412761.1.35072 WP_003412761.1.35078 WP_003412761.1.35100 WP_003412761.1.35146 WP_003412761.1.35156 WP_003412761.1.35160 WP_003412761.1.35162 WP_003412761.1.35176 WP_003412761.1.3520 WP_003412761.1.35221 WP_003412761.1.35246 WP_003412761.1.35278 WP_003412761.1.35301 WP_003412761.1.35311 WP_003412761.1.35312 WP_003412761.1.35317 WP_003412761.1.35319 WP_003412761.1.35347 WP_003412761.1.35363 WP_003412761.1.35382 WP_003412761.1.35385 WP_003412761.1.35396 WP_003412761.1.35397 WP_003412761.1.35426 WP_003412761.1.35439 WP_003412761.1.35455 WP_003412761.1.3548 WP_003412761.1.35484 WP_003412761.1.35492 WP_003412761.1.3553 WP_003412761.1.35553 WP_003412761.1.35555 WP_003412761.1.35561 WP_003412761.1.35602 WP_003412761.1.35610 WP_003412761.1.35635 WP_003412761.1.35657 WP_003412761.1.35680 WP_003412761.1.35687 WP_003412761.1.35689 WP_003412761.1.35707 WP_003412761.1.35732 WP_003412761.1.35754 WP_003412761.1.35767 WP_003412761.1.35770 WP_003412761.1.35771 WP_003412761.1.35780 WP_003412761.1.35805 WP_003412761.1.35811 WP_003412761.1.35821 WP_003412761.1.3584 WP_003412761.1.35848 WP_003412761.1.35864 WP_003412761.1.35874 WP_003412761.1.35876 WP_003412761.1.35897 WP_003412761.1.35899 WP_003412761.1.35923 WP_003412761.1.3593 WP_003412761.1.35954 WP_003412761.1.36005 WP_003412761.1.36014 WP_003412761.1.36023 WP_003412761.1.36051 WP_003412761.1.36053 WP_003412761.1.36075 WP_003412761.1.36089 WP_003412761.1.36097 WP_003412761.1.36098 WP_003412761.1.36116 WP_003412761.1.36145 WP_003412761.1.36156 WP_003412761.1.36205 WP_003412761.1.36228 WP_003412761.1.36246 WP_003412761.1.36252 WP_003412761.1.36260 WP_003412761.1.36270 WP_003412761.1.36271 WP_003412761.1.36303 WP_003412761.1.36309 WP_003412761.1.36315 WP_003412761.1.36319 WP_003412761.1.36321 WP_003412761.1.36326 WP_003412761.1.3634 WP_003412761.1.36356 WP_003412761.1.36357 WP_003412761.1.3636 WP_003412761.1.36385 WP_003412761.1.36399 WP_003412761.1.36436 WP_003412761.1.36465 WP_003412761.1.36469 WP_003412761.1.36473 WP_003412761.1.36485 WP_003412761.1.36508 WP_003412761.1.36540 WP_003412761.1.36561 WP_003412761.1.36571 WP_003412761.1.36573 WP_003412761.1.36578 WP_003412761.1.36585 WP_003412761.1.36597 WP_003412761.1.36614 WP_003412761.1.36657 WP_003412761.1.36674 WP_003412761.1.36720 WP_003412761.1.36727 WP_003412761.1.36733 WP_003412761.1.36785 WP_003412761.1.36810 WP_003412761.1.36844 WP_003412761.1.36851 WP_003412761.1.36862 WP_003412761.1.36893 WP_003412761.1.36901 WP_003412761.1.36921 WP_003412761.1.36935 WP_003412761.1.36941 WP_003412761.1.3695 WP_003412761.1.36951 WP_003412761.1.36968 WP_003412761.1.3700 WP_003412761.1.37004 WP_003412761.1.37012 WP_003412761.1.37071 WP_003412761.1.37088 WP_003412761.1.37131 WP_003412761.1.37157 WP_003412761.1.37175 WP_003412761.1.37188 WP_003412761.1.37213 WP_003412761.1.37229 WP_003412761.1.3724 WP_003412761.1.37277 WP_003412761.1.37305 WP_003412761.1.37330 WP_003412761.1.37389 WP_003412761.1.37400 WP_003412761.1.37440 WP_003412761.1.37459 WP_003412761.1.37468 WP_003412761.1.37475 WP_003412761.1.37484 WP_003412761.1.37601 WP_003412761.1.37612 WP_003412761.1.37632 WP_003412761.1.37643 WP_003412761.1.37655 WP_003412761.1.37660 WP_003412761.1.37674 WP_003412761.1.37700 WP_003412761.1.37701 WP_003412761.1.37709 WP_003412761.1.37711 WP_003412761.1.37721 WP_003412761.1.37722 WP_003412761.1.37747 WP_003412761.1.37765 WP_003412761.1.37772 WP_003412761.1.37804 WP_003412761.1.37809 WP_003412761.1.37859 WP_003412761.1.37877 WP_003412761.1.37912 WP_003412761.1.37913 WP_003412761.1.37943 WP_003412761.1.37950 WP_003412761.1.37973 WP_003412761.1.37975 WP_003412761.1.37983 WP_003412761.1.38 WP_003412761.1.38002 WP_003412761.1.3802 WP_003412761.1.38039 WP_003412761.1.38040 WP_003412761.1.38067 WP_003412761.1.38068 WP_003412761.1.38135 WP_003412761.1.38138 WP_003412761.1.38144 WP_003412761.1.38158 WP_003412761.1.38159 WP_003412761.1.38210 WP_003412761.1.38233 WP_003412761.1.38240 WP_003412761.1.38299 WP_003412761.1.38332 WP_003412761.1.38347 WP_003412761.1.38354 WP_003412761.1.38380 WP_003412761.1.38384 WP_003412761.1.38389 WP_003412761.1.38398 WP_003412761.1.38402 WP_003412761.1.38418 WP_003412761.1.38421 WP_003412761.1.38466 WP_003412761.1.38477 WP_003412761.1.38483 WP_003412761.1.3849 WP_003412761.1.385 WP_003412761.1.38530 WP_003412761.1.38535 WP_003412761.1.38539 WP_003412761.1.38594 WP_003412761.1.38601 WP_003412761.1.38611 WP_003412761.1.38638 WP_003412761.1.38639 WP_003412761.1.38646 WP_003412761.1.38648 WP_003412761.1.38654 WP_003412761.1.38659 WP_003412761.1.38660 WP_003412761.1.38666 WP_003412761.1.38671 WP_003412761.1.38672 WP_003412761.1.38677 WP_003412761.1.38750 WP_003412761.1.38772 WP_003412761.1.38812 WP_003412761.1.38821 WP_003412761.1.38844 WP_003412761.1.38863 WP_003412761.1.38865 WP_003412761.1.38873 WP_003412761.1.3889 WP_003412761.1.38894 WP_003412761.1.38909 WP_003412761.1.38939 WP_003412761.1.38974 WP_003412761.1.38991 WP_003412761.1.39025 WP_003412761.1.39070 WP_003412761.1.39072 WP_003412761.1.39095 WP_003412761.1.39106 WP_003412761.1.39165 WP_003412761.1.39174 WP_003412761.1.39176 WP_003412761.1.39178 WP_003412761.1.39190 WP_003412761.1.39201 WP_003412761.1.39207 WP_003412761.1.39211 WP_003412761.1.39236 WP_003412761.1.39239 WP_003412761.1.39252 WP_003412761.1.39288 WP_003412761.1.39295 WP_003412761.1.39306 WP_003412761.1.39359 WP_003412761.1.39364 WP_003412761.1.39400 WP_003412761.1.39447 WP_003412761.1.3945 WP_003412761.1.39450 WP_003412761.1.39455 WP_003412761.1.3949 WP_003412761.1.39521 WP_003412761.1.39560 WP_003412761.1.39592 WP_003412761.1.396 WP_003412761.1.3960 WP_003412761.1.39616 WP_003412761.1.39654 WP_003412761.1.39657 WP_003412761.1.39661 WP_003412761.1.39674 WP_003412761.1.39678 WP_003412761.1.3968 WP_003412761.1.39694 WP_003412761.1.3971 WP_003412761.1.39718 WP_003412761.1.39728 WP_003412761.1.39748 WP_003412761.1.39751 WP_003412761.1.39759 WP_003412761.1.39801 WP_003412761.1.39804 WP_003412761.1.39848 WP_003412761.1.39877 WP_003412761.1.39925 WP_003412761.1.3994 WP_003412761.1.39959 WP_003412761.1.3996 WP_003412761.1.39960 WP_003412761.1.3997 WP_003412761.1.39980 WP_003412761.1.40000 WP_003412761.1.40028 WP_003412761.1.40029 WP_003412761.1.4003 WP_003412761.1.40094 WP_003412761.1.40096 WP_003412761.1.40150 WP_003412761.1.40156 WP_003412761.1.40174 WP_003412761.1.40186 WP_003412761.1.40276 WP_003412761.1.40277 WP_003412761.1.40323 WP_003412761.1.40336 WP_003412761.1.40353 WP_003412761.1.4036 WP_003412761.1.40402 WP_003412761.1.40413 WP_003412761.1.40440 WP_003412761.1.40446 WP_003412761.1.40451 WP_003412761.1.40523 WP_003412761.1.40543 WP_003412761.1.40641 WP_003412761.1.40646 WP_003412761.1.40651 WP_003412761.1.40653 WP_003412761.1.4067 WP_003412761.1.40705 WP_003412761.1.40723 WP_003412761.1.40731 WP_003412761.1.40735 WP_003412761.1.40795 WP_003412761.1.40799 WP_003412761.1.40852 WP_003412761.1.40876 WP_003412761.1.40881 WP_003412761.1.40922 WP_003412761.1.40948 WP_003412761.1.4095 WP_003412761.1.40956 WP_003412761.1.40957 WP_003412761.1.4097 WP_003412761.1.410 WP_003412761.1.41000 WP_003412761.1.41055 WP_003412761.1.41108 WP_003412761.1.41123 WP_003412761.1.41177 WP_003412761.1.41202 WP_003412761.1.41219 WP_003412761.1.41231 WP_003412761.1.41249 WP_003412761.1.4127 WP_003412761.1.41296 WP_003412761.1.41355 WP_003412761.1.41376 WP_003412761.1.41430 WP_003412761.1.41447 WP_003412761.1.41469 WP_003412761.1.41504 WP_003412761.1.41553 WP_003412761.1.41564 WP_003412761.1.41583 WP_003412761.1.41616 WP_003412761.1.41632 WP_003412761.1.41635 WP_003412761.1.41636 WP_003412761.1.41648 WP_003412761.1.41660 WP_003412761.1.41685 WP_003412761.1.41695 WP_003412761.1.41704 WP_003412761.1.4171 WP_003412761.1.41719 WP_003412761.1.41733 WP_003412761.1.41744 WP_003412761.1.41774 WP_003412761.1.41791 WP_003412761.1.41803 WP_003412761.1.41820 WP_003412761.1.41828 WP_003412761.1.41829 WP_003412761.1.41860 WP_003412761.1.41912 WP_003412761.1.41921 WP_003412761.1.41933 WP_003412761.1.41944 WP_003412761.1.42043 WP_003412761.1.42075 WP_003412761.1.42078 WP_003412761.1.42094 WP_003412761.1.42112 WP_003412761.1.4212 WP_003412761.1.42122 WP_003412761.1.42134 WP_003412761.1.42183 WP_003412761.1.42188 WP_003412761.1.42201 WP_003412761.1.42202 WP_003412761.1.42208 WP_003412761.1.42247 WP_003412761.1.42255 WP_003412761.1.42273 WP_003412761.1.42278 WP_003412761.1.42304 WP_003412761.1.42309 WP_003412761.1.42370 WP_003412761.1.42385 WP_003412761.1.42400 WP_003412761.1.42409 WP_003412761.1.42414 WP_003412761.1.42417 WP_003412761.1.42430 WP_003412761.1.42461 WP_003412761.1.42465 WP_003412761.1.42467 WP_003412761.1.42473 WP_003412761.1.42474 WP_003412761.1.4248 WP_003412761.1.42494 WP_003412761.1.42519 WP_003412761.1.42524 WP_003412761.1.42534 WP_003412761.1.4255 WP_003412761.1.42562 WP_003412761.1.42568 WP_003412761.1.42570 WP_003412761.1.42618 WP_003412761.1.42660 WP_003412761.1.42695 WP_003412761.1.42704 WP_003412761.1.42705 WP_003412761.1.42722 WP_003412761.1.42777 WP_003412761.1.42782 WP_003412761.1.42835 WP_003412761.1.42839 WP_003412761.1.42842 WP_003412761.1.42905 WP_003412761.1.42916 WP_003412761.1.42930 WP_003412761.1.42971 WP_003412761.1.43005 WP_003412761.1.43009 WP_003412761.1.43053 WP_003412761.1.43087 WP_003412761.1.43098 WP_003412761.1.43208 WP_003412761.1.43236 WP_003412761.1.43246 WP_003412761.1.43255 WP_003412761.1.43266 WP_003412761.1.43269 WP_003412761.1.43273 WP_003412761.1.43296 WP_003412761.1.43306 WP_003412761.1.4335 WP_003412761.1.43368 WP_003412761.1.43395 WP_003412761.1.43475 WP_003412761.1.43478 WP_003412761.1.43484 WP_003412761.1.43557 WP_003412761.1.43578 WP_003412761.1.43588 WP_003412761.1.43643 WP_003412761.1.43664 WP_003412761.1.43684 WP_003412761.1.43686 WP_003412761.1.43706 WP_003412761.1.43716 WP_003412761.1.4377 WP_003412761.1.43781 WP_003412761.1.43794 WP_003412761.1.43815 WP_003412761.1.43846 WP_003412761.1.43861 WP_003412761.1.43863 WP_003412761.1.43866 WP_003412761.1.43872 WP_003412761.1.43885 WP_003412761.1.43897 WP_003412761.1.4390 WP_003412761.1.43902 WP_003412761.1.43921 WP_003412761.1.43936 WP_003412761.1.43937 WP_003412761.1.43960 WP_003412761.1.43965 WP_003412761.1.4399 WP_003412761.1.43993 WP_003412761.1.43996 WP_003412761.1.44 WP_003412761.1.44001 WP_003412761.1.44008 WP_003412761.1.44016 WP_003412761.1.44033 WP_003412761.1.44037 WP_003412761.1.44041 WP_003412761.1.44070 WP_003412761.1.44071 WP_003412761.1.44076 WP_003412761.1.44104 WP_003412761.1.44111 WP_003412761.1.44124 WP_003412761.1.44169 WP_003412761.1.44219 WP_003412761.1.44237 WP_003412761.1.44277 WP_003412761.1.44279 WP_003412761.1.44336 WP_003412761.1.44355 WP_003412761.1.44358 WP_003412761.1.4438 WP_003412761.1.44390 WP_003412761.1.44392 WP_003412761.1.4441 WP_003412761.1.44415 WP_003412761.1.44464 WP_003412761.1.44466 WP_003412761.1.44489 WP_003412761.1.44492 WP_003412761.1.44494 WP_003412761.1.44500 WP_003412761.1.44519 WP_003412761.1.44526 WP_003412761.1.44532 WP_003412761.1.44534 WP_003412761.1.44562 WP_003412761.1.44589 WP_003412761.1.44600 WP_003412761.1.44602 WP_003412761.1.44615 WP_003412761.1.4464 WP_003412761.1.44651 WP_003412761.1.44659 WP_003412761.1.44665 WP_003412761.1.44694 WP_003412761.1.44700 WP_003412761.1.44713 WP_003412761.1.44735 WP_003412761.1.44740 WP_003412761.1.44757 WP_003412761.1.4476 WP_003412761.1.44761 WP_003412761.1.44767 WP_003412761.1.44776 WP_003412761.1.44779 WP_003412761.1.44786 WP_003412761.1.44808 WP_003412761.1.44864 WP_003412761.1.44901 WP_003412761.1.44908 WP_003412761.1.44913 WP_003412761.1.4492 WP_003412761.1.44939 WP_003412761.1.44979 WP_003412761.1.44981 WP_003412761.1.45002 WP_003412761.1.45011 WP_003412761.1.4504 WP_003412761.1.45062 WP_003412761.1.45066 WP_003412761.1.45081 WP_003412761.1.45113 WP_003412761.1.45129 WP_003412761.1.45135 WP_003412761.1.45147 WP_003412761.1.45168 WP_003412761.1.4517 WP_003412761.1.45181 WP_003412761.1.45185 WP_003412761.1.45192 WP_003412761.1.45200 WP_003412761.1.45205 WP_003412761.1.45211 WP_003412761.1.45249 WP_003412761.1.4526 WP_003412761.1.45286 WP_003412761.1.45326 WP_003412761.1.45347 WP_003412761.1.45374 WP_003412761.1.45390 WP_003412761.1.454 WP_003412761.1.45407 WP_003412761.1.45451 WP_003412761.1.45453 WP_003412761.1.45460 WP_003412761.1.45463 WP_003412761.1.45470 WP_003412761.1.45474 WP_003412761.1.45491 WP_003412761.1.45510 WP_003412761.1.45563 WP_003412761.1.45590 WP_003412761.1.45619 WP_003412761.1.45626 WP_003412761.1.45631 WP_003412761.1.45697 WP_003412761.1.4571 WP_003412761.1.45731 WP_003412761.1.45743 WP_003412761.1.45765 WP_003412761.1.45776 WP_003412761.1.45783 WP_003412761.1.45805 WP_003412761.1.45815 WP_003412761.1.45849 WP_003412761.1.45867 WP_003412761.1.45884 WP_003412761.1.4590 WP_003412761.1.45923 WP_003412761.1.45926 WP_003412761.1.45963 WP_003412761.1.45989 WP_003412761.1.45992 WP_003412761.1.46025 WP_003412761.1.46083 WP_003412761.1.46090 WP_003412761.1.46092 WP_003412761.1.46100 WP_003412761.1.46101 WP_003412761.1.46103 WP_003412761.1.46107 WP_003412761.1.46127 WP_003412761.1.46128 WP_003412761.1.46129 WP_003412761.1.46141 WP_003412761.1.46150 WP_003412761.1.46201 WP_003412761.1.46226 WP_003412761.1.4624 WP_003412761.1.46253 WP_003412761.1.46268 WP_003412761.1.46285 WP_003412761.1.46300 WP_003412761.1.46313 WP_003412761.1.46336 WP_003412761.1.46365 WP_003412761.1.46370 WP_003412761.1.46381 WP_003412761.1.46402 WP_003412761.1.46411 WP_003412761.1.4644 WP_003412761.1.46442 WP_003412761.1.46453 WP_003412761.1.46463 WP_003412761.1.46478 WP_003412761.1.46492 WP_003412761.1.46521 WP_003412761.1.4653 WP_003412761.1.46532 WP_003412761.1.46539 WP_003412761.1.46568 WP_003412761.1.46585 WP_003412761.1.46609 WP_003412761.1.46613 WP_003412761.1.46625 WP_003412761.1.46642 WP_003412761.1.46647 WP_003412761.1.46674 WP_003412761.1.46724 WP_003412761.1.46758 WP_003412761.1.46773 WP_003412761.1.46777 WP_003412761.1.46786 WP_003412761.1.46792 WP_003412761.1.46847 WP_003412761.1.46851 WP_003412761.1.4687 WP_003412761.1.46897 WP_003412761.1.46936 WP_003412761.1.46980 WP_003412761.1.47011 WP_003412761.1.47012 WP_003412761.1.47066 WP_003412761.1.47077 WP_003412761.1.47083 WP_003412761.1.47106 WP_003412761.1.47142 WP_003412761.1.47147 WP_003412761.1.47166 WP_003412761.1.47178 WP_003412761.1.47179 WP_003412761.1.47194 WP_003412761.1.47207 WP_003412761.1.47210 WP_003412761.1.47261 WP_003412761.1.47262 WP_003412761.1.47402 WP_003412761.1.47423 WP_003412761.1.47467 WP_003412761.1.47502 WP_003412761.1.4751 WP_003412761.1.47511 WP_003412761.1.47537 WP_003412761.1.47540 WP_003412761.1.47568 WP_003412761.1.47572 WP_003412761.1.47588 WP_003412761.1.47636 WP_003412761.1.4764 WP_003412761.1.47653 WP_003412761.1.47679 WP_003412761.1.47681 WP_003412761.1.47690 WP_003412761.1.4771 WP_003412761.1.47717 WP_003412761.1.47743 WP_003412761.1.47754 WP_003412761.1.47773 WP_003412761.1.47776 WP_003412761.1.47780 WP_003412761.1.47805 WP_003412761.1.47832 WP_003412761.1.47847 WP_003412761.1.47858 WP_003412761.1.47861 WP_003412761.1.47868 WP_003412761.1.47893 WP_003412761.1.47899 WP_003412761.1.479 WP_003412761.1.47912 WP_003412761.1.47913 WP_003412761.1.47926 WP_003412761.1.4794 WP_003412761.1.47943 WP_003412761.1.47944 WP_003412761.1.47974 WP_003412761.1.47993 WP_003412761.1.48004 WP_003412761.1.48039 WP_003412761.1.48050 WP_003412761.1.48084 WP_003412761.1.48097 WP_003412761.1.48101 WP_003412761.1.48109 WP_003412761.1.4813 WP_003412761.1.48130 WP_003412761.1.48135 WP_003412761.1.48143 WP_003412761.1.48152 WP_003412761.1.48155 WP_003412761.1.48170 WP_003412761.1.48173 WP_003412761.1.48177 WP_003412761.1.48185 WP_003412761.1.48219 WP_003412761.1.4823 WP_003412761.1.48240 WP_003412761.1.48256 WP_003412761.1.48264 WP_003412761.1.48287 WP_003412761.1.48330 WP_003412761.1.48333 WP_003412761.1.48348 WP_003412761.1.48372 WP_003412761.1.48383 WP_003412761.1.48388 WP_003412761.1.48419 WP_003412761.1.48423 WP_003412761.1.48443 WP_003412761.1.48450 WP_003412761.1.48462 WP_003412761.1.48543 WP_003412761.1.48605 WP_003412761.1.48618 WP_003412761.1.4863 WP_003412761.1.48648 WP_003412761.1.48658 WP_003412761.1.48666 WP_003412761.1.48687 WP_003412761.1.48779 WP_003412761.1.4878 WP_003412761.1.48798 WP_003412761.1.48802 WP_003412761.1.48826 WP_003412761.1.48831 WP_003412761.1.48843 WP_003412761.1.48857 WP_003412761.1.4890 WP_003412761.1.48946 WP_003412761.1.48979 WP_003412761.1.49017 WP_003412761.1.49048 WP_003412761.1.49059 WP_003412761.1.4906 WP_003412761.1.4907 WP_003412761.1.49103 WP_003412761.1.49110 WP_003412761.1.49111 WP_003412761.1.49112 WP_003412761.1.4919 WP_003412761.1.49251 WP_003412761.1.49254 WP_003412761.1.49263 WP_003412761.1.49291 WP_003412761.1.49296 WP_003412761.1.49335 WP_003412761.1.49337 WP_003412761.1.49419 WP_003412761.1.49426 WP_003412761.1.49437 WP_003412761.1.49439 WP_003412761.1.49474 WP_003412761.1.49506 WP_003412761.1.49516 WP_003412761.1.49523 WP_003412761.1.49526 WP_003412761.1.49532 WP_003412761.1.49588 WP_003412761.1.4959 WP_003412761.1.49678 WP_003412761.1.49687 WP_003412761.1.49699 WP_003412761.1.49709 WP_003412761.1.4971 WP_003412761.1.4972 WP_003412761.1.49736 WP_003412761.1.49746 WP_003412761.1.49764 WP_003412761.1.49773 WP_003412761.1.49796 WP_003412761.1.49814 WP_003412761.1.49815 WP_003412761.1.49816 WP_003412761.1.49839 WP_003412761.1.49857 WP_003412761.1.49878 WP_003412761.1.49880 WP_003412761.1.49944 WP_003412761.1.4999 WP_003412761.1.49990 WP_003412761.1.50068 WP_003412761.1.50077 WP_003412761.1.5008 WP_003412761.1.50081 WP_003412761.1.50122 WP_003412761.1.50126 WP_003412761.1.50149 WP_003412761.1.50162 WP_003412761.1.5018 WP_003412761.1.50194 WP_003412761.1.50218 WP_003412761.1.50235 WP_003412761.1.50249 WP_003412761.1.50265 WP_003412761.1.50271 WP_003412761.1.50324 WP_003412761.1.50347 WP_003412761.1.50372 WP_003412761.1.50398 WP_003412761.1.50407 WP_003412761.1.50466 WP_003412761.1.50472 WP_003412761.1.5048 WP_003412761.1.50498 WP_003412761.1.5050 WP_003412761.1.50540 WP_003412761.1.50554 WP_003412761.1.50557 WP_003412761.1.50601 WP_003412761.1.50610 WP_003412761.1.50632 WP_003412761.1.50633 WP_003412761.1.50642 WP_003412761.1.50655 WP_003412761.1.50659 WP_003412761.1.50683 WP_003412761.1.50689 WP_003412761.1.50692 WP_003412761.1.50714 WP_003412761.1.50729 WP_003412761.1.50756 WP_003412761.1.50784 WP_003412761.1.50794 WP_003412761.1.50841 WP_003412761.1.50860 WP_003412761.1.50868 WP_003412761.1.50877 WP_003412761.1.5096 WP_003412761.1.50981 WP_003412761.1.50987 WP_003412761.1.51003 WP_003412761.1.51009 WP_003412761.1.51037 WP_003412761.1.51074 WP_003412761.1.51082 WP_003412761.1.51101 WP_003412761.1.51116 WP_003412761.1.51149 WP_003412761.1.51156 WP_003412761.1.51157 WP_003412761.1.51213 WP_003412761.1.51232 WP_003412761.1.51239 WP_003412761.1.51247 WP_003412761.1.51266 WP_003412761.1.51279 WP_003412761.1.51291 WP_003412761.1.51294 WP_003412761.1.51301 WP_003412761.1.51329 WP_003412761.1.51391 WP_003412761.1.51422 WP_003412761.1.51445 WP_003412761.1.51455 WP_003412761.1.51466 WP_003412761.1.51468 WP_003412761.1.51478 WP_003412761.1.51497 WP_003412761.1.51520 WP_003412761.1.51593 WP_003412761.1.51628 WP_003412761.1.5164 WP_003412761.1.51647 WP_003412761.1.51660 WP_003412761.1.51696 WP_003412761.1.51721 WP_003412761.1.51788 WP_003412761.1.51795 WP_003412761.1.51801 WP_003412761.1.51817 WP_003412761.1.51819 WP_003412761.1.51854 WP_003412761.1.51923 WP_003412761.1.51942 WP_003412761.1.51948 WP_003412761.1.51963 WP_003412761.1.51969 WP_003412761.1.52000 WP_003412761.1.52001 WP_003412761.1.52003 WP_003412761.1.52006 WP_003412761.1.52036 WP_003412761.1.52038 WP_003412761.1.52046 WP_003412761.1.52059 WP_003412761.1.52069 WP_003412761.1.52082 WP_003412761.1.52102 WP_003412761.1.52106 WP_003412761.1.52166 WP_003412761.1.52168 WP_003412761.1.52173 WP_003412761.1.52178 WP_003412761.1.52206 WP_003412761.1.52216 WP_003412761.1.52238 WP_003412761.1.52241 WP_003412761.1.52280 WP_003412761.1.52314 WP_003412761.1.52385 WP_003412761.1.52390 WP_003412761.1.524 WP_003412761.1.52460 WP_003412761.1.52485 WP_003412761.1.52486 WP_003412761.1.52504 WP_003412761.1.52522 WP_003412761.1.52531 WP_003412761.1.52533 WP_003412761.1.52545 WP_003412761.1.52553 WP_003412761.1.52563 WP_003412761.1.52564 WP_003412761.1.52574 WP_003412761.1.52641 WP_003412761.1.52673 WP_003412761.1.52674 WP_003412761.1.52708 WP_003412761.1.52713 WP_003412761.1.52761 WP_003412761.1.52778 WP_003412761.1.52791 WP_003412761.1.52797 WP_003412761.1.52818 WP_003412761.1.52872 WP_003412761.1.52873 WP_003412761.1.52891 WP_003412761.1.52892 WP_003412761.1.52909 WP_003412761.1.52970 WP_003412761.1.52998 WP_003412761.1.53053 WP_003412761.1.53056 WP_003412761.1.5306 WP_003412761.1.53088 WP_003412761.1.5309 WP_003412761.1.531 WP_003412761.1.53117 WP_003412761.1.53118 WP_003412761.1.53142 WP_003412761.1.53143 WP_003412761.1.53157 WP_003412761.1.53167 WP_003412761.1.53200 WP_003412761.1.53204 WP_003412761.1.53213 WP_003412761.1.53217 WP_003412761.1.53226 WP_003412761.1.53229 WP_003412761.1.53230 WP_003412761.1.53237 WP_003412761.1.53254 WP_003412761.1.53257 WP_003412761.1.5327 WP_003412761.1.53276 WP_003412761.1.53278 WP_003412761.1.533 WP_003412761.1.53302 WP_003412761.1.53306 WP_003412761.1.5334 WP_003412761.1.5335 WP_003412761.1.53353 WP_003412761.1.53381 WP_003412761.1.53413 WP_003412761.1.53458 WP_003412761.1.53460 WP_003412761.1.53480 WP_003412761.1.53517 WP_003412761.1.53522 WP_003412761.1.53525 WP_003412761.1.53526 WP_003412761.1.53553 WP_003412761.1.53606 WP_003412761.1.53609 WP_003412761.1.53628 WP_003412761.1.53643 WP_003412761.1.53679 WP_003412761.1.53715 WP_003412761.1.53730 WP_003412761.1.53742 WP_003412761.1.53743 WP_003412761.1.53754 WP_003412761.1.53775 WP_003412761.1.53787 WP_003412761.1.53803 WP_003412761.1.53818 WP_003412761.1.53822 WP_003412761.1.53853 WP_003412761.1.53865 WP_003412761.1.53888 WP_003412761.1.53900 WP_003412761.1.53912 WP_003412761.1.53914 WP_003412761.1.53952 WP_003412761.1.5398 WP_003412761.1.5408 WP_003412761.1.54089 WP_003412761.1.54093 WP_003412761.1.54099 WP_003412761.1.54112 WP_003412761.1.54125 WP_003412761.1.54141 WP_003412761.1.54162 WP_003412761.1.54179 WP_003412761.1.54218 WP_003412761.1.54225 WP_003412761.1.54227 WP_003412761.1.54232 WP_003412761.1.54241 WP_003412761.1.54245 WP_003412761.1.54247 WP_003412761.1.54260 WP_003412761.1.54275 WP_003412761.1.54280 WP_003412761.1.5429 WP_003412761.1.54294 WP_003412761.1.54314 WP_003412761.1.54347 WP_003412761.1.54351 WP_003412761.1.54370 WP_003412761.1.54428 WP_003412761.1.54449 WP_003412761.1.54494 WP_003412761.1.54502 WP_003412761.1.54519 WP_003412761.1.5452 WP_003412761.1.54531 WP_003412761.1.54537 WP_003412761.1.54553 WP_003412761.1.54555 WP_003412761.1.54575 WP_003412761.1.54633 WP_003412761.1.54686 WP_003412761.1.54687 WP_003412761.1.54705 WP_003412761.1.54730 WP_003412761.1.54732 WP_003412761.1.5475 WP_003412761.1.54797 WP_003412761.1.54807 WP_003412761.1.54836 WP_003412761.1.54838 WP_003412761.1.54860 WP_003412761.1.54888 WP_003412761.1.54897 WP_003412761.1.54905 WP_003412761.1.54909 WP_003412761.1.54937 WP_003412761.1.54939 WP_003412761.1.54944 WP_003412761.1.54945 WP_003412761.1.54953 WP_003412761.1.54964 WP_003412761.1.55015 WP_003412761.1.55022 WP_003412761.1.55023 WP_003412761.1.55051 WP_003412761.1.55072 WP_003412761.1.55088 WP_003412761.1.55106 WP_003412761.1.55126 WP_003412761.1.55128 WP_003412761.1.55140 WP_003412761.1.55150 WP_003412761.1.55210 WP_003412761.1.55227 WP_003412761.1.55248 WP_003412761.1.55257 WP_003412761.1.55258 WP_003412761.1.55267 WP_003412761.1.55279 WP_003412761.1.55307 WP_003412761.1.55326 WP_003412761.1.55328 WP_003412761.1.5533 WP_003412761.1.55345 WP_003412761.1.55396 WP_003412761.1.55398 WP_003412761.1.55441 WP_003412761.1.55459 WP_003412761.1.55501 WP_003412761.1.55504 WP_003412761.1.55578 WP_003412761.1.55626 WP_003412761.1.55641 WP_003412761.1.5569 WP_003412761.1.55723 WP_003412761.1.55735 WP_003412761.1.5574 WP_003412761.1.55772 WP_003412761.1.55802 WP_003412761.1.55807 WP_003412761.1.55819 WP_003412761.1.55821 WP_003412761.1.5583 WP_003412761.1.55849 WP_003412761.1.55856 WP_003412761.1.55860 WP_003412761.1.55882 WP_003412761.1.55883 WP_003412761.1.55894 WP_003412761.1.55902 WP_003412761.1.55908 WP_003412761.1.55909 WP_003412761.1.5591 WP_003412761.1.55961 WP_003412761.1.55977 WP_003412761.1.55983 WP_003412761.1.56028 WP_003412761.1.56057 WP_003412761.1.56060 WP_003412761.1.56107 WP_003412761.1.56132 WP_003412761.1.56163 WP_003412761.1.56167 WP_003412761.1.56178 WP_003412761.1.56287 WP_003412761.1.56292 WP_003412761.1.56327 WP_003412761.1.56341 WP_003412761.1.56359 WP_003412761.1.56365 WP_003412761.1.56394 WP_003412761.1.56443 WP_003412761.1.56473 WP_003412761.1.56478 WP_003412761.1.56500 WP_003412761.1.56517 WP_003412761.1.56534 WP_003412761.1.5656 WP_003412761.1.56577 WP_003412761.1.56593 WP_003412761.1.56625 WP_003412761.1.56637 WP_003412761.1.56697 WP_003412761.1.567 WP_003412761.1.56709 WP_003412761.1.56729 WP_003412761.1.56743 WP_003412761.1.56755 WP_003412761.1.56764 WP_003412761.1.56769 WP_003412761.1.56770 WP_003412761.1.56795 WP_003412761.1.5681 WP_003412761.1.56827 WP_003412761.1.56839 WP_003412761.1.56863 WP_003412761.1.56868 WP_003412761.1.56869 WP_003412761.1.56915 WP_003412761.1.56926 WP_003412761.1.56961 WP_003412761.1.56971 WP_003412761.1.56972 WP_003412761.1.57023 WP_003412761.1.57035 WP_003412761.1.57077 WP_003412761.1.57087 WP_003412761.1.57094 WP_003412761.1.57134 WP_003412761.1.57151 WP_003412761.1.57169 WP_003412761.1.57208 WP_003412761.1.57212 WP_003412761.1.57230 WP_003412761.1.5724 WP_003412761.1.5725 WP_003412761.1.5727 WP_003412761.1.57273 WP_003412761.1.573 WP_003412761.1.57326 WP_003412761.1.57328 WP_003412761.1.57331 WP_003412761.1.57340 WP_003412761.1.57351 WP_003412761.1.57352 WP_003412761.1.57380 WP_003412761.1.57430 WP_003412761.1.5744 WP_003412761.1.57440 WP_003412761.1.5745 WP_003412761.1.57461 WP_003412761.1.57469 WP_003412761.1.57489 WP_003412761.1.575 WP_003412761.1.57509 WP_003412761.1.57519 WP_003412761.1.57525 WP_003412761.1.57551 WP_003412761.1.5758 WP_003412761.1.57596 WP_003412761.1.57604 WP_003412761.1.57616 WP_003412761.1.57617 WP_003412761.1.57619 WP_003412761.1.57642 WP_003412761.1.57658 WP_003412761.1.57675 WP_003412761.1.57689 WP_003412761.1.57708 WP_003412761.1.57821 WP_003412761.1.57825 WP_003412761.1.57843 WP_003412761.1.57906 WP_003412761.1.57924 WP_003412761.1.57926 WP_003412761.1.57930 WP_003412761.1.57957 WP_003412761.1.57960 WP_003412761.1.57964 WP_003412761.1.57991 WP_003412761.1.58000 WP_003412761.1.58086 WP_003412761.1.58101 WP_003412761.1.58103 WP_003412761.1.58108 WP_003412761.1.5811 WP_003412761.1.58121 WP_003412761.1.58145 WP_003412761.1.58164 WP_003412761.1.58174 WP_003412761.1.582 WP_003412761.1.58202 WP_003412761.1.58209 WP_003412761.1.5824 WP_003412761.1.58250 WP_003412761.1.58259 WP_003412761.1.58283 WP_003412761.1.5830 WP_003412761.1.58303 WP_003412761.1.58311 WP_003412761.1.58330 WP_003412761.1.58359 WP_003412761.1.58386 WP_003412761.1.58393 WP_003412761.1.58431 WP_003412761.1.5844 WP_003412761.1.58457 WP_003412761.1.58488 WP_003412761.1.58518 WP_003412761.1.58534 WP_003412761.1.58559 WP_003412761.1.58567 WP_003412761.1.58573 WP_003412761.1.58602 WP_003412761.1.58612 WP_003412761.1.58619 WP_003412761.1.58630 WP_003412761.1.5865 WP_003412761.1.58671 WP_003412761.1.58690 WP_003412761.1.58702 WP_003412761.1.58743 WP_003412761.1.58754 WP_003412761.1.5879 WP_003412761.1.5881 WP_003412761.1.58824 WP_003412761.1.58848 WP_003412761.1.58857 WP_003412761.1.58891 WP_003412761.1.58892 WP_003412761.1.5890 WP_003412761.1.58904 WP_003412761.1.58921 WP_003412761.1.58930 WP_003412761.1.58939 WP_003412761.1.58941 WP_003412761.1.58953 WP_003412761.1.58961 WP_003412761.1.5898 WP_003412761.1.59025 WP_003412761.1.59029 WP_003412761.1.59037 WP_003412761.1.59044 WP_003412761.1.59085 WP_003412761.1.59088 WP_003412761.1.59112 WP_003412761.1.59130 WP_003412761.1.5914 WP_003412761.1.59147 WP_003412761.1.59166 WP_003412761.1.59205 WP_003412761.1.59209 WP_003412761.1.59237 WP_003412761.1.59240 WP_003412761.1.59253 WP_003412761.1.59254 WP_003412761.1.59262 WP_003412761.1.59270 WP_003412761.1.5928 WP_003412761.1.59304 WP_003412761.1.59305 WP_003412761.1.59309 WP_003412761.1.59316 WP_003412761.1.59326 WP_003412761.1.59328 WP_003412761.1.59333 WP_003412761.1.59338 WP_003412761.1.59388 WP_003412761.1.59428 WP_003412761.1.59487 WP_003412761.1.59537 WP_003412761.1.59561 WP_003412761.1.59677 WP_003412761.1.59722 WP_003412761.1.59727 WP_003412761.1.59732 WP_003412761.1.59738 WP_003412761.1.59750 WP_003412761.1.59757 WP_003412761.1.59761 WP_003412761.1.59808 WP_003412761.1.59850 WP_003412761.1.59856 WP_003412761.1.59860 WP_003412761.1.59861 WP_003412761.1.5987 WP_003412761.1.59878 WP_003412761.1.59888 WP_003412761.1.59952 WP_003412761.1.5996 WP_003412761.1.59961 WP_003412761.1.59974 WP_003412761.1.6000 WP_003412761.1.60007 WP_003412761.1.60016 WP_003412761.1.6003 WP_003412761.1.6007 WP_003412761.1.60091 WP_003412761.1.60121 WP_003412761.1.60125 WP_003412761.1.60135 WP_003412761.1.60139 WP_003412761.1.60152 WP_003412761.1.60171 WP_003412761.1.60197 WP_003412761.1.6020 WP_003412761.1.60205 WP_003412761.1.60207 WP_003412761.1.60215 WP_003412761.1.60217 WP_003412761.1.60267 WP_003412761.1.60288 WP_003412761.1.60291 WP_003412761.1.60301 WP_003412761.1.60305 WP_003412761.1.60312 WP_003412761.1.60313 WP_003412761.1.60314 WP_003412761.1.60367 WP_003412761.1.60376 WP_003412761.1.60403 WP_003412761.1.60413 WP_003412761.1.60421 WP_003412761.1.60451 WP_003412761.1.60460 WP_003412761.1.60479 WP_003412761.1.60487 WP_003412761.1.60512 WP_003412761.1.60573 WP_003412761.1.60583 WP_003412761.1.60632 WP_003412761.1.60657 WP_003412761.1.60687 WP_003412761.1.60689 WP_003412761.1.60727 WP_003412761.1.60738 WP_003412761.1.60763 WP_003412761.1.6077 WP_003412761.1.60791 WP_003412761.1.60834 WP_003412761.1.60870 WP_003412761.1.60878 WP_003412761.1.60879 WP_003412761.1.60913 WP_003412761.1.60978 WP_003412761.1.61000 WP_003412761.1.61001 WP_003412761.1.61014 WP_003412761.1.61015 WP_003412761.1.61037 WP_003412761.1.61052 WP_003412761.1.61065 WP_003412761.1.61100 WP_003412761.1.61101 WP_003412761.1.61138 WP_003412761.1.61142 WP_003412761.1.61198 WP_003412761.1.61234 WP_003412761.1.61256 WP_003412761.1.61281 WP_003412761.1.61314 WP_003412761.1.61321 WP_003412761.1.61326 WP_003412761.1.61328 WP_003412761.1.61368 WP_003412761.1.61391 WP_003412761.1.61406 WP_003412761.1.61409 WP_003412761.1.61420 WP_003412761.1.61422 WP_003412761.1.61425 WP_003412761.1.61428 WP_003412761.1.61469 WP_003412761.1.61494 WP_003412761.1.61522 WP_003412761.1.61552 WP_003412761.1.61557 WP_003412761.1.61567 WP_003412761.1.61571 WP_003412761.1.61573 WP_003412761.1.61584 WP_003412761.1.61586 WP_003412761.1.6159 WP_003412761.1.6160 WP_003412761.1.61614 WP_003412761.1.6163 WP_003412761.1.61655 WP_003412761.1.61665 WP_003412761.1.61669 WP_003412761.1.61682 WP_003412761.1.61692 WP_003412761.1.61719 WP_003412761.1.61728 WP_003412761.1.61750 WP_003412761.1.61754 WP_003412761.1.61755 WP_003412761.1.61757 WP_003412761.1.61778 WP_003412761.1.6179 WP_003412761.1.61793 WP_003412761.1.61816 WP_003412761.1.61842 WP_003412761.1.61850 WP_003412761.1.61862 WP_003412761.1.61865 WP_003412761.1.61868 WP_003412761.1.61911 WP_003412761.1.61925 WP_003412761.1.61941 WP_003412761.1.61953 WP_003412761.1.61979 WP_003412761.1.61986 WP_003412761.1.61987 WP_003412761.1.61998 WP_003412761.1.62021 WP_003412761.1.62087 WP_003412761.1.62089 WP_003412761.1.62101 WP_003412761.1.62104 WP_003412761.1.6211 WP_003412761.1.62132 WP_003412761.1.62162 WP_003412761.1.62225 WP_003412761.1.62230 WP_003412761.1.62238 WP_003412761.1.62249 WP_003412761.1.62270 WP_003412761.1.62281 WP_003412761.1.62307 WP_003412761.1.6231 WP_003412761.1.62359 WP_003412761.1.62360 WP_003412761.1.62371 WP_003412761.1.62379 WP_003412761.1.62395 WP_003412761.1.62408 WP_003412761.1.62449 WP_003412761.1.62468 WP_003412761.1.6248 WP_003412761.1.62508 WP_003412761.1.62565 WP_003412761.1.62594 WP_003412761.1.62606 WP_003412761.1.62616 WP_003412761.1.62666 WP_003412761.1.62687 WP_003412761.1.62715 WP_003412761.1.62730 WP_003412761.1.62738 WP_003412761.1.62761 WP_003412761.1.62766 WP_003412761.1.62786 WP_003412761.1.62813 WP_003412761.1.62839 WP_003412761.1.62841 WP_003412761.1.62909 WP_003412761.1.62936 WP_003412761.1.6294 WP_003412761.1.6295 WP_003412761.1.63007 WP_003412761.1.63019 WP_003412761.1.63032 WP_003412761.1.63037 WP_003412761.1.63064 WP_003412761.1.63066 WP_003412761.1.63072 WP_003412761.1.6308 WP_003412761.1.63081 WP_003412761.1.63096 WP_003412761.1.63106 WP_003412761.1.6314 WP_003412761.1.63144 WP_003412761.1.63154 WP_003412761.1.63160 WP_003412761.1.63161 WP_003412761.1.63166 WP_003412761.1.63175 WP_003412761.1.63194 WP_003412761.1.6322 WP_003412761.1.63222 WP_003412761.1.63247 WP_003412761.1.6328 WP_003412761.1.63291 WP_003412761.1.63317 WP_003412761.1.63331 WP_003412761.1.63373 WP_003412761.1.63384 WP_003412761.1.63403 WP_003412761.1.63424 WP_003412761.1.63428 WP_003412761.1.6345 WP_003412761.1.63464 WP_003412761.1.63483 WP_003412761.1.63502 WP_003412761.1.63504 WP_003412761.1.63522 WP_003412761.1.63530 WP_003412761.1.63538 WP_003412761.1.63564 WP_003412761.1.63567 WP_003412761.1.63596 WP_003412761.1.63600 WP_003412761.1.63623 WP_003412761.1.63624 WP_003412761.1.63625 WP_003412761.1.63627 WP_003412761.1.63654 WP_003412761.1.63662 WP_003412761.1.63711 WP_003412761.1.63734 WP_003412761.1.63807 WP_003412761.1.63819 WP_003412761.1.63844 WP_003412761.1.63888 WP_003412761.1.63913 WP_003412761.1.63915 WP_003412761.1.63918 WP_003412761.1.63970 WP_003412761.1.64000 WP_003412761.1.64027 WP_003412761.1.64058 WP_003412761.1.64065 WP_003412761.1.6407 WP_003412761.1.64082 WP_003412761.1.64091 WP_003412761.1.64102 WP_003412761.1.64104 WP_003412761.1.64119 WP_003412761.1.64169 WP_003412761.1.64219 WP_003412761.1.6422 WP_003412761.1.64222 WP_003412761.1.64223 WP_003412761.1.64228 WP_003412761.1.64235 WP_003412761.1.64249 WP_003412761.1.6427 WP_003412761.1.64278 WP_003412761.1.64287 WP_003412761.1.64414 WP_003412761.1.64419 WP_003412761.1.6443 WP_003412761.1.64463 WP_003412761.1.64480 WP_003412761.1.64497 WP_003412761.1.64506 WP_003412761.1.64511 WP_003412761.1.64513 WP_003412761.1.64514 WP_003412761.1.64515 WP_003412761.1.64522 WP_003412761.1.64526 WP_003412761.1.64543 WP_003412761.1.6456 WP_003412761.1.64567 WP_003412761.1.64588 WP_003412761.1.64589 WP_003412761.1.64594 WP_003412761.1.64595 WP_003412761.1.64608 WP_003412761.1.64619 WP_003412761.1.64629 WP_003412761.1.6464 WP_003412761.1.64664 WP_003412761.1.64669 WP_003412761.1.64672 WP_003412761.1.64680 WP_003412761.1.64682 WP_003412761.1.64727 WP_003412761.1.64729 WP_003412761.1.64774 WP_003412761.1.64776 WP_003412761.1.64802 WP_003412761.1.64832 WP_003412761.1.6486 WP_003412761.1.64870 WP_003412761.1.64898 WP_003412761.1.64922 WP_003412761.1.64924 WP_003412761.1.6493 WP_003412761.1.64937 WP_003412761.1.64941 WP_003412761.1.64966 WP_003412761.1.64973 WP_003412761.1.65001 WP_003412761.1.65026 WP_003412761.1.65053 WP_003412761.1.65070 WP_003412761.1.65079 WP_003412761.1.65102 WP_003412761.1.65157 WP_003412761.1.65181 WP_003412761.1.65212 WP_003412761.1.65229 WP_003412761.1.6523 WP_003412761.1.65253 WP_003412761.1.65289 WP_003412761.1.65291 WP_003412761.1.65315 WP_003412761.1.65329 WP_003412761.1.65359 WP_003412761.1.6536 WP_003412761.1.65374 WP_003412761.1.65386 WP_003412761.1.65414 WP_003412761.1.65416 WP_003412761.1.65433 WP_003412761.1.65455 WP_003412761.1.65467 WP_003412761.1.65488 WP_003412761.1.65529 WP_003412761.1.65539 WP_003412761.1.65583 WP_003412761.1.65612 WP_003412761.1.65623 WP_003412761.1.65635 WP_003412761.1.65637 WP_003412761.1.65648 WP_003412761.1.65683 WP_003412761.1.65686 WP_003412761.1.65688 WP_003412761.1.65707 WP_003412761.1.65733 WP_003412761.1.65746 WP_003412761.1.65747 WP_003412761.1.65759 WP_003412761.1.65816 WP_003412761.1.65830 WP_003412761.1.65858 WP_003412761.1.65862 WP_003412761.1.65869 WP_003412761.1.65893 WP_003412761.1.65929 WP_003412761.1.65958 WP_003412761.1.65974 WP_003412761.1.66004 WP_003412761.1.66013 WP_003412761.1.6606 WP_003412761.1.66089 WP_003412761.1.66149 WP_003412761.1.66151 WP_003412761.1.66276 WP_003412761.1.66293 WP_003412761.1.66297 WP_003412761.1.66323 WP_003412761.1.66325 WP_003412761.1.6633 WP_003412761.1.66355 WP_003412761.1.66367 WP_003412761.1.66394 WP_003412761.1.66396 WP_003412761.1.66451 WP_003412761.1.66455 WP_003412761.1.66457 WP_003412761.1.66460 WP_003412761.1.66464 WP_003412761.1.66466 WP_003412761.1.66487 WP_003412761.1.66504 WP_003412761.1.66544 WP_003412761.1.66558 WP_003412761.1.66580 WP_003412761.1.66582 WP_003412761.1.66612 WP_003412761.1.66615 WP_003412761.1.66617 WP_003412761.1.66635 WP_003412761.1.66656 WP_003412761.1.66663 WP_003412761.1.66675 WP_003412761.1.66715 WP_003412761.1.66718 WP_003412761.1.66762 WP_003412761.1.66776 WP_003412761.1.66808 WP_003412761.1.66817 WP_003412761.1.66819 WP_003412761.1.66826 WP_003412761.1.66830 WP_003412761.1.66842 WP_003412761.1.66868 WP_003412761.1.66878 WP_003412761.1.66880 WP_003412761.1.66893 WP_003412761.1.66961 WP_003412761.1.67005 WP_003412761.1.6704 WP_003412761.1.67044 WP_003412761.1.67061 WP_003412761.1.67089 WP_003412761.1.67098 WP_003412761.1.67146 WP_003412761.1.67170 WP_003412761.1.67197 WP_003412761.1.67198 WP_003412761.1.6720 WP_003412761.1.67207 WP_003412761.1.67218 WP_003412761.1.67220 WP_003412761.1.67225 WP_003412761.1.67231 WP_003412761.1.6724 WP_003412761.1.67257 WP_003412761.1.67298 WP_003412761.1.67324 WP_003412761.1.67332 WP_003412761.1.67346 WP_003412761.1.67354 WP_003412761.1.67360 WP_003412761.1.67381 WP_003412761.1.67396 WP_003412761.1.67417 WP_003412761.1.67422 WP_003412761.1.67453 WP_003412761.1.67459 WP_003412761.1.67473 WP_003412761.1.67481 WP_003412761.1.67482 WP_003412761.1.67496 WP_003412761.1.67499 WP_003412761.1.67516 WP_003412761.1.67523 WP_003412761.1.67536 WP_003412761.1.67575 WP_003412761.1.67587 WP_003412761.1.67598 WP_003412761.1.67600 WP_003412761.1.67602 WP_003412761.1.67630 WP_003412761.1.67679 WP_003412761.1.67692 WP_003412761.1.67744 WP_003412761.1.67750 WP_003412761.1.6777 WP_003412761.1.67809 WP_003412761.1.67816 WP_003412761.1.67844 WP_003412761.1.67848 WP_003412761.1.67870 WP_003412761.1.67888 WP_003412761.1.67915 WP_003412761.1.67945 WP_003412761.1.67949 WP_003412761.1.67980 WP_003412761.1.67982 WP_003412761.1.68022 WP_003412761.1.68029 WP_003412761.1.68037 WP_003412761.1.68038 WP_003412761.1.68045 WP_003412761.1.68057 WP_003412761.1.68083 WP_003412761.1.68088 WP_003412761.1.68106 WP_003412761.1.68110 WP_003412761.1.68153 WP_003412761.1.68164 WP_003412761.1.68169 WP_003412761.1.68193 WP_003412761.1.68212 WP_003412761.1.68227 WP_003412761.1.68243 WP_003412761.1.6825 WP_003412761.1.68297 WP_003412761.1.68309 WP_003412761.1.68325 WP_003412761.1.68329 WP_003412761.1.68340 WP_003412761.1.68384 WP_003412761.1.68388 WP_003412761.1.68429 WP_003412761.1.6843 WP_003412761.1.68433 WP_003412761.1.68444 WP_003412761.1.68465 WP_003412761.1.68484 WP_003412761.1.68518 WP_003412761.1.68569 WP_003412761.1.68576 WP_003412761.1.68580 WP_003412761.1.68586 WP_003412761.1.68623 WP_003412761.1.68624 WP_003412761.1.68637 WP_003412761.1.68646 WP_003412761.1.68667 WP_003412761.1.68669 WP_003412761.1.68672 WP_003412761.1.68684 WP_003412761.1.68704 WP_003412761.1.68708 WP_003412761.1.6872 WP_003412761.1.68730 WP_003412761.1.68734 WP_003412761.1.68748 WP_003412761.1.68754 WP_003412761.1.6876 WP_003412761.1.68761 WP_003412761.1.68763 WP_003412761.1.68766 WP_003412761.1.68774 WP_003412761.1.68796 WP_003412761.1.68824 WP_003412761.1.68832 WP_003412761.1.68833 WP_003412761.1.68841 WP_003412761.1.68859 WP_003412761.1.68876 WP_003412761.1.68906 WP_003412761.1.68916 WP_003412761.1.68923 WP_003412761.1.68945 WP_003412761.1.6896 WP_003412761.1.68981 WP_003412761.1.68984 WP_003412761.1.68997 WP_003412761.1.69008 WP_003412761.1.69076 WP_003412761.1.69079 WP_003412761.1.6908 WP_003412761.1.69082 WP_003412761.1.69178 WP_003412761.1.69181 WP_003412761.1.69208 WP_003412761.1.69231 WP_003412761.1.69256 WP_003412761.1.69311 WP_003412761.1.69315 WP_003412761.1.69322 WP_003412761.1.69342 WP_003412761.1.6935 WP_003412761.1.6936 WP_003412761.1.69369 WP_003412761.1.69374 WP_003412761.1.69398 WP_003412761.1.69401 WP_003412761.1.69426 WP_003412761.1.69427 WP_003412761.1.69429 WP_003412761.1.6949 WP_003412761.1.6951 WP_003412761.1.69511 WP_003412761.1.69526 WP_003412761.1.69528 WP_003412761.1.69547 WP_003412761.1.69573 WP_003412761.1.69581 WP_003412761.1.6960 WP_003412761.1.69617 WP_003412761.1.69647 WP_003412761.1.69659 WP_003412761.1.69673 WP_003412761.1.69682 WP_003412761.1.69684 WP_003412761.1.69686 WP_003412761.1.69707 WP_003412761.1.69709 WP_003412761.1.69723 WP_003412761.1.69736 WP_003412761.1.69778 WP_003412761.1.69800 WP_003412761.1.69802 WP_003412761.1.69845 WP_003412761.1.69870 WP_003412761.1.69873 WP_003412761.1.69898 WP_003412761.1.69913 WP_003412761.1.69925 WP_003412761.1.69931 WP_003412761.1.69938 WP_003412761.1.69955 WP_003412761.1.69981 WP_003412761.1.69990 WP_003412761.1.70 WP_003412761.1.70000 WP_003412761.1.70017 WP_003412761.1.70032 WP_003412761.1.70055 WP_003412761.1.70062 WP_003412761.1.70072 WP_003412761.1.70131 WP_003412761.1.70132 WP_003412761.1.7022 WP_003412761.1.70227 WP_003412761.1.70255 WP_003412761.1.70271 WP_003412761.1.70274 WP_003412761.1.7029 WP_003412761.1.70325 WP_003412761.1.70328 WP_003412761.1.70356 WP_003412761.1.70364 WP_003412761.1.70368 WP_003412761.1.70369 WP_003412761.1.70418 WP_003412761.1.70422 WP_003412761.1.70435 WP_003412761.1.70444 WP_003412761.1.70463 WP_003412761.1.70471 WP_003412761.1.70480 WP_003412761.1.70494 WP_003412761.1.70498 WP_003412761.1.70505 WP_003412761.1.70525 WP_003412761.1.70573 WP_003412761.1.70577 WP_003412761.1.70610 WP_003412761.1.70615 WP_003412761.1.70618 WP_003412761.1.70622 WP_003412761.1.70626 WP_003412761.1.70668 WP_003412761.1.70699 WP_003412761.1.70704 WP_003412761.1.70729 WP_003412761.1.70757 WP_003412761.1.70782 WP_003412761.1.70796 WP_003412761.1.70830 WP_003412761.1.70834 WP_003412761.1.7084 WP_003412761.1.70840 WP_003412761.1.70864 WP_003412761.1.70871 WP_003412761.1.70915 WP_003412761.1.70955 WP_003412761.1.70958 WP_003412761.1.70964 WP_003412761.1.70976 WP_003412761.1.71015 WP_003412761.1.71026 WP_003412761.1.71063 WP_003412761.1.71076 WP_003412761.1.71083 WP_003412761.1.7111 WP_003412761.1.71118 WP_003412761.1.71128 WP_003412761.1.7113 WP_003412761.1.71187 WP_003412761.1.71191 WP_003412761.1.71255 WP_003412761.1.71258 WP_003412761.1.71259 WP_003412761.1.71289 WP_003412761.1.71326 WP_003412761.1.71329 WP_003412761.1.71331 WP_003412761.1.71344 WP_003412761.1.71390 WP_003412761.1.71399 WP_003412761.1.71414 WP_003412761.1.71440 WP_003412761.1.71457 WP_003412761.1.7146 WP_003412761.1.71464 WP_003412761.1.71490 WP_003412761.1.71492 WP_003412761.1.71509 WP_003412761.1.71516 WP_003412761.1.71517 WP_003412761.1.71527 WP_003412761.1.71532 WP_003412761.1.71545 WP_003412761.1.71546 WP_003412761.1.71604 WP_003412761.1.71621 WP_003412761.1.71630 WP_003412761.1.71638 WP_003412761.1.71654 WP_003412761.1.71664 WP_003412761.1.71665 WP_003412761.1.71683 WP_003412761.1.71701 WP_003412761.1.71718 WP_003412761.1.71731 WP_003412761.1.71778 WP_003412761.1.71781 WP_003412761.1.71803 WP_003412761.1.71820 WP_003412761.1.71847 WP_003412761.1.7185 WP_003412761.1.71851 WP_003412761.1.71871 WP_003412761.1.71909 WP_003412761.1.71957 WP_003412761.1.71970 WP_003412761.1.72047 WP_003412761.1.72061 WP_003412761.1.72062 WP_003412761.1.72072 WP_003412761.1.72111 WP_003412761.1.72122 WP_003412761.1.72128 WP_003412761.1.72143 WP_003412761.1.7216 WP_003412761.1.72168 WP_003412761.1.72179 WP_003412761.1.72209 WP_003412761.1.72218 WP_003412761.1.72219 WP_003412761.1.72227 WP_003412761.1.7224 WP_003412761.1.72268 WP_003412761.1.72332 WP_003412761.1.72380 WP_003412761.1.72401 WP_003412761.1.72405 WP_003412761.1.72420 WP_003412761.1.72441 WP_003412761.1.72451 WP_003412761.1.72452 WP_003412761.1.72457 WP_003412761.1.72459 WP_003412761.1.72460 WP_003412761.1.72466 WP_003412761.1.72487 WP_003412761.1.72488 WP_003412761.1.72492 WP_003412761.1.72506 WP_003412761.1.72543 WP_003412761.1.7256 WP_003412761.1.72576 WP_003412761.1.72578 WP_003412761.1.72585 WP_003412761.1.72591 WP_003412761.1.72592 WP_003412761.1.72640 WP_003412761.1.7266 WP_003412761.1.72661 WP_003412761.1.72739 WP_003412761.1.72744 WP_003412761.1.72755 WP_003412761.1.72759 WP_003412761.1.72784 WP_003412761.1.72792 WP_003412761.1.72826 WP_003412761.1.72831 WP_003412761.1.72852 WP_003412761.1.72853 WP_003412761.1.72879 WP_003412761.1.72880 WP_003412761.1.72938 WP_003412761.1.72954 WP_003412761.1.72957 WP_003412761.1.72959 WP_003412761.1.72973 WP_003412761.1.7298 WP_003412761.1.72982 WP_003412761.1.72988 WP_003412761.1.72993 WP_003412761.1.73006 WP_003412761.1.73013 WP_003412761.1.73028 WP_003412761.1.73045 WP_003412761.1.73092 WP_003412761.1.73118 WP_003412761.1.7312 WP_003412761.1.73127 WP_003412761.1.73134 WP_003412761.1.73150 WP_003412761.1.73154 WP_003412761.1.73163 WP_003412761.1.73182 WP_003412761.1.73205 WP_003412761.1.7321 WP_003412761.1.73310 WP_003412761.1.73315 WP_003412761.1.73365 WP_003412761.1.73391 WP_003412761.1.73404 WP_003412761.1.73424 WP_003412761.1.73436 WP_003412761.1.73445 WP_003412761.1.73453 WP_003412761.1.73465 WP_003412761.1.73466 WP_003412761.1.73470 WP_003412761.1.73471 WP_003412761.1.73478 WP_003412761.1.73482 WP_003412761.1.73507 WP_003412761.1.73532 WP_003412761.1.73550 WP_003412761.1.73564 WP_003412761.1.73623 WP_003412761.1.73629 WP_003412761.1.7366 WP_003412761.1.73661 WP_003412761.1.7368 WP_003412761.1.73688 WP_003412761.1.73723 WP_003412761.1.73744 WP_003412761.1.73750 WP_003412761.1.73760 WP_003412761.1.73774 WP_003412761.1.7379 WP_003412761.1.73813 WP_003412761.1.73840 WP_003412761.1.73876 WP_003412761.1.73986 WP_003412761.1.74016 WP_003412761.1.74039 WP_003412761.1.74083 WP_003412761.1.74101 WP_003412761.1.74107 WP_003412761.1.74120 WP_003412761.1.74129 WP_003412761.1.74144 WP_003412761.1.7417 WP_003412761.1.74190 WP_003412761.1.74210 WP_003412761.1.7423 WP_003412761.1.74259 WP_003412761.1.74262 WP_003412761.1.74269 WP_003412761.1.74282 WP_003412761.1.74291 WP_003412761.1.74296 WP_003412761.1.74304 WP_003412761.1.7432 WP_003412761.1.74347 WP_003412761.1.7436 WP_003412761.1.74378 WP_003412761.1.74382 WP_003412761.1.74395 WP_003412761.1.74400 WP_003412761.1.74401 WP_003412761.1.74432 WP_003412761.1.74442 WP_003412761.1.74477 WP_003412761.1.74487 WP_003412761.1.74499 WP_003412761.1.74504 WP_003412761.1.74511 WP_003412761.1.74523 WP_003412761.1.74525 WP_003412761.1.74551 WP_003412761.1.74555 WP_003412761.1.74628 WP_003412761.1.74641 WP_003412761.1.74653 WP_003412761.1.74660 WP_003412761.1.74683 WP_003412761.1.7469 WP_003412761.1.74725 WP_003412761.1.74760 WP_003412761.1.74809 WP_003412761.1.74820 WP_003412761.1.74870 WP_003412761.1.74881 WP_003412761.1.74888 WP_003412761.1.74952 WP_003412761.1.7496 WP_003412761.1.74988 WP_003412761.1.75043 WP_003412761.1.75045 WP_003412761.1.75055 WP_003412761.1.75078 WP_003412761.1.75081 WP_003412761.1.75120 WP_003412761.1.75163 WP_003412761.1.75188 WP_003412761.1.75200 WP_003412761.1.75202 WP_003412761.1.75234 WP_003412761.1.75239 WP_003412761.1.75250 WP_003412761.1.75263 WP_003412761.1.75281 WP_003412761.1.75342 WP_003412761.1.7535 WP_003412761.1.75376 WP_003412761.1.75391 WP_003412761.1.75395 WP_003412761.1.75441 WP_003412761.1.75510 WP_003412761.1.75581 WP_003412761.1.75598 WP_003412761.1.75635 WP_003412761.1.75645 WP_003412761.1.75665 WP_003412761.1.75671 WP_003412761.1.75749 WP_003412761.1.75772 WP_003412761.1.75774 WP_003412761.1.75811 WP_003412761.1.75833 WP_003412761.1.7585 WP_003412761.1.75868 WP_003412761.1.75878 WP_003412761.1.75927 WP_003412761.1.75946 WP_003412761.1.75968 WP_003412761.1.75974 WP_003412761.1.76007 WP_003412761.1.76016 WP_003412761.1.76032 WP_003412761.1.76037 WP_003412761.1.7604 WP_003412761.1.76045 WP_003412761.1.76052 WP_003412761.1.76058 WP_003412761.1.76064 WP_003412761.1.76110 WP_003412761.1.76126 WP_003412761.1.76138 WP_003412761.1.76157 WP_003412761.1.76172 WP_003412761.1.76177 WP_003412761.1.76183 WP_003412761.1.76209 WP_003412761.1.76272 WP_003412761.1.76277 WP_003412761.1.76280 WP_003412761.1.76281 WP_003412761.1.76291 WP_003412761.1.76297 WP_003412761.1.76360 WP_003412761.1.76379 WP_003412761.1.76403 WP_003412761.1.76413 WP_003412761.1.76414 WP_003412761.1.76427 WP_003412761.1.76436 WP_003412761.1.76442 WP_003412761.1.76443 WP_003412761.1.76456 WP_003412761.1.76533 WP_003412761.1.76616 WP_003412761.1.76625 WP_003412761.1.76629 WP_003412761.1.76635 WP_003412761.1.76638 WP_003412761.1.76639 WP_003412761.1.76640 WP_003412761.1.76644 WP_003412761.1.76677 WP_003412761.1.76678 WP_003412761.1.76679 WP_003412761.1.76734 WP_003412761.1.76744 WP_003412761.1.76750 WP_003412761.1.76754 WP_003412761.1.76757 WP_003412761.1.76781 WP_003412761.1.76818 WP_003412761.1.76824 WP_003412761.1.76835 WP_003412761.1.76873 WP_003412761.1.76881 WP_003412761.1.76888 WP_003412761.1.76900 WP_003412761.1.7691 WP_003412761.1.76947 WP_003412761.1.76954 WP_003412761.1.76955 WP_003412761.1.76963 WP_003412761.1.76976 WP_003412761.1.770 WP_003412761.1.77000 WP_003412761.1.77008 WP_003412761.1.77021 WP_003412761.1.77056 WP_003412761.1.77065 WP_003412761.1.77075 WP_003412761.1.77093 WP_003412761.1.77115 WP_003412761.1.77118 WP_003412761.1.77125 WP_003412761.1.77141 WP_003412761.1.77142 WP_003412761.1.77166 WP_003412761.1.77250 WP_003412761.1.77252 WP_003412761.1.77260 WP_003412761.1.77266 WP_003412761.1.77280 WP_003412761.1.77285 WP_003412761.1.77312 WP_003412761.1.77348 WP_003412761.1.77351 WP_003412761.1.77352 WP_003412761.1.77361 WP_003412761.1.774 WP_003412761.1.7740 WP_003412761.1.77404 WP_003412761.1.77463 WP_003412761.1.77474 WP_003412761.1.7748 WP_003412761.1.77484 WP_003412761.1.77491 WP_003412761.1.77499 WP_003412761.1.77510 WP_003412761.1.77530 WP_003412761.1.77554 WP_003412761.1.77559 WP_003412761.1.77599 WP_003412761.1.77605 WP_003412761.1.7762 WP_003412761.1.77627 WP_003412761.1.77649 WP_003412761.1.77654 WP_003412761.1.7766 WP_003412761.1.77667 WP_003412761.1.77704 WP_003412761.1.77706 WP_003412761.1.77726 WP_003412761.1.77774 WP_003412761.1.7778 WP_003412761.1.77790 WP_003412761.1.77809 WP_003412761.1.77820 WP_003412761.1.77843 WP_003412761.1.77855 WP_003412761.1.77865 WP_003412761.1.77868 WP_003412761.1.77879 WP_003412761.1.77890 WP_003412761.1.77909 WP_003412761.1.77911 WP_003412761.1.77931 WP_003412761.1.77984 WP_003412761.1.78020 WP_003412761.1.78024 WP_003412761.1.78075 WP_003412761.1.78084 WP_003412761.1.78086 WP_003412761.1.7809 WP_003412761.1.78098 WP_003412761.1.78105 WP_003412761.1.78113 WP_003412761.1.78136 WP_003412761.1.78162 WP_003412761.1.7817 WP_003412761.1.78200 WP_003412761.1.78216 WP_003412761.1.78236 WP_003412761.1.78238 WP_003412761.1.78322 WP_003412761.1.78338 WP_003412761.1.7836 WP_003412761.1.78360 WP_003412761.1.78386 WP_003412761.1.78429 WP_003412761.1.78435 WP_003412761.1.7844 WP_003412761.1.78459 WP_003412761.1.78488 WP_003412761.1.7849 WP_003412761.1.78499 WP_003412761.1.785 WP_003412761.1.78516 WP_003412761.1.78524 WP_003412761.1.78526 WP_003412761.1.78538 WP_003412761.1.78544 WP_003412761.1.78545 WP_003412761.1.78547 WP_003412761.1.78574 WP_003412761.1.78580 WP_003412761.1.7860 WP_003412761.1.78620 WP_003412761.1.78646 WP_003412761.1.78648 WP_003412761.1.78649 WP_003412761.1.78655 WP_003412761.1.78657 WP_003412761.1.78659 WP_003412761.1.7869 WP_003412761.1.78692 WP_003412761.1.78760 WP_003412761.1.78766 WP_003412761.1.78776 WP_003412761.1.78778 WP_003412761.1.78784 WP_003412761.1.78788 WP_003412761.1.78790 WP_003412761.1.78793 WP_003412761.1.78848 WP_003412761.1.78860 WP_003412761.1.7887 WP_003412761.1.78932 WP_003412761.1.78969 WP_003412761.1.78977 WP_003412761.1.78980 WP_003412761.1.79005 WP_003412761.1.79016 WP_003412761.1.79033 WP_003412761.1.79064 WP_003412761.1.79066 WP_003412761.1.79068 WP_003412761.1.79077 WP_003412761.1.79095 WP_003412761.1.79112 WP_003412761.1.79122 WP_003412761.1.79145 WP_003412761.1.79152 WP_003412761.1.79163 WP_003412761.1.79182 WP_003412761.1.79198 WP_003412761.1.79213 WP_003412761.1.79218 WP_003412761.1.79268 WP_003412761.1.79273 WP_003412761.1.79278 WP_003412761.1.79290 WP_003412761.1.79319 WP_003412761.1.79325 WP_003412761.1.79326 WP_003412761.1.7933 WP_003412761.1.79330 WP_003412761.1.79339 WP_003412761.1.79394 WP_003412761.1.79399 WP_003412761.1.79413 WP_003412761.1.79422 WP_003412761.1.79445 WP_003412761.1.79447 WP_003412761.1.79455 WP_003412761.1.79471 WP_003412761.1.79480 WP_003412761.1.79482 WP_003412761.1.79488 WP_003412761.1.79500 WP_003412761.1.79502 WP_003412761.1.79508 WP_003412761.1.79514 WP_003412761.1.79561 WP_003412761.1.79565 WP_003412761.1.79578 WP_003412761.1.79588 WP_003412761.1.79598 WP_003412761.1.79615 WP_003412761.1.79684 WP_003412761.1.79698 WP_003412761.1.797 WP_003412761.1.79744 WP_003412761.1.79784 WP_003412761.1.79802 WP_003412761.1.79806 WP_003412761.1.79819 WP_003412761.1.79826 WP_003412761.1.79828 WP_003412761.1.79851 WP_003412761.1.79853 WP_003412761.1.79863 WP_003412761.1.79881 WP_003412761.1.79885 WP_003412761.1.79898 WP_003412761.1.7990 WP_003412761.1.79900 WP_003412761.1.79913 WP_003412761.1.79918 WP_003412761.1.79947 WP_003412761.1.79948 WP_003412761.1.7995 WP_003412761.1.7997 WP_003412761.1.80004 WP_003412761.1.80015 WP_003412761.1.80022 WP_003412761.1.80030 WP_003412761.1.80054 WP_003412761.1.80084 WP_003412761.1.80099 WP_003412761.1.80129 WP_003412761.1.80177 WP_003412761.1.80234 WP_003412761.1.8026 WP_003412761.1.80275 WP_003412761.1.8029 WP_003412761.1.80299 WP_003412761.1.80300 WP_003412761.1.80304 WP_003412761.1.80326 WP_003412761.1.80351 WP_003412761.1.8037 WP_003412761.1.80370 WP_003412761.1.8044 WP_003412761.1.80451 WP_003412761.1.80458 WP_003412761.1.80461 WP_003412761.1.80490 WP_003412761.1.80503 WP_003412761.1.80507 WP_003412761.1.80552 WP_003412761.1.80576 WP_003412761.1.80588 WP_003412761.1.80599 WP_003412761.1.8060 WP_003412761.1.80624 WP_003412761.1.80636 WP_003412761.1.80669 WP_003412761.1.80673 WP_003412761.1.80711 WP_003412761.1.80714 WP_003412761.1.80743 WP_003412761.1.80784 WP_003412761.1.80815 WP_003412761.1.80853 WP_003412761.1.80918 WP_003412761.1.8093 WP_003412761.1.80967 WP_003412761.1.8097 WP_003412761.1.80988 WP_003412761.1.81007 WP_003412761.1.81013 WP_003412761.1.8105 WP_003412761.1.81059 WP_003412761.1.81063 WP_003412761.1.81066 WP_003412761.1.81075 WP_003412761.1.81091 WP_003412761.1.81119 WP_003412761.1.81125 WP_003412761.1.81136 WP_003412761.1.8114 WP_003412761.1.81189 WP_003412761.1.81192 WP_003412761.1.812 WP_003412761.1.81230 WP_003412761.1.81249 WP_003412761.1.81250 WP_003412761.1.81264 WP_003412761.1.8128 WP_003412761.1.81287 WP_003412761.1.81297 WP_003412761.1.8138 WP_003412761.1.81407 WP_003412761.1.8143 WP_003412761.1.81439 WP_003412761.1.81465 WP_003412761.1.81505 WP_003412761.1.81529 WP_003412761.1.81538 WP_003412761.1.81541 WP_003412761.1.81560 WP_003412761.1.81561 WP_003412761.1.81567 WP_003412761.1.81583 WP_003412761.1.81686 WP_003412761.1.81712 WP_003412761.1.81720 WP_003412761.1.81731 WP_003412761.1.81774 WP_003412761.1.81788 WP_003412761.1.81809 WP_003412761.1.81820 WP_003412761.1.81850 WP_003412761.1.81883 WP_003412761.1.81891 WP_003412761.1.81911 WP_003412761.1.81918 WP_003412761.1.82011 WP_003412761.1.82048 WP_003412761.1.82069 WP_003412761.1.82071 WP_003412761.1.82108 WP_003412761.1.82136 WP_003412761.1.8215 WP_003412761.1.82158 WP_003412761.1.8217 WP_003412761.1.82209 WP_003412761.1.82210 WP_003412761.1.82228 WP_003412761.1.82236 WP_003412761.1.82251 WP_003412761.1.82271 WP_003412761.1.82305 WP_003412761.1.82307 WP_003412761.1.82309 WP_003412761.1.82317 WP_003412761.1.8232 WP_003412761.1.82346 WP_003412761.1.82374 WP_003412761.1.82385 WP_003412761.1.82429 WP_003412761.1.82460 WP_003412761.1.82462 WP_003412761.1.82483 WP_003412761.1.82494 WP_003412761.1.82531 WP_003412761.1.82546 WP_003412761.1.82547 WP_003412761.1.82549 WP_003412761.1.82577 WP_003412761.1.82592 WP_003412761.1.82597 WP_003412761.1.82598 WP_003412761.1.82625 WP_003412761.1.82642 WP_003412761.1.82651 WP_003412761.1.82653 WP_003412761.1.82681 WP_003412761.1.82685 WP_003412761.1.8271 WP_003412761.1.82712 WP_003412761.1.8273 WP_003412761.1.82743 WP_003412761.1.82757 WP_003412761.1.82774 WP_003412761.1.82803 WP_003412761.1.82860 WP_003412761.1.82871 WP_003412761.1.82892 WP_003412761.1.82935 WP_003412761.1.82957 WP_003412761.1.82973 WP_003412761.1.82981 WP_003412761.1.82983 WP_003412761.1.83004 WP_003412761.1.83009 WP_003412761.1.83044 WP_003412761.1.83065 WP_003412761.1.83074 WP_003412761.1.83110 WP_003412761.1.83146 WP_003412761.1.83149 WP_003412761.1.83159 WP_003412761.1.8317 WP_003412761.1.83173 WP_003412761.1.83181 WP_003412761.1.83182 WP_003412761.1.83191 WP_003412761.1.83197 WP_003412761.1.83212 WP_003412761.1.8326 WP_003412761.1.83262 WP_003412761.1.83268 WP_003412761.1.83273 WP_003412761.1.83309 WP_003412761.1.83332 WP_003412761.1.83334 WP_003412761.1.83341 WP_003412761.1.83349 WP_003412761.1.8335 WP_003412761.1.83353 WP_003412761.1.83367 WP_003412761.1.83381 WP_003412761.1.83408 WP_003412761.1.83409 WP_003412761.1.83435 WP_003412761.1.83470 WP_003412761.1.83524 WP_003412761.1.83526 WP_003412761.1.8358 WP_003412761.1.83589 WP_003412761.1.83601 WP_003412761.1.83611 WP_003412761.1.83638 WP_003412761.1.83648 WP_003412761.1.83656 WP_003412761.1.83667 WP_003412761.1.83689 WP_003412761.1.83692 WP_003412761.1.83704 WP_003412761.1.83705 WP_003412761.1.83766 WP_003412761.1.83793 WP_003412761.1.83794 WP_003412761.1.83802 WP_003412761.1.83805 WP_003412761.1.83839 WP_003412761.1.83842 WP_003412761.1.83850 WP_003412761.1.83861 WP_003412761.1.83884 WP_003412761.1.83920 WP_003412761.1.83929 WP_003412761.1.83930 WP_003412761.1.83975 WP_003412761.1.83991 WP_003412761.1.8400 WP_003412761.1.84027 WP_003412761.1.8404 WP_003412761.1.84057 WP_003412761.1.84070 WP_003412761.1.8409 WP_003412761.1.84112 WP_003412761.1.84146 WP_003412761.1.8415 WP_003412761.1.84176 WP_003412761.1.84186 WP_003412761.1.84192 WP_003412761.1.84228 WP_003412761.1.8424 WP_003412761.1.84244 WP_003412761.1.84259 WP_003412761.1.8426 WP_003412761.1.84277 WP_003412761.1.84287 WP_003412761.1.8434 WP_003412761.1.84388 WP_003412761.1.84408 WP_003412761.1.84409 WP_003412761.1.84438 WP_003412761.1.84460 WP_003412761.1.84488 WP_003412761.1.84504 WP_003412761.1.84525 WP_003412761.1.84620 WP_003412761.1.84623 WP_003412761.1.84641 WP_003412761.1.84655 WP_003412761.1.84666 WP_003412761.1.84670 WP_003412761.1.84739 WP_003412761.1.84748 WP_003412761.1.84766 WP_003412761.1.84772 WP_003412761.1.84774 WP_003412761.1.848 WP_003412761.1.84812 WP_003412761.1.84836 WP_003412761.1.84839 WP_003412761.1.84846 WP_003412761.1.84873 WP_003412761.1.84911 WP_003412761.1.84938 WP_003412761.1.84968 WP_003412761.1.84973 WP_003412761.1.84981 WP_003412761.1.84985 WP_003412761.1.8503 WP_003412761.1.85038 WP_003412761.1.85041 WP_003412761.1.85043 WP_003412761.1.8505 WP_003412761.1.85074 WP_003412761.1.8509 WP_003412761.1.8512 WP_003412761.1.85148 WP_003412761.1.8518 WP_003412761.1.8522 WP_003412761.1.85242 WP_003412761.1.85276 WP_003412761.1.85281 WP_003412761.1.85284 WP_003412761.1.85314 WP_003412761.1.85319 WP_003412761.1.85330 WP_003412761.1.85341 WP_003412761.1.85346 WP_003412761.1.8535 WP_003412761.1.85363 WP_003412761.1.85371 WP_003412761.1.85377 WP_003412761.1.85387 WP_003412761.1.85399 WP_003412761.1.85458 WP_003412761.1.8546 WP_003412761.1.85464 WP_003412761.1.85478 WP_003412761.1.85480 WP_003412761.1.85488 WP_003412761.1.85495 WP_003412761.1.85551 WP_003412761.1.85557 WP_003412761.1.85577 WP_003412761.1.85597 WP_003412761.1.85599 WP_003412761.1.85610 WP_003412761.1.8563 WP_003412761.1.85648 WP_003412761.1.85679 WP_003412761.1.85704 WP_003412761.1.85717 WP_003412761.1.85737 WP_003412761.1.85763 WP_003412761.1.85808 WP_003412761.1.85819 WP_003412761.1.85820 WP_003412761.1.85823 WP_003412761.1.85832 WP_003412761.1.8586 WP_003412761.1.85872 WP_003412761.1.85894 WP_003412761.1.85909 WP_003412761.1.85913 WP_003412761.1.85953 WP_003412761.1.85986 WP_003412761.1.86000 WP_003412761.1.86024 WP_003412761.1.86025 WP_003412761.1.86032 WP_003412761.1.86048 WP_003412761.1.86052 WP_003412761.1.86067 WP_003412761.1.86103 WP_003412761.1.86122 WP_003412761.1.86124 WP_003412761.1.86160 WP_003412761.1.86164 WP_003412761.1.86168 WP_003412761.1.86190 WP_003412761.1.86204 WP_003412761.1.86208 WP_003412761.1.86235 WP_003412761.1.86249 WP_003412761.1.86260 WP_003412761.1.86290 WP_003412761.1.863 WP_003412761.1.86327 WP_003412761.1.86334 WP_003412761.1.86337 WP_003412761.1.86368 WP_003412761.1.86377 WP_003412761.1.86425 WP_003412761.1.86459 WP_003412761.1.8649 WP_003412761.1.86499 WP_003412761.1.86520 WP_003412761.1.86561 WP_003412761.1.86568 WP_003412761.1.86575 WP_003412761.1.86584 WP_003412761.1.86605 WP_003412761.1.86626 WP_003412761.1.86648 WP_003412761.1.8666 WP_003412761.1.86684 WP_003412761.1.86696 WP_003412761.1.86705 WP_003412761.1.86718 WP_003412761.1.86725 WP_003412761.1.86757 WP_003412761.1.86766 WP_003412761.1.86801 WP_003412761.1.86814 WP_003412761.1.86820 WP_003412761.1.86825 WP_003412761.1.86834 WP_003412761.1.8685 WP_003412761.1.86851 WP_003412761.1.86855 WP_003412761.1.86867 WP_003412761.1.86877 WP_003412761.1.86883 WP_003412761.1.8689 WP_003412761.1.86892 WP_003412761.1.86933 WP_003412761.1.86941 WP_003412761.1.86950 WP_003412761.1.86962 WP_003412761.1.86963 WP_003412761.1.86979 WP_003412761.1.8700 WP_003412761.1.87001 WP_003412761.1.87002 WP_003412761.1.87031 WP_003412761.1.87116 WP_003412761.1.87117 WP_003412761.1.8714 WP_003412761.1.87162 WP_003412761.1.87178 WP_003412761.1.87191 WP_003412761.1.87201 WP_003412761.1.87209 WP_003412761.1.87240 WP_003412761.1.87266 WP_003412761.1.87273 WP_003412761.1.87275 WP_003412761.1.8733 WP_003412761.1.87345 WP_003412761.1.87369 WP_003412761.1.8737 WP_003412761.1.87401 WP_003412761.1.87404 WP_003412761.1.87406 WP_003412761.1.87409 WP_003412761.1.87444 WP_003412761.1.87446 WP_003412761.1.87459 WP_003412761.1.87472 WP_003412761.1.87489 WP_003412761.1.87494 WP_003412761.1.87496 WP_003412761.1.87582 WP_003412761.1.87588 WP_003412761.1.87617 WP_003412761.1.87619 WP_003412761.1.87620 WP_003412761.1.87634 WP_003412761.1.87643 WP_003412761.1.8765 WP_003412761.1.87650 WP_003412761.1.87654 WP_003412761.1.87658 WP_003412761.1.87665 WP_003412761.1.87676 WP_003412761.1.87677 WP_003412761.1.87684 WP_003412761.1.87692 WP_003412761.1.87707 WP_003412761.1.87732 WP_003412761.1.87784 WP_003412761.1.87796 WP_003412761.1.87809 WP_003412761.1.87817 WP_003412761.1.87827 WP_003412761.1.87831 WP_003412761.1.87835 WP_003412761.1.87837 WP_003412761.1.87866 WP_003412761.1.8789 WP_003412761.1.87911 WP_003412761.1.87924 WP_003412761.1.87951 WP_003412761.1.87955 WP_003412761.1.87956 WP_003412761.1.87991 WP_003412761.1.88 WP_003412761.1.88002 WP_003412761.1.88037 WP_003412761.1.88039 WP_003412761.1.88072 WP_003412761.1.88077 WP_003412761.1.88121 WP_003412761.1.88180 WP_003412761.1.88191 WP_003412761.1.88205 WP_003412761.1.88217 WP_003412761.1.88219 WP_003412761.1.88245 WP_003412761.1.88253 WP_003412761.1.88294 WP_003412761.1.88315 WP_003412761.1.88316 WP_003412761.1.88320 WP_003412761.1.88338 WP_003412761.1.8840 WP_003412761.1.88437 WP_003412761.1.88453 WP_003412761.1.88469 WP_003412761.1.88489 WP_003412761.1.88507 WP_003412761.1.88521 WP_003412761.1.88530 WP_003412761.1.88537 WP_003412761.1.88541 WP_003412761.1.88592 WP_003412761.1.88616 WP_003412761.1.88618 WP_003412761.1.8862 WP_003412761.1.88625 WP_003412761.1.88632 WP_003412761.1.88634 WP_003412761.1.88649 WP_003412761.1.8870 WP_003412761.1.88737 WP_003412761.1.88756 WP_003412761.1.888 WP_003412761.1.88824 WP_003412761.1.88886 WP_003412761.1.88965 WP_003412761.1.88985 WP_003412761.1.8902 WP_003412761.1.89025 WP_003412761.1.89041 WP_003412761.1.89046 WP_003412761.1.89082 WP_003412761.1.89162 WP_003412761.1.8917 WP_003412761.1.89193 WP_003412761.1.89205 WP_003412761.1.89207 WP_003412761.1.89225 WP_003412761.1.8925 WP_003412761.1.89277 WP_003412761.1.89286 WP_003412761.1.89293 WP_003412761.1.89320 WP_003412761.1.8935 WP_003412761.1.89371 WP_003412761.1.89378 WP_003412761.1.89392 WP_003412761.1.89406 WP_003412761.1.8943 WP_003412761.1.89451 WP_003412761.1.89453 WP_003412761.1.89473 WP_003412761.1.89475 WP_003412761.1.89483 WP_003412761.1.895 WP_003412761.1.89513 WP_003412761.1.89517 WP_003412761.1.89522 WP_003412761.1.8954 WP_003412761.1.89543 WP_003412761.1.89567 WP_003412761.1.8957 WP_003412761.1.89572 WP_003412761.1.89589 WP_003412761.1.89607 WP_003412761.1.89613 WP_003412761.1.89625 WP_003412761.1.89648 WP_003412761.1.8967 WP_003412761.1.89670 WP_003412761.1.89676 WP_003412761.1.89729 WP_003412761.1.89739 WP_003412761.1.89762 WP_003412761.1.8977 WP_003412761.1.89802 WP_003412761.1.89808 WP_003412761.1.8982 WP_003412761.1.89829 WP_003412761.1.89831 WP_003412761.1.89844 WP_003412761.1.89849 WP_003412761.1.8989 WP_003412761.1.89901 WP_003412761.1.89903 WP_003412761.1.89909 WP_003412761.1.89922 WP_003412761.1.89926 WP_003412761.1.89963 WP_003412761.1.89971 WP_003412761.1.8998 WP_003412761.1.89987 WP_003412761.1.900 WP_003412761.1.90048 WP_003412761.1.9007 WP_003412761.1.90080 WP_003412761.1.90130 WP_003412761.1.90134 WP_003412761.1.90137 WP_003412761.1.90157 WP_003412761.1.90184 WP_003412761.1.90199 WP_003412761.1.90231 WP_003412761.1.90245 WP_003412761.1.90308 WP_003412761.1.90322 WP_003412761.1.90328 WP_003412761.1.90372 WP_003412761.1.90439 WP_003412761.1.90481 WP_003412761.1.90499 WP_003412761.1.9050 WP_003412761.1.90527 WP_003412761.1.90550 WP_003412761.1.90560 WP_003412761.1.90612 WP_003412761.1.90640 WP_003412761.1.90672 WP_003412761.1.90687 WP_003412761.1.90691 WP_003412761.1.90711 WP_003412761.1.90722 WP_003412761.1.90744 WP_003412761.1.9075 WP_003412761.1.90756 WP_003412761.1.90767 WP_003412761.1.90771 WP_003412761.1.90785 WP_003412761.1.90788 WP_003412761.1.90800 WP_003412761.1.90816 WP_003412761.1.90819 WP_003412761.1.9082 WP_003412761.1.90884 WP_003412761.1.90899 WP_003412761.1.90906 WP_003412761.1.90958 WP_003412761.1.90976 WP_003412761.1.90977 WP_003412761.1.90987 WP_003412761.1.9102 WP_003412761.1.91026 WP_003412761.1.91032 WP_003412761.1.91043 WP_003412761.1.91053 WP_003412761.1.91082 WP_003412761.1.91106 WP_003412761.1.91112 WP_003412761.1.91144 WP_003412761.1.91151 WP_003412761.1.91157 WP_003412761.1.91167 WP_003412761.1.91169 WP_003412761.1.91192 WP_003412761.1.91201 WP_003412761.1.91207 WP_003412761.1.91208 WP_003412761.1.91211 WP_003412761.1.91214 WP_003412761.1.91230 WP_003412761.1.91244 WP_003412761.1.91251 WP_003412761.1.91260 WP_003412761.1.91265 WP_003412761.1.9128 WP_003412761.1.91284 WP_003412761.1.91294 WP_003412761.1.91303 WP_003412761.1.91322 WP_003412761.1.91352 WP_003412761.1.91386 WP_003412761.1.9139 WP_003412761.1.91398 WP_003412761.1.91411 WP_003412761.1.91430 WP_003412761.1.91436 WP_003412761.1.91496 WP_003412761.1.91507 WP_003412761.1.91508 WP_003412761.1.91576 WP_003412761.1.91589 WP_003412761.1.91694 WP_003412761.1.91713 WP_003412761.1.91716 WP_003412761.1.91717 WP_003412761.1.91728 WP_003412761.1.91743 WP_003412761.1.91759 WP_003412761.1.91784 WP_003412761.1.91785 WP_003412761.1.91786 WP_003412761.1.91802 WP_003412761.1.91822 WP_003412761.1.91828 WP_003412761.1.9189 WP_003412761.1.91896 WP_003412761.1.9190 WP_003412761.1.91915 WP_003412761.1.91931 WP_003412761.1.91937 WP_003412761.1.91944 WP_003412761.1.91953 WP_003412761.1.91957 WP_003412761.1.91976 WP_003412761.1.91978 WP_003412761.1.92021 WP_003412761.1.92083 WP_003412761.1.92127 WP_003412761.1.92144 WP_003412761.1.92150 WP_003412761.1.92153 WP_003412761.1.92190 WP_003412761.1.92192 WP_003412761.1.92200 WP_003412761.1.92220 WP_003412761.1.92221 WP_003412761.1.92222 WP_003412761.1.92273 WP_003412761.1.92289 WP_003412761.1.9229 WP_003412761.1.92294 WP_003412761.1.92300 WP_003412761.1.92317 WP_003412761.1.92334 WP_003412761.1.92338 WP_003412761.1.92345 WP_003412761.1.92356 WP_003412761.1.92364 WP_003412761.1.92380 WP_003412761.1.92416 WP_003412761.1.92428 WP_003412761.1.92447 WP_003412761.1.92456 WP_003412761.1.92467 WP_003412761.1.92471 WP_003412761.1.92490 WP_003412761.1.92508 WP_003412761.1.9251 WP_003412761.1.92511 WP_003412761.1.92523 WP_003412761.1.92527 WP_003412761.1.92592 WP_003412761.1.92597 WP_003412761.1.92603 WP_003412761.1.92606 WP_003412761.1.92610 WP_003412761.1.92613 WP_003412761.1.9263 WP_003412761.1.9265 WP_003412761.1.92650 WP_003412761.1.92660 WP_003412761.1.92677 WP_003412761.1.92685 WP_003412761.1.92689 WP_003412761.1.92690 WP_003412761.1.92706 WP_003412761.1.92714 WP_003412761.1.92736 WP_003412761.1.9274 WP_003412761.1.92752 WP_003412761.1.92760 WP_003412761.1.92777 WP_003412761.1.92803 WP_003412761.1.92833 WP_003412761.1.92856 WP_003412761.1.92881 WP_003412761.1.92892 WP_003412761.1.92907 WP_003412761.1.92908 WP_003412761.1.9291 WP_003412761.1.92917 WP_003412761.1.92996 WP_003412761.1.93006 WP_003412761.1.93008 WP_003412761.1.93009 WP_003412761.1.93015 WP_003412761.1.93043 WP_003412761.1.9307 WP_003412761.1.93083 WP_003412761.1.93097 WP_003412761.1.93137 WP_003412761.1.93192 WP_003412761.1.93199 WP_003412761.1.93203 WP_003412761.1.93212 WP_003412761.1.93234 WP_003412761.1.93245 WP_003412761.1.93257 WP_003412761.1.93265 WP_003412761.1.93297 WP_003412761.1.93320 WP_003412761.1.93328 WP_003412761.1.93337 WP_003412761.1.93343 WP_003412761.1.93349 WP_003412761.1.93363 WP_003412761.1.93377 WP_003412761.1.9338 WP_003412761.1.93407 WP_003412761.1.93417 WP_003412761.1.93419 WP_003412761.1.93426 WP_003412761.1.9344 WP_003412761.1.93443 WP_003412761.1.93447 WP_003412761.1.93470 WP_003412761.1.93483 WP_003412761.1.93487 WP_003412761.1.93495 WP_003412761.1.93499 WP_003412761.1.93516 WP_003412761.1.93536 WP_003412761.1.93544 WP_003412761.1.93555 WP_003412761.1.93560 WP_003412761.1.93564 WP_003412761.1.9357 WP_003412761.1.93573 WP_003412761.1.93576 WP_003412761.1.93588 WP_003412761.1.9363 WP_003412761.1.93645 WP_003412761.1.93649 WP_003412761.1.93659 WP_003412761.1.93677 WP_003412761.1.9368 WP_003412761.1.93689 WP_003412761.1.93693 WP_003412761.1.93698 WP_003412761.1.93706 WP_003412761.1.9371 WP_003412761.1.93792 WP_003412761.1.93823 WP_003412761.1.93871 WP_003412761.1.9388 WP_003412761.1.93894 WP_003412761.1.93903 WP_003412761.1.93907 WP_003412761.1.93913 WP_003412761.1.93946 WP_003412761.1.93950 WP_003412761.1.93953 WP_003412761.1.93954 WP_003412761.1.93988 WP_003412761.1.9407 WP_003412761.1.94143 WP_003412761.1.94154 WP_003412761.1.94184 WP_003412761.1.94204 WP_003412761.1.94205 WP_003412761.1.94226 WP_003412761.1.94231 WP_003412761.1.94256 WP_003412761.1.94261 WP_003412761.1.94281 WP_003412761.1.94292 WP_003412761.1.94297 WP_003412761.1.9431 WP_003412761.1.94326 WP_003412761.1.94339 WP_003412761.1.94392 WP_003412761.1.94421 WP_003412761.1.94456 WP_003412761.1.94470 WP_003412761.1.94480 WP_003412761.1.94495 WP_003412761.1.94511 WP_003412761.1.94512 WP_003412761.1.94525 WP_003412761.1.94528 WP_003412761.1.94564 WP_003412761.1.946 WP_003412761.1.94602 WP_003412761.1.94623 WP_003412761.1.94629 WP_003412761.1.9465 WP_003412761.1.94673 WP_003412761.1.94714 WP_003412761.1.94736 WP_003412761.1.94776 WP_003412761.1.9478 WP_003412761.1.94834 WP_003412761.1.94852 WP_003412761.1.94872 WP_003412761.1.94902 WP_003412761.1.94916 WP_003412761.1.94979 WP_003412761.1.94994 WP_003412761.1.94996 WP_003412761.1.94998 WP_003412761.1.95007 WP_003412761.1.95010 WP_003412761.1.95015 WP_003412761.1.95034 WP_003412761.1.95068 WP_003412761.1.95081 WP_003412761.1.95082 WP_003412761.1.9509 WP_003412761.1.95096 WP_003412761.1.95112 WP_003412761.1.95138 WP_003412761.1.9514 WP_003412761.1.95179 WP_003412761.1.95188 WP_003412761.1.95190 WP_003412761.1.95241 WP_003412761.1.95245 WP_003412761.1.95257 WP_003412761.1.95279 WP_003412761.1.9531 WP_003412761.1.95335 WP_003412761.1.95344 WP_003412761.1.9535 WP_003412761.1.95370 WP_003412761.1.95392 WP_003412761.1.95416 WP_003412761.1.95417 WP_003412761.1.95454 WP_003412761.1.95455 WP_003412761.1.95491 WP_003412761.1.95497 WP_003412761.1.95508 WP_003412761.1.95509 WP_003412761.1.95529 WP_003412761.1.95556 WP_003412761.1.95557 WP_003412761.1.95565 WP_003412761.1.95578 WP_003412761.1.95580 WP_003412761.1.95585 WP_003412761.1.95643 WP_003412761.1.95679 WP_003412761.1.95685 WP_003412761.1.957 WP_003412761.1.95724 WP_003412761.1.95727 WP_003412761.1.95730 WP_003412761.1.95735 WP_003412761.1.95758 WP_003412761.1.95772 WP_003412761.1.95797 WP_003412761.1.95839 WP_003412761.1.9585 WP_003412761.1.9590 WP_003412761.1.95902 WP_003412761.1.95908 WP_003412761.1.95924 WP_003412761.1.95926 WP_003412761.1.95953 WP_003412761.1.95958 WP_003412761.1.95964 WP_003412761.1.95973 WP_003412761.1.96006 WP_003412761.1.9602 WP_003412761.1.96036 WP_003412761.1.96062 WP_003412761.1.96065 WP_003412761.1.96098 WP_003412761.1.96146 WP_003412761.1.96166 WP_003412761.1.96171 WP_003412761.1.96182 WP_003412761.1.96204 WP_003412761.1.96230 WP_003412761.1.96235 WP_003412761.1.96242 WP_003412761.1.96245 WP_003412761.1.96254 WP_003412761.1.96259 WP_003412761.1.96286 WP_003412761.1.96313 WP_003412761.1.96318 WP_003412761.1.96345 WP_003412761.1.96360 WP_003412761.1.96373 WP_003412761.1.96456 WP_003412761.1.96486 WP_003412761.1.96560 WP_003412761.1.96569 WP_003412761.1.96573 WP_003412761.1.96575 WP_003412761.1.96576 WP_003412761.1.96611 WP_003412761.1.96621 WP_003412761.1.9667 WP_003412761.1.96681 WP_003412761.1.96726 WP_003412761.1.96733 WP_003412761.1.96742 WP_003412761.1.96754 WP_003412761.1.9678 WP_003412761.1.9685 WP_003412761.1.97008 WP_003412761.1.97009 WP_003412761.1.97056 WP_003412761.1.97084 WP_003412761.1.97087 WP_003412761.1.97094 WP_003412761.1.97096 WP_003412761.1.97099 WP_003412761.1.97108 WP_003412761.1.97113 WP_003412761.1.97122 WP_003412761.1.97127 WP_003412761.1.97129 WP_003412761.1.97136 WP_003412761.1.9716 WP_003412761.1.97176 WP_003412761.1.97222 WP_003412761.1.97223 WP_003412761.1.97237 WP_003412761.1.97242 WP_003412761.1.97270 WP_003412761.1.97283 WP_003412761.1.97296 WP_003412761.1.97321 WP_003412761.1.97325 WP_003412761.1.97330 WP_003412761.1.97366 WP_003412761.1.97376 WP_003412761.1.97380 WP_003412761.1.9739 WP_003412761.1.97462 WP_003412761.1.97517 WP_003412761.1.97519 WP_003412761.1.97535 WP_003412761.1.97540 WP_003412761.1.97545 WP_003412761.1.97546 WP_003412761.1.97550 WP_003412761.1.97568 WP_003412761.1.97577 WP_003412761.1.97584 WP_003412761.1.9759 WP_003412761.1.97591 WP_003412761.1.97596 WP_003412761.1.97609 WP_003412761.1.97618 WP_003412761.1.9763 WP_003412761.1.97669 WP_003412761.1.97673 WP_003412761.1.97700 WP_003412761.1.97701 WP_003412761.1.9773 WP_003412761.1.97730 WP_003412761.1.97740 WP_003412761.1.97751 WP_003412761.1.97754 WP_003412761.1.97797 WP_003412761.1.9782 WP_003412761.1.9784 WP_003412761.1.97888 WP_003412761.1.9795 WP_003412761.1.97951 WP_003412761.1.97958 WP_003412761.1.97966 WP_003412761.1.97977 WP_003412761.1.97979 WP_003412761.1.97995 WP_003412761.1.98018 WP_003412761.1.98034 WP_003412761.1.98052 WP_003412761.1.98071 WP_003412761.1.98072 WP_003412761.1.98113 WP_003412761.1.98114 WP_003412761.1.98128 WP_003412761.1.98181 WP_003412761.1.98188 WP_003412761.1.98189 WP_003412761.1.98213 WP_003412761.1.98225 WP_003412761.1.98291 WP_003412761.1.98335 WP_003412761.1.98350 WP_003412761.1.98395 WP_003412761.1.98412 WP_003412761.1.98441 WP_003412761.1.98443 WP_003412761.1.98462 WP_003412761.1.9848 WP_003412761.1.98482 WP_003412761.1.98486 WP_003412761.1.98488 WP_003412761.1.98503 WP_003412761.1.98516 WP_003412761.1.98524 WP_003412761.1.98536 WP_003412761.1.98541 WP_003412761.1.98566 WP_003412761.1.98576 WP_003412761.1.98590 WP_003412761.1.98594 WP_003412761.1.98599 WP_003412761.1.98629 WP_003412761.1.98645 WP_003412761.1.98646 WP_003412761.1.98649 WP_003412761.1.98656 WP_003412761.1.9867 WP_003412761.1.98674 WP_003412761.1.98697 WP_003412761.1.98701 WP_003412761.1.98739 WP_003412761.1.98749 WP_003412761.1.98765 WP_003412761.1.98770 WP_003412761.1.98777 WP_003412761.1.98778 WP_003412761.1.98802 WP_003412761.1.98838 WP_003412761.1.98850 WP_003412761.1.98906 WP_003412761.1.98935 WP_003412761.1.98948 WP_003412761.1.98953 WP_003412761.1.98984 WP_003412761.1.99000 WP_003412761.1.99023 WP_003412761.1.99030 WP_003412761.1.99037 WP_003412761.1.99055 WP_003412761.1.99062 WP_003412761.1.99086 WP_003412761.1.99115 WP_003412761.1.99117 WP_003412761.1.99161 WP_003412761.1.99176 WP_003412761.1.99205 WP_003412761.1.99211 WP_003412761.1.99216 WP_003412761.1.99222 WP_003412761.1.99251 WP_003412761.1.99269 WP_003412761.1.99294 WP_003412761.1.99312 WP_003412761.1.99315 WP_003412761.1.99316 WP_003412761.1.99322 WP_003412761.1.99328 WP_003412761.1.99365 WP_003412761.1.99368 WP_003412761.1.99379 WP_003412761.1.99396 WP_003412761.1.99402 WP_003412761.1.99404 WP_003412761.1.99419 WP_003412761.1.99438 WP_003412761.1.99460 WP_003412761.1.99468 WP_003412761.1.99473 WP_003412761.1.99513 WP_003412761.1.99529 WP_003412761.1.99548 WP_003412761.1.99572 WP_003412761.1.99575 WP_003412761.1.99578 WP_003412761.1.99605 WP_003412761.1.99609 WP_003412761.1.99617 WP_003412761.1.99635 WP_003412761.1.99650 WP_003412761.1.99672 WP_003412761.1.99701 WP_003412761.1.99711 WP_003412761.1.99716 WP_003412761.1.99740 WP_003412761.1.99745 WP_003412761.1.99749 WP_003412761.1.9976 WP_003412761.1.99798 WP_003412761.1.99817 WP_003412761.1.99832 WP_003412761.1.99847 WP_003412761.1.99852 WP_003412761.1.99886 WP_003412761.1.99897 WP_003412761.1.99899 WP_003412761.1.99915 WP_003412761.1.9993 WP_003412761.1.99982 WP_003412761.1.99991 gi|383308273|ref|YP_005361084.1| gi|15609634|ref|NP_217013.1| gi|449064570|ref|YP_007431653.1| gi|392431893|ref|YP_006472937.1| gi|148823694|ref|YP_001288448.1| gi|479056459|ref|YP_007352265.1| gi|121638379|ref|YP_978603.1| gi|375295686|ref|YP_005099953.1| gi|340627511|ref|YP_004745963.1| gi|31793677|ref|NP_856170.1| gi|253798423|ref|YP_003031424.1| gi|15609634|ref|NP_217013.1| gi|15842025|ref|NP_337062.1| gi|392387135|ref|YP_005308764.1| gi|433642695|ref|YP_007288454.1| gi|224990873|ref|YP_002645560.1| gi|386005401|ref|YP_005923680.1| gi|339632523|ref|YP_004724165.1| gi|148662333|ref|YP_001283856.1| gi|506927031|ref|YP_008007481.1| gi|494700934|ref|YP_007966416.1| gi|433627632|ref|YP_007261261.1| gi|525675060|ref|YP_008226587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]