SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378772412|ref|YP_005172145.1| from Mycobacterium bovis BCG str. Mexico

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378772412|ref|YP_005172145.1|
Domain Number 1 Region: 18-193,238-361
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.93e-67
Family TK-like PP module 0.02
Further Details:      
 
Domain Number 2 Region: 291-476
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.25e-54
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.086
Further Details:      
 
Domain Number 3 Region: 501-619
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.5e-22
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378772412|ref|YP_005172145.1|
Sequence length 638
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Mycobacterium bovis BCG str. Mexico]
Sequence
MLQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDS
PHDPIIFDTGHQAYVHKMLTGRSQDFATLRKKGGLSGYPSRAESEHDWVESSHASAALSY
ADGLAKAFELTGHRNRHVVAVVGDGALTGGMCWEALNNIAASRRPVIIVVNDNGRSYAPT
IGGVADHLATLRLQPAYEQALETGRDLVRAVPLVGGLWFRFLHSVKAGIKDSLSPQLLFT
DLGLKYVGPVDGHDERAVEVALRSARRFGAPVIVHVVTRKGMGYPPAEADQAEQMHSTVP
IDPATGQATKVAGPGWTATFSDALIGYAQKRRDIVAITAAMPGPTGLTAFGQRFPDRLFD
VGIAEQHAMTSAAGLAMGGLHPVVAIYSTFLNRAFDQIMMDVALHKLPVTMVLDRAGITG
SDGASHNGMWDLSMLGIVPGIRVAAPRDATRLREELGEALDVDDGPTALRFPKGDVGEDI
SALERRGGVDVLAAPADGLNHDVLLVAIGAFAPMALAVAKRLHNQGIGVTVIDPRWVLPV
SDGVRELAVQHKLLVTLEDNGVNGGAGSAVSAALRRAEIDVPCRDVGLPQEFYEHASRSE
VLADLGLTDQDVARRITGWVAALGTGVCASDAIPEHLD
Download sequence
Identical sequences A0A045IIP3 A0A083W158 A0A0H3LCI5 A0A0K2HZU6 A0A109SQC8 A0A197J1N1 A0A1S1BDE4 A1KM20 A5U634 C1AFE1 F8M3D6 I6YE49 M8CBE1 P0A555 P9WNS2 P9WNS3
gi|57117013|ref|YP_177898.1| gi|479056645|ref|YP_007352451.1| MbR84 MytuD.17230.a Rv2682c gi|383308449|ref|YP_005361260.1| gi|375295503|ref|YP_005099770.1| gi|15842220|ref|NP_337257.1| gi|392431711|ref|YP_006472755.1| gi|433642869|ref|YP_007288628.1| gi|385999462|ref|YP_005917761.1| gi|433627799|ref|YP_007261428.1| gi|121638557|ref|YP_978781.1| gi|449064749|ref|YP_007431832.1| gi|148662523|ref|YP_001284046.1| WP_003413891.1.100000 WP_003413891.1.100021 WP_003413891.1.100069 WP_003413891.1.100087 WP_003413891.1.10015 WP_003413891.1.100208 WP_003413891.1.100216 WP_003413891.1.10022 WP_003413891.1.100255 WP_003413891.1.100260 WP_003413891.1.100270 WP_003413891.1.100279 WP_003413891.1.100286 WP_003413891.1.100308 WP_003413891.1.100309 WP_003413891.1.100318 WP_003413891.1.100337 WP_003413891.1.100338 WP_003413891.1.10037 WP_003413891.1.100383 WP_003413891.1.100395 WP_003413891.1.100396 WP_003413891.1.1004 WP_003413891.1.100401 WP_003413891.1.100459 WP_003413891.1.100460 WP_003413891.1.100552 WP_003413891.1.100581 WP_003413891.1.100600 WP_003413891.1.100625 WP_003413891.1.10064 WP_003413891.1.100666 WP_003413891.1.100671 WP_003413891.1.100677 WP_003413891.1.100682 WP_003413891.1.100697 WP_003413891.1.100703 WP_003413891.1.100716 WP_003413891.1.100722 WP_003413891.1.100754 WP_003413891.1.100757 WP_003413891.1.100772 WP_003413891.1.1008 WP_003413891.1.100812 WP_003413891.1.100845 WP_003413891.1.10088 WP_003413891.1.100889 WP_003413891.1.10090 WP_003413891.1.100910 WP_003413891.1.100915 WP_003413891.1.100918 WP_003413891.1.100935 WP_003413891.1.100984 WP_003413891.1.100998 WP_003413891.1.101 WP_003413891.1.101025 WP_003413891.1.101028 WP_003413891.1.10104 WP_003413891.1.101048 WP_003413891.1.101054 WP_003413891.1.101075 WP_003413891.1.101143 WP_003413891.1.101146 WP_003413891.1.10116 WP_003413891.1.10117 WP_003413891.1.101209 WP_003413891.1.10125 WP_003413891.1.101290 WP_003413891.1.101323 WP_003413891.1.101324 WP_003413891.1.101350 WP_003413891.1.101367 WP_003413891.1.101398 WP_003413891.1.101403 WP_003413891.1.101421 WP_003413891.1.10144 WP_003413891.1.101442 WP_003413891.1.10145 WP_003413891.1.101452 WP_003413891.1.101456 WP_003413891.1.101481 WP_003413891.1.101493 WP_003413891.1.101496 WP_003413891.1.101525 WP_003413891.1.101533 WP_003413891.1.101535 WP_003413891.1.101553 WP_003413891.1.101558 WP_003413891.1.10156 WP_003413891.1.101573 WP_003413891.1.101576 WP_003413891.1.10159 WP_003413891.1.101592 WP_003413891.1.101604 WP_003413891.1.101607 WP_003413891.1.101622 WP_003413891.1.101644 WP_003413891.1.101659 WP_003413891.1.101671 WP_003413891.1.101687 WP_003413891.1.10170 WP_003413891.1.101713 WP_003413891.1.101722 WP_003413891.1.101733 WP_003413891.1.101743 WP_003413891.1.101753 WP_003413891.1.101754 WP_003413891.1.101764 WP_003413891.1.101797 WP_003413891.1.101798 WP_003413891.1.101802 WP_003413891.1.101836 WP_003413891.1.101858 WP_003413891.1.101859 WP_003413891.1.101862 WP_003413891.1.101888 WP_003413891.1.101894 WP_003413891.1.101899 WP_003413891.1.1019 WP_003413891.1.101923 WP_003413891.1.101925 WP_003413891.1.10193 WP_003413891.1.101996 WP_003413891.1.102 WP_003413891.1.102008 WP_003413891.1.102017 WP_003413891.1.102053 WP_003413891.1.102055 WP_003413891.1.102063 WP_003413891.1.102099 WP_003413891.1.1021 WP_003413891.1.10211 WP_003413891.1.102119 WP_003413891.1.102121 WP_003413891.1.102143 WP_003413891.1.10224 WP_003413891.1.10253 WP_003413891.1.10262 WP_003413891.1.10277 WP_003413891.1.1033 WP_003413891.1.10350 WP_003413891.1.10362 WP_003413891.1.10366 WP_003413891.1.10376 WP_003413891.1.10396 WP_003413891.1.10410 WP_003413891.1.10414 WP_003413891.1.10421 WP_003413891.1.10430 WP_003413891.1.1044 WP_003413891.1.10440 WP_003413891.1.10445 WP_003413891.1.10471 WP_003413891.1.10472 WP_003413891.1.10489 WP_003413891.1.105 WP_003413891.1.10518 WP_003413891.1.10523 WP_003413891.1.10545 WP_003413891.1.1057 WP_003413891.1.10594 WP_003413891.1.10603 WP_003413891.1.10606 WP_003413891.1.10615 WP_003413891.1.10623 WP_003413891.1.10635 WP_003413891.1.10643 WP_003413891.1.10648 WP_003413891.1.10662 WP_003413891.1.10709 WP_003413891.1.10735 WP_003413891.1.10740 WP_003413891.1.10756 WP_003413891.1.1078 WP_003413891.1.10791 WP_003413891.1.10799 WP_003413891.1.10825 WP_003413891.1.10848 WP_003413891.1.10863 WP_003413891.1.10912 WP_003413891.1.10916 WP_003413891.1.10923 WP_003413891.1.10927 WP_003413891.1.1095 WP_003413891.1.10956 WP_003413891.1.10958 WP_003413891.1.10962 WP_003413891.1.10980 WP_003413891.1.10981 WP_003413891.1.10993 WP_003413891.1.1100 WP_003413891.1.11040 WP_003413891.1.11061 WP_003413891.1.11070 WP_003413891.1.11141 WP_003413891.1.11171 WP_003413891.1.11175 WP_003413891.1.11176 WP_003413891.1.11222 WP_003413891.1.11236 WP_003413891.1.11329 WP_003413891.1.1133 WP_003413891.1.11342 WP_003413891.1.11373 WP_003413891.1.11376 WP_003413891.1.11390 WP_003413891.1.11402 WP_003413891.1.11481 WP_003413891.1.11487 WP_003413891.1.11489 WP_003413891.1.11491 WP_003413891.1.11514 WP_003413891.1.11587 WP_003413891.1.11589 WP_003413891.1.11596 WP_003413891.1.11604 WP_003413891.1.11610 WP_003413891.1.11697 WP_003413891.1.11707 WP_003413891.1.11752 WP_003413891.1.11758 WP_003413891.1.11761 WP_003413891.1.11775 WP_003413891.1.11822 WP_003413891.1.11826 WP_003413891.1.11856 WP_003413891.1.11898 WP_003413891.1.11906 WP_003413891.1.11939 WP_003413891.1.11960 WP_003413891.1.11961 WP_003413891.1.11972 WP_003413891.1.11984 WP_003413891.1.12001 WP_003413891.1.12049 WP_003413891.1.12052 WP_003413891.1.12100 WP_003413891.1.12116 WP_003413891.1.12130 WP_003413891.1.12161 WP_003413891.1.12165 WP_003413891.1.12184 WP_003413891.1.12187 WP_003413891.1.12190 WP_003413891.1.12216 WP_003413891.1.12265 WP_003413891.1.12275 WP_003413891.1.12293 WP_003413891.1.12294 WP_003413891.1.123 WP_003413891.1.1231 WP_003413891.1.12314 WP_003413891.1.12327 WP_003413891.1.12338 WP_003413891.1.1236 WP_003413891.1.12371 WP_003413891.1.12372 WP_003413891.1.12389 WP_003413891.1.12406 WP_003413891.1.1241 WP_003413891.1.12421 WP_003413891.1.12424 WP_003413891.1.12446 WP_003413891.1.12464 WP_003413891.1.12479 WP_003413891.1.12519 WP_003413891.1.12523 WP_003413891.1.12526 WP_003413891.1.1255 WP_003413891.1.12550 WP_003413891.1.12551 WP_003413891.1.12563 WP_003413891.1.12611 WP_003413891.1.12669 WP_003413891.1.1267 WP_003413891.1.12672 WP_003413891.1.12692 WP_003413891.1.1271 WP_003413891.1.12710 WP_003413891.1.12768 WP_003413891.1.1279 WP_003413891.1.12794 WP_003413891.1.12801 WP_003413891.1.12804 WP_003413891.1.12841 WP_003413891.1.12854 WP_003413891.1.12871 WP_003413891.1.12901 WP_003413891.1.12941 WP_003413891.1.12947 WP_003413891.1.12957 WP_003413891.1.12972 WP_003413891.1.13028 WP_003413891.1.13043 WP_003413891.1.13086 WP_003413891.1.13087 WP_003413891.1.13090 WP_003413891.1.13096 WP_003413891.1.13163 WP_003413891.1.13175 WP_003413891.1.13183 WP_003413891.1.132 WP_003413891.1.13249 WP_003413891.1.13282 WP_003413891.1.13284 WP_003413891.1.13296 WP_003413891.1.13298 WP_003413891.1.13302 WP_003413891.1.13306 WP_003413891.1.13312 WP_003413891.1.13313 WP_003413891.1.13321 WP_003413891.1.13345 WP_003413891.1.13358 WP_003413891.1.13375 WP_003413891.1.1338 WP_003413891.1.13420 WP_003413891.1.13433 WP_003413891.1.13435 WP_003413891.1.13438 WP_003413891.1.13461 WP_003413891.1.13466 WP_003413891.1.13489 WP_003413891.1.13526 WP_003413891.1.13551 WP_003413891.1.13561 WP_003413891.1.13564 WP_003413891.1.13579 WP_003413891.1.13647 WP_003413891.1.13667 WP_003413891.1.13687 WP_003413891.1.13697 WP_003413891.1.13719 WP_003413891.1.13763 WP_003413891.1.1377 WP_003413891.1.13774 WP_003413891.1.13786 WP_003413891.1.13793 WP_003413891.1.13794 WP_003413891.1.13817 WP_003413891.1.13834 WP_003413891.1.13866 WP_003413891.1.13880 WP_003413891.1.13899 WP_003413891.1.13910 WP_003413891.1.13919 WP_003413891.1.13920 WP_003413891.1.13953 WP_003413891.1.13962 WP_003413891.1.1398 WP_003413891.1.13988 WP_003413891.1.14046 WP_003413891.1.14115 WP_003413891.1.14152 WP_003413891.1.14158 WP_003413891.1.14162 WP_003413891.1.14175 WP_003413891.1.14178 WP_003413891.1.14194 WP_003413891.1.14195 WP_003413891.1.14208 WP_003413891.1.14238 WP_003413891.1.14266 WP_003413891.1.14273 WP_003413891.1.14303 WP_003413891.1.14306 WP_003413891.1.14307 WP_003413891.1.14310 WP_003413891.1.14341 WP_003413891.1.14382 WP_003413891.1.14416 WP_003413891.1.14428 WP_003413891.1.14441 WP_003413891.1.14469 WP_003413891.1.14477 WP_003413891.1.14504 WP_003413891.1.14514 WP_003413891.1.1452 WP_003413891.1.14527 WP_003413891.1.1454 WP_003413891.1.14544 WP_003413891.1.14548 WP_003413891.1.14551 WP_003413891.1.14561 WP_003413891.1.14573 WP_003413891.1.1462 WP_003413891.1.14658 WP_003413891.1.14667 WP_003413891.1.14668 WP_003413891.1.14675 WP_003413891.1.14694 WP_003413891.1.14695 WP_003413891.1.14709 WP_003413891.1.14766 WP_003413891.1.14783 WP_003413891.1.14865 WP_003413891.1.14872 WP_003413891.1.14905 WP_003413891.1.14926 WP_003413891.1.14951 WP_003413891.1.14955 WP_003413891.1.15003 WP_003413891.1.15009 WP_003413891.1.15028 WP_003413891.1.15040 WP_003413891.1.15052 WP_003413891.1.15065 WP_003413891.1.15072 WP_003413891.1.15089 WP_003413891.1.1509 WP_003413891.1.15126 WP_003413891.1.15131 WP_003413891.1.15168 WP_003413891.1.15172 WP_003413891.1.15174 WP_003413891.1.15187 WP_003413891.1.15196 WP_003413891.1.15210 WP_003413891.1.15216 WP_003413891.1.15217 WP_003413891.1.1523 WP_003413891.1.15232 WP_003413891.1.15238 WP_003413891.1.15240 WP_003413891.1.15253 WP_003413891.1.15267 WP_003413891.1.1527 WP_003413891.1.15292 WP_003413891.1.15299 WP_003413891.1.15302 WP_003413891.1.15322 WP_003413891.1.1534 WP_003413891.1.15345 WP_003413891.1.15365 WP_003413891.1.15386 WP_003413891.1.15387 WP_003413891.1.15442 WP_003413891.1.15447 WP_003413891.1.15449 WP_003413891.1.15477 WP_003413891.1.15481 WP_003413891.1.15492 WP_003413891.1.15511 WP_003413891.1.15512 WP_003413891.1.15558 WP_003413891.1.15559 WP_003413891.1.15566 WP_003413891.1.15599 WP_003413891.1.1560 WP_003413891.1.15611 WP_003413891.1.1563 WP_003413891.1.15633 WP_003413891.1.15643 WP_003413891.1.15688 WP_003413891.1.15755 WP_003413891.1.15763 WP_003413891.1.15774 WP_003413891.1.1578 WP_003413891.1.15780 WP_003413891.1.15827 WP_003413891.1.15834 WP_003413891.1.15842 WP_003413891.1.15853 WP_003413891.1.15870 WP_003413891.1.15877 WP_003413891.1.15893 WP_003413891.1.15896 WP_003413891.1.15926 WP_003413891.1.15933 WP_003413891.1.15946 WP_003413891.1.15958 WP_003413891.1.15973 WP_003413891.1.15987 WP_003413891.1.15993 WP_003413891.1.16009 WP_003413891.1.16025 WP_003413891.1.16043 WP_003413891.1.16055 WP_003413891.1.16066 WP_003413891.1.16069 WP_003413891.1.16077 WP_003413891.1.16106 WP_003413891.1.16108 WP_003413891.1.16110 WP_003413891.1.16130 WP_003413891.1.16136 WP_003413891.1.16139 WP_003413891.1.16141 WP_003413891.1.16143 WP_003413891.1.1630 WP_003413891.1.16318 WP_003413891.1.1632 WP_003413891.1.16327 WP_003413891.1.16334 WP_003413891.1.16341 WP_003413891.1.16345 WP_003413891.1.16374 WP_003413891.1.16384 WP_003413891.1.16386 WP_003413891.1.164 WP_003413891.1.1642 WP_003413891.1.16421 WP_003413891.1.16424 WP_003413891.1.16426 WP_003413891.1.16431 WP_003413891.1.16438 WP_003413891.1.16442 WP_003413891.1.16448 WP_003413891.1.16451 WP_003413891.1.16476 WP_003413891.1.16480 WP_003413891.1.16494 WP_003413891.1.1652 WP_003413891.1.16549 WP_003413891.1.16560 WP_003413891.1.16598 WP_003413891.1.16609 WP_003413891.1.16619 WP_003413891.1.16622 WP_003413891.1.16637 WP_003413891.1.1669 WP_003413891.1.16707 WP_003413891.1.16724 WP_003413891.1.16731 WP_003413891.1.16743 WP_003413891.1.1683 WP_003413891.1.16837 WP_003413891.1.16852 WP_003413891.1.16937 WP_003413891.1.16940 WP_003413891.1.16950 WP_003413891.1.16959 WP_003413891.1.16968 WP_003413891.1.1697 WP_003413891.1.16973 WP_003413891.1.16977 WP_003413891.1.16987 WP_003413891.1.17005 WP_003413891.1.17006 WP_003413891.1.17010 WP_003413891.1.17015 WP_003413891.1.17019 WP_003413891.1.17039 WP_003413891.1.17041 WP_003413891.1.17052 WP_003413891.1.17057 WP_003413891.1.17062 WP_003413891.1.1707 WP_003413891.1.17094 WP_003413891.1.17130 WP_003413891.1.17138 WP_003413891.1.17147 WP_003413891.1.17167 WP_003413891.1.17224 WP_003413891.1.17251 WP_003413891.1.17288 WP_003413891.1.17304 WP_003413891.1.17314 WP_003413891.1.17345 WP_003413891.1.17381 WP_003413891.1.17391 WP_003413891.1.17412 WP_003413891.1.1743 WP_003413891.1.17440 WP_003413891.1.17466 WP_003413891.1.17477 WP_003413891.1.17483 WP_003413891.1.17505 WP_003413891.1.17527 WP_003413891.1.17535 WP_003413891.1.17540 WP_003413891.1.17553 WP_003413891.1.17558 WP_003413891.1.17599 WP_003413891.1.17635 WP_003413891.1.17655 WP_003413891.1.17679 WP_003413891.1.1768 WP_003413891.1.17687 WP_003413891.1.17700 WP_003413891.1.17710 WP_003413891.1.17713 WP_003413891.1.17722 WP_003413891.1.17746 WP_003413891.1.17788 WP_003413891.1.17798 WP_003413891.1.17803 WP_003413891.1.17816 WP_003413891.1.17821 WP_003413891.1.17830 WP_003413891.1.17868 WP_003413891.1.17878 WP_003413891.1.1792 WP_003413891.1.17923 WP_003413891.1.1795 WP_003413891.1.17955 WP_003413891.1.17973 WP_003413891.1.18009 WP_003413891.1.18013 WP_003413891.1.18033 WP_003413891.1.18057 WP_003413891.1.18065 WP_003413891.1.18070 WP_003413891.1.18116 WP_003413891.1.18120 WP_003413891.1.18126 WP_003413891.1.1817 WP_003413891.1.18170 WP_003413891.1.18206 WP_003413891.1.18216 WP_003413891.1.18240 WP_003413891.1.18257 WP_003413891.1.18297 WP_003413891.1.18306 WP_003413891.1.18364 WP_003413891.1.18399 WP_003413891.1.18411 WP_003413891.1.18444 WP_003413891.1.18448 WP_003413891.1.18467 WP_003413891.1.18476 WP_003413891.1.18522 WP_003413891.1.18580 WP_003413891.1.18582 WP_003413891.1.18587 WP_003413891.1.186 WP_003413891.1.18601 WP_003413891.1.18639 WP_003413891.1.18646 WP_003413891.1.18647 WP_003413891.1.1868 WP_003413891.1.18694 WP_003413891.1.18710 WP_003413891.1.18751 WP_003413891.1.18793 WP_003413891.1.18804 WP_003413891.1.18816 WP_003413891.1.18823 WP_003413891.1.18827 WP_003413891.1.18838 WP_003413891.1.18849 WP_003413891.1.18856 WP_003413891.1.18945 WP_003413891.1.1898 WP_003413891.1.19005 WP_003413891.1.19056 WP_003413891.1.19063 WP_003413891.1.19066 WP_003413891.1.19071 WP_003413891.1.19085 WP_003413891.1.19094 WP_003413891.1.19144 WP_003413891.1.19159 WP_003413891.1.19193 WP_003413891.1.19231 WP_003413891.1.19243 WP_003413891.1.19264 WP_003413891.1.19307 WP_003413891.1.19326 WP_003413891.1.1933 WP_003413891.1.19364 WP_003413891.1.19382 WP_003413891.1.19400 WP_003413891.1.19426 WP_003413891.1.19429 WP_003413891.1.19464 WP_003413891.1.19480 WP_003413891.1.19512 WP_003413891.1.19553 WP_003413891.1.19562 WP_003413891.1.19564 WP_003413891.1.19568 WP_003413891.1.19572 WP_003413891.1.19595 WP_003413891.1.19596 WP_003413891.1.19600 WP_003413891.1.19630 WP_003413891.1.1967 WP_003413891.1.19694 WP_003413891.1.1970 WP_003413891.1.19707 WP_003413891.1.19742 WP_003413891.1.19785 WP_003413891.1.19820 WP_003413891.1.19868 WP_003413891.1.19874 WP_003413891.1.19890 WP_003413891.1.19900 WP_003413891.1.19922 WP_003413891.1.19936 WP_003413891.1.19946 WP_003413891.1.19949 WP_003413891.1.19960 WP_003413891.1.19964 WP_003413891.1.20007 WP_003413891.1.20016 WP_003413891.1.20028 WP_003413891.1.2003 WP_003413891.1.20037 WP_003413891.1.20039 WP_003413891.1.20082 WP_003413891.1.20085 WP_003413891.1.20097 WP_003413891.1.20116 WP_003413891.1.20130 WP_003413891.1.20141 WP_003413891.1.20142 WP_003413891.1.20158 WP_003413891.1.20239 WP_003413891.1.20243 WP_003413891.1.20259 WP_003413891.1.20268 WP_003413891.1.20272 WP_003413891.1.20273 WP_003413891.1.20280 WP_003413891.1.20294 WP_003413891.1.20300 WP_003413891.1.20309 WP_003413891.1.20322 WP_003413891.1.2037 WP_003413891.1.20381 WP_003413891.1.204 WP_003413891.1.20427 WP_003413891.1.20432 WP_003413891.1.20457 WP_003413891.1.20459 WP_003413891.1.20460 WP_003413891.1.20542 WP_003413891.1.20578 WP_003413891.1.20608 WP_003413891.1.20624 WP_003413891.1.20628 WP_003413891.1.2066 WP_003413891.1.20707 WP_003413891.1.20722 WP_003413891.1.20729 WP_003413891.1.20742 WP_003413891.1.20751 WP_003413891.1.20843 WP_003413891.1.20850 WP_003413891.1.2086 WP_003413891.1.20868 WP_003413891.1.20876 WP_003413891.1.20897 WP_003413891.1.20898 WP_003413891.1.2090 WP_003413891.1.20911 WP_003413891.1.20916 WP_003413891.1.20921 WP_003413891.1.20926 WP_003413891.1.20927 WP_003413891.1.20951 WP_003413891.1.20970 WP_003413891.1.2104 WP_003413891.1.21127 WP_003413891.1.21135 WP_003413891.1.21173 WP_003413891.1.21187 WP_003413891.1.212 WP_003413891.1.2120 WP_003413891.1.21218 WP_003413891.1.21219 WP_003413891.1.2123 WP_003413891.1.21231 WP_003413891.1.21234 WP_003413891.1.2126 WP_003413891.1.21292 WP_003413891.1.21307 WP_003413891.1.2131 WP_003413891.1.21311 WP_003413891.1.21321 WP_003413891.1.21365 WP_003413891.1.2137 WP_003413891.1.21392 WP_003413891.1.21397 WP_003413891.1.21403 WP_003413891.1.21415 WP_003413891.1.21430 WP_003413891.1.21434 WP_003413891.1.21468 WP_003413891.1.21498 WP_003413891.1.21509 WP_003413891.1.21513 WP_003413891.1.21560 WP_003413891.1.21565 WP_003413891.1.21586 WP_003413891.1.21591 WP_003413891.1.21594 WP_003413891.1.21602 WP_003413891.1.21615 WP_003413891.1.21638 WP_003413891.1.21639 WP_003413891.1.21655 WP_003413891.1.21658 WP_003413891.1.2168 WP_003413891.1.2174 WP_003413891.1.21742 WP_003413891.1.21777 WP_003413891.1.21786 WP_003413891.1.21795 WP_003413891.1.218 WP_003413891.1.21826 WP_003413891.1.21829 WP_003413891.1.21840 WP_003413891.1.21843 WP_003413891.1.21872 WP_003413891.1.2188 WP_003413891.1.21882 WP_003413891.1.21906 WP_003413891.1.21912 WP_003413891.1.2194 WP_003413891.1.21941 WP_003413891.1.21956 WP_003413891.1.21958 WP_003413891.1.21960 WP_003413891.1.21971 WP_003413891.1.21973 WP_003413891.1.21983 WP_003413891.1.22003 WP_003413891.1.22013 WP_003413891.1.22025 WP_003413891.1.22036 WP_003413891.1.22075 WP_003413891.1.22092 WP_003413891.1.2212 WP_003413891.1.22127 WP_003413891.1.22140 WP_003413891.1.22233 WP_003413891.1.22255 WP_003413891.1.22277 WP_003413891.1.22305 WP_003413891.1.22348 WP_003413891.1.22356 WP_003413891.1.22366 WP_003413891.1.2238 WP_003413891.1.22380 WP_003413891.1.22437 WP_003413891.1.22438 WP_003413891.1.22445 WP_003413891.1.22490 WP_003413891.1.22511 WP_003413891.1.22524 WP_003413891.1.2253 WP_003413891.1.22585 WP_003413891.1.22589 WP_003413891.1.22606 WP_003413891.1.22608 WP_003413891.1.22609 WP_003413891.1.22618 WP_003413891.1.2262 WP_003413891.1.22624 WP_003413891.1.22629 WP_003413891.1.22647 WP_003413891.1.22664 WP_003413891.1.22665 WP_003413891.1.22670 WP_003413891.1.22674 WP_003413891.1.22680 WP_003413891.1.22725 WP_003413891.1.22728 WP_003413891.1.22733 WP_003413891.1.22737 WP_003413891.1.22754 WP_003413891.1.22797 WP_003413891.1.22800 WP_003413891.1.22804 WP_003413891.1.22829 WP_003413891.1.22840 WP_003413891.1.22844 WP_003413891.1.22963 WP_003413891.1.22970 WP_003413891.1.22996 WP_003413891.1.22997 WP_003413891.1.22999 WP_003413891.1.23015 WP_003413891.1.23032 WP_003413891.1.231 WP_003413891.1.23101 WP_003413891.1.2312 WP_003413891.1.23140 WP_003413891.1.23153 WP_003413891.1.23171 WP_003413891.1.23199 WP_003413891.1.2320 WP_003413891.1.23204 WP_003413891.1.23216 WP_003413891.1.23229 WP_003413891.1.23233 WP_003413891.1.2326 WP_003413891.1.23261 WP_003413891.1.23272 WP_003413891.1.23289 WP_003413891.1.2329 WP_003413891.1.23308 WP_003413891.1.23316 WP_003413891.1.23321 WP_003413891.1.23325 WP_003413891.1.2339 WP_003413891.1.23406 WP_003413891.1.23438 WP_003413891.1.23445 WP_003413891.1.23447 WP_003413891.1.23452 WP_003413891.1.23461 WP_003413891.1.2349 WP_003413891.1.23496 WP_003413891.1.23497 WP_003413891.1.23506 WP_003413891.1.23530 WP_003413891.1.23539 WP_003413891.1.23546 WP_003413891.1.23551 WP_003413891.1.23573 WP_003413891.1.23583 WP_003413891.1.23588 WP_003413891.1.23628 WP_003413891.1.23677 WP_003413891.1.23683 WP_003413891.1.23692 WP_003413891.1.23694 WP_003413891.1.23699 WP_003413891.1.2371 WP_003413891.1.23803 WP_003413891.1.23807 WP_003413891.1.23825 WP_003413891.1.23832 WP_003413891.1.2384 WP_003413891.1.23843 WP_003413891.1.23863 WP_003413891.1.2387 WP_003413891.1.23894 WP_003413891.1.23993 WP_003413891.1.2400 WP_003413891.1.24007 WP_003413891.1.24008 WP_003413891.1.24046 WP_003413891.1.24057 WP_003413891.1.24062 WP_003413891.1.24113 WP_003413891.1.24119 WP_003413891.1.24128 WP_003413891.1.24190 WP_003413891.1.24202 WP_003413891.1.24244 WP_003413891.1.24261 WP_003413891.1.24284 WP_003413891.1.24294 WP_003413891.1.24357 WP_003413891.1.24396 WP_003413891.1.24414 WP_003413891.1.24423 WP_003413891.1.2443 WP_003413891.1.24446 WP_003413891.1.24461 WP_003413891.1.24500 WP_003413891.1.24507 WP_003413891.1.24509 WP_003413891.1.24529 WP_003413891.1.24553 WP_003413891.1.24599 WP_003413891.1.24629 WP_003413891.1.24638 WP_003413891.1.24648 WP_003413891.1.2466 WP_003413891.1.24767 WP_003413891.1.24824 WP_003413891.1.24831 WP_003413891.1.24840 WP_003413891.1.24848 WP_003413891.1.24857 WP_003413891.1.2487 WP_003413891.1.24893 WP_003413891.1.24907 WP_003413891.1.24933 WP_003413891.1.24956 WP_003413891.1.24958 WP_003413891.1.24985 WP_003413891.1.2499 WP_003413891.1.25004 WP_003413891.1.2505 WP_003413891.1.25051 WP_003413891.1.2507 WP_003413891.1.25103 WP_003413891.1.25129 WP_003413891.1.25171 WP_003413891.1.25184 WP_003413891.1.25247 WP_003413891.1.25252 WP_003413891.1.25278 WP_003413891.1.25283 WP_003413891.1.25309 WP_003413891.1.25313 WP_003413891.1.25338 WP_003413891.1.25342 WP_003413891.1.25343 WP_003413891.1.25367 WP_003413891.1.25393 WP_003413891.1.25406 WP_003413891.1.25435 WP_003413891.1.25445 WP_003413891.1.25455 WP_003413891.1.25473 WP_003413891.1.25504 WP_003413891.1.25513 WP_003413891.1.25542 WP_003413891.1.25579 WP_003413891.1.25594 WP_003413891.1.25606 WP_003413891.1.25645 WP_003413891.1.2566 WP_003413891.1.25673 WP_003413891.1.25674 WP_003413891.1.25693 WP_003413891.1.25699 WP_003413891.1.25727 WP_003413891.1.25736 WP_003413891.1.25738 WP_003413891.1.25756 WP_003413891.1.25759 WP_003413891.1.2580 WP_003413891.1.25813 WP_003413891.1.25853 WP_003413891.1.25854 WP_003413891.1.25874 WP_003413891.1.25885 WP_003413891.1.25906 WP_003413891.1.25914 WP_003413891.1.25916 WP_003413891.1.2594 WP_003413891.1.25954 WP_003413891.1.25965 WP_003413891.1.25972 WP_003413891.1.26017 WP_003413891.1.26032 WP_003413891.1.26038 WP_003413891.1.26072 WP_003413891.1.26089 WP_003413891.1.26097 WP_003413891.1.26098 WP_003413891.1.26108 WP_003413891.1.26118 WP_003413891.1.26126 WP_003413891.1.2614 WP_003413891.1.26168 WP_003413891.1.26182 WP_003413891.1.26190 WP_003413891.1.2620 WP_003413891.1.26234 WP_003413891.1.26243 WP_003413891.1.26265 WP_003413891.1.26267 WP_003413891.1.26292 WP_003413891.1.26310 WP_003413891.1.26328 WP_003413891.1.26349 WP_003413891.1.26366 WP_003413891.1.26374 WP_003413891.1.26407 WP_003413891.1.26412 WP_003413891.1.26454 WP_003413891.1.26464 WP_003413891.1.2653 WP_003413891.1.26571 WP_003413891.1.2659 WP_003413891.1.26597 WP_003413891.1.26603 WP_003413891.1.26629 WP_003413891.1.26651 WP_003413891.1.26702 WP_003413891.1.26707 WP_003413891.1.26710 WP_003413891.1.26737 WP_003413891.1.26738 WP_003413891.1.26756 WP_003413891.1.2676 WP_003413891.1.2677 WP_003413891.1.26779 WP_003413891.1.26780 WP_003413891.1.26798 WP_003413891.1.26854 WP_003413891.1.26868 WP_003413891.1.26876 WP_003413891.1.26888 WP_003413891.1.26914 WP_003413891.1.26945 WP_003413891.1.26959 WP_003413891.1.26969 WP_003413891.1.26984 WP_003413891.1.26992 WP_003413891.1.27004 WP_003413891.1.27017 WP_003413891.1.27045 WP_003413891.1.27074 WP_003413891.1.27075 WP_003413891.1.27128 WP_003413891.1.27130 WP_003413891.1.27139 WP_003413891.1.27152 WP_003413891.1.27162 WP_003413891.1.27164 WP_003413891.1.27193 WP_003413891.1.27235 WP_003413891.1.27254 WP_003413891.1.27278 WP_003413891.1.27343 WP_003413891.1.27352 WP_003413891.1.27369 WP_003413891.1.27391 WP_003413891.1.27398 WP_003413891.1.27402 WP_003413891.1.27410 WP_003413891.1.27411 WP_003413891.1.27449 WP_003413891.1.27460 WP_003413891.1.27463 WP_003413891.1.2749 WP_003413891.1.27492 WP_003413891.1.27528 WP_003413891.1.27541 WP_003413891.1.27576 WP_003413891.1.27582 WP_003413891.1.27596 WP_003413891.1.27607 WP_003413891.1.2766 WP_003413891.1.277 WP_003413891.1.27724 WP_003413891.1.27730 WP_003413891.1.27736 WP_003413891.1.27743 WP_003413891.1.27750 WP_003413891.1.27779 WP_003413891.1.27795 WP_003413891.1.27803 WP_003413891.1.27819 WP_003413891.1.27915 WP_003413891.1.27935 WP_003413891.1.27962 WP_003413891.1.28053 WP_003413891.1.28092 WP_003413891.1.28106 WP_003413891.1.28131 WP_003413891.1.28142 WP_003413891.1.28159 WP_003413891.1.2816 WP_003413891.1.28161 WP_003413891.1.28192 WP_003413891.1.28202 WP_003413891.1.28241 WP_003413891.1.28242 WP_003413891.1.28251 WP_003413891.1.28255 WP_003413891.1.28269 WP_003413891.1.28276 WP_003413891.1.28293 WP_003413891.1.28331 WP_003413891.1.28367 WP_003413891.1.28378 WP_003413891.1.28391 WP_003413891.1.2842 WP_003413891.1.28448 WP_003413891.1.2847 WP_003413891.1.28471 WP_003413891.1.28473 WP_003413891.1.28493 WP_003413891.1.28497 WP_003413891.1.28530 WP_003413891.1.28545 WP_003413891.1.28561 WP_003413891.1.28567 WP_003413891.1.28585 WP_003413891.1.286 WP_003413891.1.28610 WP_003413891.1.28617 WP_003413891.1.28634 WP_003413891.1.28642 WP_003413891.1.28671 WP_003413891.1.28682 WP_003413891.1.28698 WP_003413891.1.28739 WP_003413891.1.28758 WP_003413891.1.28781 WP_003413891.1.28787 WP_003413891.1.28827 WP_003413891.1.28839 WP_003413891.1.28847 WP_003413891.1.28850 WP_003413891.1.28851 WP_003413891.1.28865 WP_003413891.1.28897 WP_003413891.1.28914 WP_003413891.1.28936 WP_003413891.1.28939 WP_003413891.1.28943 WP_003413891.1.28952 WP_003413891.1.28975 WP_003413891.1.28993 WP_003413891.1.29000 WP_003413891.1.2901 WP_003413891.1.29028 WP_003413891.1.29033 WP_003413891.1.29058 WP_003413891.1.29078 WP_003413891.1.29102 WP_003413891.1.29115 WP_003413891.1.2916 WP_003413891.1.29217 WP_003413891.1.29223 WP_003413891.1.29234 WP_003413891.1.29264 WP_003413891.1.29275 WP_003413891.1.29306 WP_003413891.1.29339 WP_003413891.1.29348 WP_003413891.1.29364 WP_003413891.1.29367 WP_003413891.1.2938 WP_003413891.1.29399 WP_003413891.1.29426 WP_003413891.1.2944 WP_003413891.1.29449 WP_003413891.1.29450 WP_003413891.1.29452 WP_003413891.1.2949 WP_003413891.1.29510 WP_003413891.1.29515 WP_003413891.1.29525 WP_003413891.1.2953 WP_003413891.1.29559 WP_003413891.1.29587 WP_003413891.1.2959 WP_003413891.1.29592 WP_003413891.1.29599 WP_003413891.1.29611 WP_003413891.1.29632 WP_003413891.1.29649 WP_003413891.1.2965 WP_003413891.1.2969 WP_003413891.1.29698 WP_003413891.1.29718 WP_003413891.1.29742 WP_003413891.1.29745 WP_003413891.1.29747 WP_003413891.1.29769 WP_003413891.1.29825 WP_003413891.1.29830 WP_003413891.1.29847 WP_003413891.1.29861 WP_003413891.1.29869 WP_003413891.1.29883 WP_003413891.1.29890 WP_003413891.1.29931 WP_003413891.1.29960 WP_003413891.1.30014 WP_003413891.1.3004 WP_003413891.1.30040 WP_003413891.1.30043 WP_003413891.1.30074 WP_003413891.1.30097 WP_003413891.1.30101 WP_003413891.1.30106 WP_003413891.1.30114 WP_003413891.1.30126 WP_003413891.1.30131 WP_003413891.1.30139 WP_003413891.1.30145 WP_003413891.1.30211 WP_003413891.1.30224 WP_003413891.1.30235 WP_003413891.1.30237 WP_003413891.1.3027 WP_003413891.1.30279 WP_003413891.1.30282 WP_003413891.1.30283 WP_003413891.1.30288 WP_003413891.1.30291 WP_003413891.1.30363 WP_003413891.1.30374 WP_003413891.1.30404 WP_003413891.1.3043 WP_003413891.1.30433 WP_003413891.1.30438 WP_003413891.1.30462 WP_003413891.1.30464 WP_003413891.1.30468 WP_003413891.1.30500 WP_003413891.1.3057 WP_003413891.1.30574 WP_003413891.1.30628 WP_003413891.1.30641 WP_003413891.1.30642 WP_003413891.1.30661 WP_003413891.1.30669 WP_003413891.1.30683 WP_003413891.1.30699 WP_003413891.1.30709 WP_003413891.1.30713 WP_003413891.1.30716 WP_003413891.1.30719 WP_003413891.1.30730 WP_003413891.1.30732 WP_003413891.1.30736 WP_003413891.1.30745 WP_003413891.1.30760 WP_003413891.1.30791 WP_003413891.1.308 WP_003413891.1.30807 WP_003413891.1.30818 WP_003413891.1.30824 WP_003413891.1.30877 WP_003413891.1.30888 WP_003413891.1.30901 WP_003413891.1.30903 WP_003413891.1.30912 WP_003413891.1.30914 WP_003413891.1.30919 WP_003413891.1.30977 WP_003413891.1.3100 WP_003413891.1.31002 WP_003413891.1.3101 WP_003413891.1.31034 WP_003413891.1.31047 WP_003413891.1.31074 WP_003413891.1.31102 WP_003413891.1.31127 WP_003413891.1.31184 WP_003413891.1.31199 WP_003413891.1.31226 WP_003413891.1.31230 WP_003413891.1.31233 WP_003413891.1.31263 WP_003413891.1.31264 WP_003413891.1.31270 WP_003413891.1.31287 WP_003413891.1.31290 WP_003413891.1.31304 WP_003413891.1.31346 WP_003413891.1.31348 WP_003413891.1.31354 WP_003413891.1.31390 WP_003413891.1.31414 WP_003413891.1.31417 WP_003413891.1.31428 WP_003413891.1.3143 WP_003413891.1.31458 WP_003413891.1.31483 WP_003413891.1.3149 WP_003413891.1.31498 WP_003413891.1.31507 WP_003413891.1.31537 WP_003413891.1.31548 WP_003413891.1.31569 WP_003413891.1.316 WP_003413891.1.31629 WP_003413891.1.31666 WP_003413891.1.31693 WP_003413891.1.31703 WP_003413891.1.31744 WP_003413891.1.31745 WP_003413891.1.31770 WP_003413891.1.31776 WP_003413891.1.31783 WP_003413891.1.318 WP_003413891.1.3184 WP_003413891.1.31840 WP_003413891.1.31880 WP_003413891.1.31911 WP_003413891.1.31930 WP_003413891.1.31932 WP_003413891.1.31955 WP_003413891.1.31985 WP_003413891.1.31991 WP_003413891.1.31995 WP_003413891.1.32004 WP_003413891.1.32039 WP_003413891.1.3204 WP_003413891.1.32045 WP_003413891.1.32071 WP_003413891.1.32098 WP_003413891.1.32132 WP_003413891.1.32157 WP_003413891.1.32164 WP_003413891.1.32179 WP_003413891.1.32198 WP_003413891.1.32297 WP_003413891.1.32317 WP_003413891.1.32383 WP_003413891.1.32400 WP_003413891.1.32403 WP_003413891.1.32416 WP_003413891.1.32421 WP_003413891.1.32433 WP_003413891.1.32461 WP_003413891.1.32503 WP_003413891.1.32556 WP_003413891.1.32562 WP_003413891.1.32569 WP_003413891.1.32592 WP_003413891.1.32620 WP_003413891.1.32647 WP_003413891.1.32653 WP_003413891.1.32654 WP_003413891.1.3268 WP_003413891.1.32695 WP_003413891.1.32706 WP_003413891.1.32716 WP_003413891.1.32738 WP_003413891.1.32752 WP_003413891.1.32780 WP_003413891.1.32781 WP_003413891.1.32793 WP_003413891.1.32799 WP_003413891.1.32822 WP_003413891.1.32833 WP_003413891.1.32862 WP_003413891.1.32880 WP_003413891.1.32897 WP_003413891.1.32909 WP_003413891.1.32935 WP_003413891.1.32974 WP_003413891.1.33007 WP_003413891.1.3302 WP_003413891.1.33028 WP_003413891.1.33035 WP_003413891.1.33054 WP_003413891.1.33082 WP_003413891.1.33141 WP_003413891.1.33148 WP_003413891.1.33155 WP_003413891.1.33168 WP_003413891.1.3321 WP_003413891.1.33215 WP_003413891.1.3325 WP_003413891.1.3327 WP_003413891.1.33278 WP_003413891.1.33305 WP_003413891.1.3331 WP_003413891.1.33319 WP_003413891.1.3333 WP_003413891.1.33393 WP_003413891.1.33403 WP_003413891.1.33452 WP_003413891.1.33467 WP_003413891.1.33477 WP_003413891.1.3349 WP_003413891.1.33519 WP_003413891.1.33542 WP_003413891.1.33601 WP_003413891.1.33602 WP_003413891.1.33633 WP_003413891.1.33646 WP_003413891.1.33673 WP_003413891.1.3369 WP_003413891.1.33762 WP_003413891.1.33783 WP_003413891.1.33789 WP_003413891.1.3383 WP_003413891.1.33832 WP_003413891.1.33839 WP_003413891.1.33848 WP_003413891.1.3387 WP_003413891.1.33886 WP_003413891.1.33895 WP_003413891.1.33906 WP_003413891.1.33912 WP_003413891.1.33954 WP_003413891.1.3399 WP_003413891.1.34042 WP_003413891.1.3405 WP_003413891.1.34055 WP_003413891.1.34056 WP_003413891.1.34065 WP_003413891.1.3408 WP_003413891.1.34090 WP_003413891.1.34109 WP_003413891.1.34111 WP_003413891.1.34131 WP_003413891.1.34152 WP_003413891.1.34153 WP_003413891.1.34163 WP_003413891.1.34181 WP_003413891.1.34197 WP_003413891.1.34198 WP_003413891.1.34215 WP_003413891.1.34219 WP_003413891.1.34255 WP_003413891.1.34260 WP_003413891.1.34275 WP_003413891.1.34347 WP_003413891.1.34358 WP_003413891.1.34392 WP_003413891.1.344 WP_003413891.1.34428 WP_003413891.1.3443 WP_003413891.1.34435 WP_003413891.1.34446 WP_003413891.1.34499 WP_003413891.1.34505 WP_003413891.1.34516 WP_003413891.1.34529 WP_003413891.1.34551 WP_003413891.1.34563 WP_003413891.1.34576 WP_003413891.1.34581 WP_003413891.1.34588 WP_003413891.1.34596 WP_003413891.1.34599 WP_003413891.1.34639 WP_003413891.1.34724 WP_003413891.1.34740 WP_003413891.1.34755 WP_003413891.1.34777 WP_003413891.1.34841 WP_003413891.1.34908 WP_003413891.1.34919 WP_003413891.1.3492 WP_003413891.1.34933 WP_003413891.1.34945 WP_003413891.1.34946 WP_003413891.1.34954 WP_003413891.1.34960 WP_003413891.1.34963 WP_003413891.1.34965 WP_003413891.1.34968 WP_003413891.1.35023 WP_003413891.1.35069 WP_003413891.1.35072 WP_003413891.1.35078 WP_003413891.1.35100 WP_003413891.1.35146 WP_003413891.1.35156 WP_003413891.1.35160 WP_003413891.1.35162 WP_003413891.1.35173 WP_003413891.1.35176 WP_003413891.1.3520 WP_003413891.1.35213 WP_003413891.1.35221 WP_003413891.1.35246 WP_003413891.1.35278 WP_003413891.1.35301 WP_003413891.1.35311 WP_003413891.1.35312 WP_003413891.1.35317 WP_003413891.1.35319 WP_003413891.1.35347 WP_003413891.1.35363 WP_003413891.1.35382 WP_003413891.1.35385 WP_003413891.1.35396 WP_003413891.1.35397 WP_003413891.1.35426 WP_003413891.1.35439 WP_003413891.1.35455 WP_003413891.1.3548 WP_003413891.1.35484 WP_003413891.1.35492 WP_003413891.1.3553 WP_003413891.1.35553 WP_003413891.1.35555 WP_003413891.1.35561 WP_003413891.1.35602 WP_003413891.1.35610 WP_003413891.1.35635 WP_003413891.1.35657 WP_003413891.1.35680 WP_003413891.1.35687 WP_003413891.1.35689 WP_003413891.1.35707 WP_003413891.1.35732 WP_003413891.1.35754 WP_003413891.1.35767 WP_003413891.1.35770 WP_003413891.1.35771 WP_003413891.1.35780 WP_003413891.1.35805 WP_003413891.1.35811 WP_003413891.1.35821 WP_003413891.1.3584 WP_003413891.1.35848 WP_003413891.1.35864 WP_003413891.1.35874 WP_003413891.1.35876 WP_003413891.1.35897 WP_003413891.1.35899 WP_003413891.1.35923 WP_003413891.1.3593 WP_003413891.1.35954 WP_003413891.1.36005 WP_003413891.1.36014 WP_003413891.1.36023 WP_003413891.1.36051 WP_003413891.1.36053 WP_003413891.1.36075 WP_003413891.1.36089 WP_003413891.1.36097 WP_003413891.1.36098 WP_003413891.1.36116 WP_003413891.1.36145 WP_003413891.1.36156 WP_003413891.1.36205 WP_003413891.1.36228 WP_003413891.1.36246 WP_003413891.1.36260 WP_003413891.1.36270 WP_003413891.1.36271 WP_003413891.1.36303 WP_003413891.1.36309 WP_003413891.1.36315 WP_003413891.1.36319 WP_003413891.1.36321 WP_003413891.1.36326 WP_003413891.1.3634 WP_003413891.1.36356 WP_003413891.1.36357 WP_003413891.1.3636 WP_003413891.1.36385 WP_003413891.1.36399 WP_003413891.1.36436 WP_003413891.1.36465 WP_003413891.1.36469 WP_003413891.1.36473 WP_003413891.1.36485 WP_003413891.1.36508 WP_003413891.1.36540 WP_003413891.1.36561 WP_003413891.1.36571 WP_003413891.1.36573 WP_003413891.1.36578 WP_003413891.1.36585 WP_003413891.1.36597 WP_003413891.1.36614 WP_003413891.1.36657 WP_003413891.1.36674 WP_003413891.1.36720 WP_003413891.1.36727 WP_003413891.1.36733 WP_003413891.1.36785 WP_003413891.1.36810 WP_003413891.1.36844 WP_003413891.1.36851 WP_003413891.1.36862 WP_003413891.1.36893 WP_003413891.1.36901 WP_003413891.1.36921 WP_003413891.1.36935 WP_003413891.1.36941 WP_003413891.1.3695 WP_003413891.1.36951 WP_003413891.1.36968 WP_003413891.1.3700 WP_003413891.1.37004 WP_003413891.1.37012 WP_003413891.1.37071 WP_003413891.1.37088 WP_003413891.1.37131 WP_003413891.1.37157 WP_003413891.1.37175 WP_003413891.1.37188 WP_003413891.1.37213 WP_003413891.1.37229 WP_003413891.1.37277 WP_003413891.1.37305 WP_003413891.1.37330 WP_003413891.1.37389 WP_003413891.1.37400 WP_003413891.1.37440 WP_003413891.1.37459 WP_003413891.1.37468 WP_003413891.1.37475 WP_003413891.1.37484 WP_003413891.1.37601 WP_003413891.1.37612 WP_003413891.1.37632 WP_003413891.1.37643 WP_003413891.1.37655 WP_003413891.1.37660 WP_003413891.1.37674 WP_003413891.1.37700 WP_003413891.1.37701 WP_003413891.1.37709 WP_003413891.1.37711 WP_003413891.1.37721 WP_003413891.1.37722 WP_003413891.1.37747 WP_003413891.1.37765 WP_003413891.1.37772 WP_003413891.1.37804 WP_003413891.1.37809 WP_003413891.1.37859 WP_003413891.1.37877 WP_003413891.1.37913 WP_003413891.1.37943 WP_003413891.1.37973 WP_003413891.1.37975 WP_003413891.1.37983 WP_003413891.1.38 WP_003413891.1.38002 WP_003413891.1.3802 WP_003413891.1.38040 WP_003413891.1.38067 WP_003413891.1.38068 WP_003413891.1.38135 WP_003413891.1.38138 WP_003413891.1.38144 WP_003413891.1.38158 WP_003413891.1.38159 WP_003413891.1.38210 WP_003413891.1.38233 WP_003413891.1.38240 WP_003413891.1.38299 WP_003413891.1.38332 WP_003413891.1.38347 WP_003413891.1.38354 WP_003413891.1.38380 WP_003413891.1.38384 WP_003413891.1.38389 WP_003413891.1.38398 WP_003413891.1.38402 WP_003413891.1.38418 WP_003413891.1.38421 WP_003413891.1.38466 WP_003413891.1.38483 WP_003413891.1.3849 WP_003413891.1.385 WP_003413891.1.38530 WP_003413891.1.38535 WP_003413891.1.38539 WP_003413891.1.38594 WP_003413891.1.38601 WP_003413891.1.38611 WP_003413891.1.38638 WP_003413891.1.38639 WP_003413891.1.38646 WP_003413891.1.38648 WP_003413891.1.38654 WP_003413891.1.38659 WP_003413891.1.38660 WP_003413891.1.38666 WP_003413891.1.38671 WP_003413891.1.38672 WP_003413891.1.38677 WP_003413891.1.38750 WP_003413891.1.38772 WP_003413891.1.38812 WP_003413891.1.38821 WP_003413891.1.38844 WP_003413891.1.38863 WP_003413891.1.38865 WP_003413891.1.38873 WP_003413891.1.3889 WP_003413891.1.38894 WP_003413891.1.38909 WP_003413891.1.38939 WP_003413891.1.38974 WP_003413891.1.38975 WP_003413891.1.38991 WP_003413891.1.39025 WP_003413891.1.39070 WP_003413891.1.39072 WP_003413891.1.39106 WP_003413891.1.39165 WP_003413891.1.39174 WP_003413891.1.39176 WP_003413891.1.39178 WP_003413891.1.39190 WP_003413891.1.39201 WP_003413891.1.39207 WP_003413891.1.39211 WP_003413891.1.39236 WP_003413891.1.39239 WP_003413891.1.39252 WP_003413891.1.39295 WP_003413891.1.39306 WP_003413891.1.39359 WP_003413891.1.39364 WP_003413891.1.39400 WP_003413891.1.39447 WP_003413891.1.3945 WP_003413891.1.39450 WP_003413891.1.39455 WP_003413891.1.3949 WP_003413891.1.39521 WP_003413891.1.39560 WP_003413891.1.39592 WP_003413891.1.39593 WP_003413891.1.396 WP_003413891.1.3960 WP_003413891.1.39616 WP_003413891.1.39654 WP_003413891.1.39657 WP_003413891.1.39661 WP_003413891.1.39678 WP_003413891.1.3968 WP_003413891.1.39694 WP_003413891.1.3971 WP_003413891.1.39718 WP_003413891.1.39728 WP_003413891.1.39739 WP_003413891.1.39748 WP_003413891.1.39751 WP_003413891.1.39759 WP_003413891.1.39801 WP_003413891.1.39804 WP_003413891.1.39848 WP_003413891.1.39877 WP_003413891.1.39925 WP_003413891.1.3994 WP_003413891.1.39959 WP_003413891.1.3996 WP_003413891.1.39960 WP_003413891.1.3997 WP_003413891.1.39980 WP_003413891.1.40000 WP_003413891.1.40028 WP_003413891.1.40029 WP_003413891.1.4003 WP_003413891.1.40094 WP_003413891.1.40150 WP_003413891.1.40156 WP_003413891.1.40174 WP_003413891.1.40186 WP_003413891.1.40276 WP_003413891.1.40277 WP_003413891.1.40323 WP_003413891.1.40336 WP_003413891.1.40353 WP_003413891.1.4036 WP_003413891.1.40372 WP_003413891.1.40402 WP_003413891.1.40413 WP_003413891.1.40446 WP_003413891.1.40451 WP_003413891.1.40455 WP_003413891.1.40523 WP_003413891.1.40543 WP_003413891.1.40641 WP_003413891.1.40646 WP_003413891.1.40651 WP_003413891.1.40653 WP_003413891.1.4067 WP_003413891.1.40723 WP_003413891.1.40731 WP_003413891.1.40735 WP_003413891.1.40799 WP_003413891.1.40852 WP_003413891.1.40876 WP_003413891.1.40881 WP_003413891.1.40922 WP_003413891.1.40948 WP_003413891.1.4095 WP_003413891.1.40956 WP_003413891.1.40957 WP_003413891.1.4097 WP_003413891.1.410 WP_003413891.1.41000 WP_003413891.1.41055 WP_003413891.1.41108 WP_003413891.1.41123 WP_003413891.1.41177 WP_003413891.1.41202 WP_003413891.1.41219 WP_003413891.1.41231 WP_003413891.1.41249 WP_003413891.1.4127 WP_003413891.1.41296 WP_003413891.1.41355 WP_003413891.1.41376 WP_003413891.1.41430 WP_003413891.1.41447 WP_003413891.1.41469 WP_003413891.1.41504 WP_003413891.1.41553 WP_003413891.1.41564 WP_003413891.1.41583 WP_003413891.1.41616 WP_003413891.1.41632 WP_003413891.1.41635 WP_003413891.1.41636 WP_003413891.1.41648 WP_003413891.1.41660 WP_003413891.1.41685 WP_003413891.1.41695 WP_003413891.1.41704 WP_003413891.1.4171 WP_003413891.1.41719 WP_003413891.1.41733 WP_003413891.1.41744 WP_003413891.1.41774 WP_003413891.1.41791 WP_003413891.1.41803 WP_003413891.1.41820 WP_003413891.1.41828 WP_003413891.1.41829 WP_003413891.1.41860 WP_003413891.1.41912 WP_003413891.1.41921 WP_003413891.1.41933 WP_003413891.1.41944 WP_003413891.1.42043 WP_003413891.1.42075 WP_003413891.1.42078 WP_003413891.1.42094 WP_003413891.1.42112 WP_003413891.1.4212 WP_003413891.1.42122 WP_003413891.1.42134 WP_003413891.1.42183 WP_003413891.1.42188 WP_003413891.1.42201 WP_003413891.1.42202 WP_003413891.1.42208 WP_003413891.1.42247 WP_003413891.1.42255 WP_003413891.1.42273 WP_003413891.1.42278 WP_003413891.1.42304 WP_003413891.1.42309 WP_003413891.1.42370 WP_003413891.1.42400 WP_003413891.1.42409 WP_003413891.1.42414 WP_003413891.1.42417 WP_003413891.1.42430 WP_003413891.1.42461 WP_003413891.1.42465 WP_003413891.1.42467 WP_003413891.1.42473 WP_003413891.1.42474 WP_003413891.1.4248 WP_003413891.1.42494 WP_003413891.1.42519 WP_003413891.1.42524 WP_003413891.1.42562 WP_003413891.1.42568 WP_003413891.1.42570 WP_003413891.1.42618 WP_003413891.1.42660 WP_003413891.1.42695 WP_003413891.1.42704 WP_003413891.1.42705 WP_003413891.1.42722 WP_003413891.1.42777 WP_003413891.1.42835 WP_003413891.1.42839 WP_003413891.1.42842 WP_003413891.1.42905 WP_003413891.1.42930 WP_003413891.1.42971 WP_003413891.1.43005 WP_003413891.1.43009 WP_003413891.1.43053 WP_003413891.1.43082 WP_003413891.1.43087 WP_003413891.1.43098 WP_003413891.1.43208 WP_003413891.1.43236 WP_003413891.1.43246 WP_003413891.1.43255 WP_003413891.1.43266 WP_003413891.1.43269 WP_003413891.1.43273 WP_003413891.1.43296 WP_003413891.1.43306 WP_003413891.1.4335 WP_003413891.1.43368 WP_003413891.1.43395 WP_003413891.1.43457 WP_003413891.1.43462 WP_003413891.1.43475 WP_003413891.1.43478 WP_003413891.1.43484 WP_003413891.1.43557 WP_003413891.1.43578 WP_003413891.1.43588 WP_003413891.1.43643 WP_003413891.1.43664 WP_003413891.1.43684 WP_003413891.1.43686 WP_003413891.1.43706 WP_003413891.1.4377 WP_003413891.1.43781 WP_003413891.1.43794 WP_003413891.1.43815 WP_003413891.1.43846 WP_003413891.1.43861 WP_003413891.1.43863 WP_003413891.1.43866 WP_003413891.1.43872 WP_003413891.1.43885 WP_003413891.1.43897 WP_003413891.1.4390 WP_003413891.1.43902 WP_003413891.1.43921 WP_003413891.1.43936 WP_003413891.1.43937 WP_003413891.1.43960 WP_003413891.1.43965 WP_003413891.1.4399 WP_003413891.1.43993 WP_003413891.1.43996 WP_003413891.1.44 WP_003413891.1.44001 WP_003413891.1.44008 WP_003413891.1.44016 WP_003413891.1.44033 WP_003413891.1.44037 WP_003413891.1.44041 WP_003413891.1.44070 WP_003413891.1.44071 WP_003413891.1.44076 WP_003413891.1.44104 WP_003413891.1.44111 WP_003413891.1.44124 WP_003413891.1.44169 WP_003413891.1.44219 WP_003413891.1.44237 WP_003413891.1.44277 WP_003413891.1.44279 WP_003413891.1.44336 WP_003413891.1.44355 WP_003413891.1.44358 WP_003413891.1.4438 WP_003413891.1.44392 WP_003413891.1.4441 WP_003413891.1.44415 WP_003413891.1.44464 WP_003413891.1.44466 WP_003413891.1.44489 WP_003413891.1.44492 WP_003413891.1.44494 WP_003413891.1.44500 WP_003413891.1.44519 WP_003413891.1.44526 WP_003413891.1.44532 WP_003413891.1.44534 WP_003413891.1.44562 WP_003413891.1.44589 WP_003413891.1.44597 WP_003413891.1.44600 WP_003413891.1.44602 WP_003413891.1.44615 WP_003413891.1.4464 WP_003413891.1.44651 WP_003413891.1.44659 WP_003413891.1.44665 WP_003413891.1.44694 WP_003413891.1.44700 WP_003413891.1.44713 WP_003413891.1.44735 WP_003413891.1.44740 WP_003413891.1.44757 WP_003413891.1.4476 WP_003413891.1.44761 WP_003413891.1.44767 WP_003413891.1.44776 WP_003413891.1.44779 WP_003413891.1.44786 WP_003413891.1.44808 WP_003413891.1.44864 WP_003413891.1.44901 WP_003413891.1.44908 WP_003413891.1.44913 WP_003413891.1.4492 WP_003413891.1.44939 WP_003413891.1.44979 WP_003413891.1.44981 WP_003413891.1.45002 WP_003413891.1.45011 WP_003413891.1.4504 WP_003413891.1.45066 WP_003413891.1.45081 WP_003413891.1.45113 WP_003413891.1.45129 WP_003413891.1.45135 WP_003413891.1.45147 WP_003413891.1.45168 WP_003413891.1.4517 WP_003413891.1.45181 WP_003413891.1.45185 WP_003413891.1.45192 WP_003413891.1.45200 WP_003413891.1.45205 WP_003413891.1.45211 WP_003413891.1.45249 WP_003413891.1.4526 WP_003413891.1.45286 WP_003413891.1.45347 WP_003413891.1.45374 WP_003413891.1.45390 WP_003413891.1.454 WP_003413891.1.45407 WP_003413891.1.45451 WP_003413891.1.45453 WP_003413891.1.45460 WP_003413891.1.45463 WP_003413891.1.45470 WP_003413891.1.45474 WP_003413891.1.45491 WP_003413891.1.45510 WP_003413891.1.45563 WP_003413891.1.45584 WP_003413891.1.45590 WP_003413891.1.45619 WP_003413891.1.45626 WP_003413891.1.45631 WP_003413891.1.45666 WP_003413891.1.45697 WP_003413891.1.4571 WP_003413891.1.45731 WP_003413891.1.45743 WP_003413891.1.45765 WP_003413891.1.45776 WP_003413891.1.45783 WP_003413891.1.45805 WP_003413891.1.45815 WP_003413891.1.45849 WP_003413891.1.45867 WP_003413891.1.45884 WP_003413891.1.4590 WP_003413891.1.45923 WP_003413891.1.45926 WP_003413891.1.45963 WP_003413891.1.45989 WP_003413891.1.45992 WP_003413891.1.46025 WP_003413891.1.46083 WP_003413891.1.46090 WP_003413891.1.46092 WP_003413891.1.46100 WP_003413891.1.46101 WP_003413891.1.46103 WP_003413891.1.46107 WP_003413891.1.46127 WP_003413891.1.46128 WP_003413891.1.46129 WP_003413891.1.46141 WP_003413891.1.46150 WP_003413891.1.46201 WP_003413891.1.46226 WP_003413891.1.4624 WP_003413891.1.46253 WP_003413891.1.46268 WP_003413891.1.46300 WP_003413891.1.46313 WP_003413891.1.46336 WP_003413891.1.46365 WP_003413891.1.46370 WP_003413891.1.46381 WP_003413891.1.46402 WP_003413891.1.46411 WP_003413891.1.4644 WP_003413891.1.46442 WP_003413891.1.46453 WP_003413891.1.46463 WP_003413891.1.46478 WP_003413891.1.46492 WP_003413891.1.46521 WP_003413891.1.4653 WP_003413891.1.46532 WP_003413891.1.46539 WP_003413891.1.46568 WP_003413891.1.46585 WP_003413891.1.46609 WP_003413891.1.46613 WP_003413891.1.46625 WP_003413891.1.46642 WP_003413891.1.46647 WP_003413891.1.46674 WP_003413891.1.46724 WP_003413891.1.46758 WP_003413891.1.46773 WP_003413891.1.46777 WP_003413891.1.46786 WP_003413891.1.46792 WP_003413891.1.46847 WP_003413891.1.46851 WP_003413891.1.46897 WP_003413891.1.46936 WP_003413891.1.46980 WP_003413891.1.47011 WP_003413891.1.47012 WP_003413891.1.47066 WP_003413891.1.47077 WP_003413891.1.47083 WP_003413891.1.47106 WP_003413891.1.47142 WP_003413891.1.47147 WP_003413891.1.47166 WP_003413891.1.47178 WP_003413891.1.47179 WP_003413891.1.47194 WP_003413891.1.47207 WP_003413891.1.47210 WP_003413891.1.47261 WP_003413891.1.47262 WP_003413891.1.47402 WP_003413891.1.47423 WP_003413891.1.47467 WP_003413891.1.47502 WP_003413891.1.4751 WP_003413891.1.47511 WP_003413891.1.47537 WP_003413891.1.47540 WP_003413891.1.47568 WP_003413891.1.47572 WP_003413891.1.47588 WP_003413891.1.47636 WP_003413891.1.4764 WP_003413891.1.47653 WP_003413891.1.47679 WP_003413891.1.47681 WP_003413891.1.47690 WP_003413891.1.4771 WP_003413891.1.47717 WP_003413891.1.47743 WP_003413891.1.47754 WP_003413891.1.47773 WP_003413891.1.47780 WP_003413891.1.47805 WP_003413891.1.47832 WP_003413891.1.47847 WP_003413891.1.47858 WP_003413891.1.47861 WP_003413891.1.47893 WP_003413891.1.47899 WP_003413891.1.479 WP_003413891.1.47912 WP_003413891.1.47913 WP_003413891.1.47926 WP_003413891.1.4794 WP_003413891.1.47943 WP_003413891.1.47944 WP_003413891.1.47959 WP_003413891.1.47974 WP_003413891.1.47993 WP_003413891.1.48004 WP_003413891.1.48039 WP_003413891.1.48050 WP_003413891.1.48084 WP_003413891.1.48097 WP_003413891.1.48101 WP_003413891.1.48109 WP_003413891.1.4813 WP_003413891.1.48130 WP_003413891.1.48135 WP_003413891.1.48143 WP_003413891.1.48152 WP_003413891.1.48155 WP_003413891.1.48170 WP_003413891.1.48173 WP_003413891.1.48177 WP_003413891.1.48185 WP_003413891.1.48204 WP_003413891.1.48219 WP_003413891.1.4823 WP_003413891.1.48240 WP_003413891.1.48256 WP_003413891.1.48264 WP_003413891.1.48287 WP_003413891.1.48330 WP_003413891.1.48333 WP_003413891.1.48348 WP_003413891.1.48354 WP_003413891.1.48372 WP_003413891.1.48383 WP_003413891.1.48388 WP_003413891.1.48419 WP_003413891.1.48423 WP_003413891.1.48443 WP_003413891.1.48450 WP_003413891.1.48462 WP_003413891.1.48543 WP_003413891.1.48550 WP_003413891.1.48605 WP_003413891.1.48618 WP_003413891.1.4863 WP_003413891.1.48648 WP_003413891.1.48658 WP_003413891.1.48666 WP_003413891.1.48687 WP_003413891.1.48779 WP_003413891.1.4878 WP_003413891.1.48798 WP_003413891.1.48802 WP_003413891.1.48826 WP_003413891.1.48831 WP_003413891.1.48843 WP_003413891.1.48857 WP_003413891.1.4890 WP_003413891.1.48946 WP_003413891.1.48979 WP_003413891.1.49017 WP_003413891.1.49048 WP_003413891.1.49059 WP_003413891.1.4906 WP_003413891.1.4907 WP_003413891.1.49103 WP_003413891.1.49110 WP_003413891.1.49111 WP_003413891.1.49112 WP_003413891.1.4919 WP_003413891.1.49251 WP_003413891.1.49254 WP_003413891.1.49263 WP_003413891.1.49291 WP_003413891.1.49296 WP_003413891.1.49335 WP_003413891.1.49337 WP_003413891.1.49419 WP_003413891.1.49426 WP_003413891.1.49437 WP_003413891.1.49439 WP_003413891.1.49474 WP_003413891.1.49506 WP_003413891.1.49516 WP_003413891.1.49523 WP_003413891.1.49526 WP_003413891.1.49532 WP_003413891.1.49588 WP_003413891.1.4959 WP_003413891.1.49678 WP_003413891.1.49687 WP_003413891.1.49699 WP_003413891.1.49709 WP_003413891.1.4971 WP_003413891.1.4972 WP_003413891.1.49736 WP_003413891.1.49746 WP_003413891.1.49764 WP_003413891.1.49773 WP_003413891.1.49796 WP_003413891.1.49814 WP_003413891.1.49815 WP_003413891.1.49816 WP_003413891.1.49839 WP_003413891.1.49857 WP_003413891.1.49880 WP_003413891.1.49944 WP_003413891.1.4999 WP_003413891.1.49990 WP_003413891.1.50068 WP_003413891.1.50077 WP_003413891.1.5008 WP_003413891.1.50081 WP_003413891.1.50122 WP_003413891.1.50126 WP_003413891.1.50149 WP_003413891.1.50162 WP_003413891.1.5018 WP_003413891.1.50194 WP_003413891.1.50235 WP_003413891.1.50249 WP_003413891.1.50265 WP_003413891.1.50324 WP_003413891.1.50347 WP_003413891.1.50372 WP_003413891.1.50398 WP_003413891.1.50407 WP_003413891.1.50444 WP_003413891.1.50466 WP_003413891.1.50472 WP_003413891.1.5048 WP_003413891.1.50498 WP_003413891.1.5050 WP_003413891.1.50540 WP_003413891.1.50554 WP_003413891.1.50557 WP_003413891.1.50601 WP_003413891.1.50610 WP_003413891.1.50632 WP_003413891.1.50633 WP_003413891.1.50642 WP_003413891.1.50655 WP_003413891.1.50659 WP_003413891.1.50683 WP_003413891.1.50689 WP_003413891.1.50692 WP_003413891.1.50714 WP_003413891.1.50729 WP_003413891.1.50756 WP_003413891.1.50784 WP_003413891.1.50794 WP_003413891.1.50841 WP_003413891.1.50860 WP_003413891.1.50868 WP_003413891.1.50877 WP_003413891.1.5096 WP_003413891.1.50981 WP_003413891.1.50987 WP_003413891.1.51003 WP_003413891.1.51009 WP_003413891.1.51037 WP_003413891.1.51074 WP_003413891.1.51082 WP_003413891.1.51101 WP_003413891.1.51116 WP_003413891.1.51149 WP_003413891.1.51157 WP_003413891.1.51213 WP_003413891.1.51232 WP_003413891.1.51239 WP_003413891.1.51247 WP_003413891.1.51266 WP_003413891.1.51279 WP_003413891.1.51291 WP_003413891.1.51294 WP_003413891.1.51301 WP_003413891.1.51329 WP_003413891.1.51391 WP_003413891.1.51422 WP_003413891.1.51445 WP_003413891.1.51455 WP_003413891.1.51466 WP_003413891.1.51468 WP_003413891.1.51478 WP_003413891.1.51497 WP_003413891.1.51520 WP_003413891.1.51593 WP_003413891.1.51628 WP_003413891.1.5164 WP_003413891.1.51647 WP_003413891.1.51660 WP_003413891.1.51696 WP_003413891.1.51721 WP_003413891.1.51788 WP_003413891.1.51795 WP_003413891.1.51801 WP_003413891.1.51817 WP_003413891.1.51819 WP_003413891.1.51854 WP_003413891.1.51923 WP_003413891.1.51942 WP_003413891.1.51948 WP_003413891.1.51963 WP_003413891.1.51969 WP_003413891.1.52000 WP_003413891.1.52001 WP_003413891.1.52003 WP_003413891.1.52006 WP_003413891.1.52036 WP_003413891.1.52038 WP_003413891.1.52046 WP_003413891.1.52059 WP_003413891.1.52069 WP_003413891.1.52082 WP_003413891.1.52102 WP_003413891.1.52106 WP_003413891.1.52166 WP_003413891.1.52168 WP_003413891.1.52173 WP_003413891.1.52178 WP_003413891.1.52206 WP_003413891.1.52216 WP_003413891.1.52238 WP_003413891.1.52241 WP_003413891.1.52280 WP_003413891.1.52314 WP_003413891.1.52385 WP_003413891.1.52390 WP_003413891.1.524 WP_003413891.1.52460 WP_003413891.1.52485 WP_003413891.1.52486 WP_003413891.1.52504 WP_003413891.1.52522 WP_003413891.1.52531 WP_003413891.1.52533 WP_003413891.1.52545 WP_003413891.1.52553 WP_003413891.1.52563 WP_003413891.1.52564 WP_003413891.1.52574 WP_003413891.1.52641 WP_003413891.1.52673 WP_003413891.1.52674 WP_003413891.1.52708 WP_003413891.1.52713 WP_003413891.1.52761 WP_003413891.1.52778 WP_003413891.1.52791 WP_003413891.1.52797 WP_003413891.1.52818 WP_003413891.1.52872 WP_003413891.1.52873 WP_003413891.1.52891 WP_003413891.1.52892 WP_003413891.1.52909 WP_003413891.1.52970 WP_003413891.1.52998 WP_003413891.1.53053 WP_003413891.1.53056 WP_003413891.1.5306 WP_003413891.1.53088 WP_003413891.1.5309 WP_003413891.1.531 WP_003413891.1.53117 WP_003413891.1.53118 WP_003413891.1.53142 WP_003413891.1.53143 WP_003413891.1.53157 WP_003413891.1.53167 WP_003413891.1.53200 WP_003413891.1.53204 WP_003413891.1.53213 WP_003413891.1.53217 WP_003413891.1.53226 WP_003413891.1.53229 WP_003413891.1.53230 WP_003413891.1.53237 WP_003413891.1.53254 WP_003413891.1.53257 WP_003413891.1.5327 WP_003413891.1.53276 WP_003413891.1.53278 WP_003413891.1.533 WP_003413891.1.53302 WP_003413891.1.53306 WP_003413891.1.5334 WP_003413891.1.5335 WP_003413891.1.53353 WP_003413891.1.53381 WP_003413891.1.53413 WP_003413891.1.53458 WP_003413891.1.53460 WP_003413891.1.53480 WP_003413891.1.53517 WP_003413891.1.53522 WP_003413891.1.53525 WP_003413891.1.53526 WP_003413891.1.53553 WP_003413891.1.53606 WP_003413891.1.53609 WP_003413891.1.53628 WP_003413891.1.53643 WP_003413891.1.53667 WP_003413891.1.53679 WP_003413891.1.53715 WP_003413891.1.53730 WP_003413891.1.53742 WP_003413891.1.53743 WP_003413891.1.53754 WP_003413891.1.53775 WP_003413891.1.53803 WP_003413891.1.53818 WP_003413891.1.53822 WP_003413891.1.53853 WP_003413891.1.53865 WP_003413891.1.53888 WP_003413891.1.53900 WP_003413891.1.53912 WP_003413891.1.53914 WP_003413891.1.53952 WP_003413891.1.5398 WP_003413891.1.54089 WP_003413891.1.54093 WP_003413891.1.54099 WP_003413891.1.54125 WP_003413891.1.54141 WP_003413891.1.54162 WP_003413891.1.54179 WP_003413891.1.54225 WP_003413891.1.54227 WP_003413891.1.54232 WP_003413891.1.54241 WP_003413891.1.54245 WP_003413891.1.54247 WP_003413891.1.54260 WP_003413891.1.54275 WP_003413891.1.54280 WP_003413891.1.5429 WP_003413891.1.54294 WP_003413891.1.54314 WP_003413891.1.54347 WP_003413891.1.54351 WP_003413891.1.54370 WP_003413891.1.54428 WP_003413891.1.54449 WP_003413891.1.54494 WP_003413891.1.54502 WP_003413891.1.54514 WP_003413891.1.54519 WP_003413891.1.5452 WP_003413891.1.54531 WP_003413891.1.54537 WP_003413891.1.54553 WP_003413891.1.54555 WP_003413891.1.54575 WP_003413891.1.54633 WP_003413891.1.54686 WP_003413891.1.54687 WP_003413891.1.54705 WP_003413891.1.54730 WP_003413891.1.54732 WP_003413891.1.5475 WP_003413891.1.54797 WP_003413891.1.54807 WP_003413891.1.54836 WP_003413891.1.54838 WP_003413891.1.54860 WP_003413891.1.54888 WP_003413891.1.54897 WP_003413891.1.54905 WP_003413891.1.54909 WP_003413891.1.54937 WP_003413891.1.54939 WP_003413891.1.54944 WP_003413891.1.54945 WP_003413891.1.54953 WP_003413891.1.54964 WP_003413891.1.55015 WP_003413891.1.55022 WP_003413891.1.55023 WP_003413891.1.55051 WP_003413891.1.55072 WP_003413891.1.55106 WP_003413891.1.55126 WP_003413891.1.55128 WP_003413891.1.55140 WP_003413891.1.55150 WP_003413891.1.55210 WP_003413891.1.55227 WP_003413891.1.55248 WP_003413891.1.55257 WP_003413891.1.55258 WP_003413891.1.55267 WP_003413891.1.55279 WP_003413891.1.55307 WP_003413891.1.55326 WP_003413891.1.55328 WP_003413891.1.5533 WP_003413891.1.55345 WP_003413891.1.55396 WP_003413891.1.55398 WP_003413891.1.55441 WP_003413891.1.55459 WP_003413891.1.55501 WP_003413891.1.55504 WP_003413891.1.55578 WP_003413891.1.55626 WP_003413891.1.55641 WP_003413891.1.5569 WP_003413891.1.55723 WP_003413891.1.55735 WP_003413891.1.5574 WP_003413891.1.55772 WP_003413891.1.55802 WP_003413891.1.55807 WP_003413891.1.55819 WP_003413891.1.55821 WP_003413891.1.5583 WP_003413891.1.55849 WP_003413891.1.55856 WP_003413891.1.55860 WP_003413891.1.55882 WP_003413891.1.55883 WP_003413891.1.55894 WP_003413891.1.55902 WP_003413891.1.55908 WP_003413891.1.55909 WP_003413891.1.5591 WP_003413891.1.55961 WP_003413891.1.55977 WP_003413891.1.55983 WP_003413891.1.56028 WP_003413891.1.56057 WP_003413891.1.56060 WP_003413891.1.56107 WP_003413891.1.56132 WP_003413891.1.56163 WP_003413891.1.56167 WP_003413891.1.56178 WP_003413891.1.56287 WP_003413891.1.56292 WP_003413891.1.56327 WP_003413891.1.56341 WP_003413891.1.56359 WP_003413891.1.56365 WP_003413891.1.56394 WP_003413891.1.56443 WP_003413891.1.56473 WP_003413891.1.56478 WP_003413891.1.56500 WP_003413891.1.56517 WP_003413891.1.56534 WP_003413891.1.56577 WP_003413891.1.56593 WP_003413891.1.56625 WP_003413891.1.56637 WP_003413891.1.56670 WP_003413891.1.56697 WP_003413891.1.567 WP_003413891.1.56701 WP_003413891.1.56709 WP_003413891.1.56729 WP_003413891.1.56743 WP_003413891.1.56755 WP_003413891.1.56764 WP_003413891.1.56769 WP_003413891.1.56770 WP_003413891.1.56795 WP_003413891.1.5681 WP_003413891.1.56827 WP_003413891.1.56839 WP_003413891.1.56863 WP_003413891.1.56868 WP_003413891.1.56869 WP_003413891.1.56915 WP_003413891.1.56926 WP_003413891.1.56961 WP_003413891.1.56971 WP_003413891.1.56972 WP_003413891.1.57023 WP_003413891.1.57035 WP_003413891.1.57087 WP_003413891.1.57094 WP_003413891.1.57134 WP_003413891.1.57151 WP_003413891.1.57169 WP_003413891.1.57208 WP_003413891.1.57212 WP_003413891.1.57230 WP_003413891.1.5724 WP_003413891.1.5725 WP_003413891.1.5727 WP_003413891.1.57273 WP_003413891.1.573 WP_003413891.1.57314 WP_003413891.1.57326 WP_003413891.1.57328 WP_003413891.1.57331 WP_003413891.1.57340 WP_003413891.1.57351 WP_003413891.1.57352 WP_003413891.1.57380 WP_003413891.1.57430 WP_003413891.1.5744 WP_003413891.1.57440 WP_003413891.1.5745 WP_003413891.1.57461 WP_003413891.1.57469 WP_003413891.1.57489 WP_003413891.1.575 WP_003413891.1.57509 WP_003413891.1.57519 WP_003413891.1.57525 WP_003413891.1.57551 WP_003413891.1.5758 WP_003413891.1.57596 WP_003413891.1.57604 WP_003413891.1.57616 WP_003413891.1.57617 WP_003413891.1.57619 WP_003413891.1.57627 WP_003413891.1.57658 WP_003413891.1.57675 WP_003413891.1.57689 WP_003413891.1.57708 WP_003413891.1.57794 WP_003413891.1.57821 WP_003413891.1.57825 WP_003413891.1.57843 WP_003413891.1.57906 WP_003413891.1.57924 WP_003413891.1.57926 WP_003413891.1.57930 WP_003413891.1.57957 WP_003413891.1.57960 WP_003413891.1.57964 WP_003413891.1.57991 WP_003413891.1.58000 WP_003413891.1.58086 WP_003413891.1.58101 WP_003413891.1.58103 WP_003413891.1.58108 WP_003413891.1.5811 WP_003413891.1.58121 WP_003413891.1.58145 WP_003413891.1.58164 WP_003413891.1.58174 WP_003413891.1.582 WP_003413891.1.58202 WP_003413891.1.58209 WP_003413891.1.58215 WP_003413891.1.58250 WP_003413891.1.58259 WP_003413891.1.58283 WP_003413891.1.5830 WP_003413891.1.58303 WP_003413891.1.58311 WP_003413891.1.58330 WP_003413891.1.58359 WP_003413891.1.58386 WP_003413891.1.58393 WP_003413891.1.58431 WP_003413891.1.5844 WP_003413891.1.58457 WP_003413891.1.58488 WP_003413891.1.58518 WP_003413891.1.58534 WP_003413891.1.58559 WP_003413891.1.58567 WP_003413891.1.58573 WP_003413891.1.58602 WP_003413891.1.58612 WP_003413891.1.58619 WP_003413891.1.58630 WP_003413891.1.5865 WP_003413891.1.58671 WP_003413891.1.58690 WP_003413891.1.58702 WP_003413891.1.58743 WP_003413891.1.58754 WP_003413891.1.5879 WP_003413891.1.5881 WP_003413891.1.58824 WP_003413891.1.58848 WP_003413891.1.58857 WP_003413891.1.58891 WP_003413891.1.58892 WP_003413891.1.5890 WP_003413891.1.58904 WP_003413891.1.58921 WP_003413891.1.58930 WP_003413891.1.58939 WP_003413891.1.58941 WP_003413891.1.58953 WP_003413891.1.58961 WP_003413891.1.5898 WP_003413891.1.59025 WP_003413891.1.59029 WP_003413891.1.59037 WP_003413891.1.59044 WP_003413891.1.59085 WP_003413891.1.59088 WP_003413891.1.59112 WP_003413891.1.59130 WP_003413891.1.59147 WP_003413891.1.59166 WP_003413891.1.59205 WP_003413891.1.59209 WP_003413891.1.59237 WP_003413891.1.59240 WP_003413891.1.59253 WP_003413891.1.59254 WP_003413891.1.59262 WP_003413891.1.59270 WP_003413891.1.5928 WP_003413891.1.59304 WP_003413891.1.59305 WP_003413891.1.59309 WP_003413891.1.59316 WP_003413891.1.59326 WP_003413891.1.59328 WP_003413891.1.59333 WP_003413891.1.59338 WP_003413891.1.59388 WP_003413891.1.59487 WP_003413891.1.59537 WP_003413891.1.59561 WP_003413891.1.59677 WP_003413891.1.59722 WP_003413891.1.59727 WP_003413891.1.59732 WP_003413891.1.59738 WP_003413891.1.59750 WP_003413891.1.59757 WP_003413891.1.59761 WP_003413891.1.59808 WP_003413891.1.59850 WP_003413891.1.59856 WP_003413891.1.59860 WP_003413891.1.59861 WP_003413891.1.5987 WP_003413891.1.59878 WP_003413891.1.59888 WP_003413891.1.5996 WP_003413891.1.59961 WP_003413891.1.59974 WP_003413891.1.6000 WP_003413891.1.60007 WP_003413891.1.60016 WP_003413891.1.6003 WP_003413891.1.60047 WP_003413891.1.6007 WP_003413891.1.60091 WP_003413891.1.60121 WP_003413891.1.60125 WP_003413891.1.60135 WP_003413891.1.60139 WP_003413891.1.60152 WP_003413891.1.60171 WP_003413891.1.6020 WP_003413891.1.60205 WP_003413891.1.60207 WP_003413891.1.60215 WP_003413891.1.60217 WP_003413891.1.60267 WP_003413891.1.60288 WP_003413891.1.60291 WP_003413891.1.60301 WP_003413891.1.60305 WP_003413891.1.60312 WP_003413891.1.60313 WP_003413891.1.60314 WP_003413891.1.60367 WP_003413891.1.60376 WP_003413891.1.60403 WP_003413891.1.60413 WP_003413891.1.60421 WP_003413891.1.60451 WP_003413891.1.60460 WP_003413891.1.60479 WP_003413891.1.60487 WP_003413891.1.60512 WP_003413891.1.60573 WP_003413891.1.60583 WP_003413891.1.60632 WP_003413891.1.60657 WP_003413891.1.60687 WP_003413891.1.60689 WP_003413891.1.60727 WP_003413891.1.60738 WP_003413891.1.6077 WP_003413891.1.60791 WP_003413891.1.60834 WP_003413891.1.60870 WP_003413891.1.60878 WP_003413891.1.60879 WP_003413891.1.60913 WP_003413891.1.60978 WP_003413891.1.61000 WP_003413891.1.61012 WP_003413891.1.61014 WP_003413891.1.61015 WP_003413891.1.61037 WP_003413891.1.61052 WP_003413891.1.61065 WP_003413891.1.61100 WP_003413891.1.61101 WP_003413891.1.61138 WP_003413891.1.61142 WP_003413891.1.61198 WP_003413891.1.61234 WP_003413891.1.61256 WP_003413891.1.61281 WP_003413891.1.61314 WP_003413891.1.61321 WP_003413891.1.61326 WP_003413891.1.61328 WP_003413891.1.61368 WP_003413891.1.61391 WP_003413891.1.61406 WP_003413891.1.61420 WP_003413891.1.61422 WP_003413891.1.61425 WP_003413891.1.61469 WP_003413891.1.61494 WP_003413891.1.61522 WP_003413891.1.61552 WP_003413891.1.61557 WP_003413891.1.61567 WP_003413891.1.61571 WP_003413891.1.61584 WP_003413891.1.61586 WP_003413891.1.6159 WP_003413891.1.61592 WP_003413891.1.6160 WP_003413891.1.61614 WP_003413891.1.6163 WP_003413891.1.61655 WP_003413891.1.61665 WP_003413891.1.61669 WP_003413891.1.61682 WP_003413891.1.61692 WP_003413891.1.61719 WP_003413891.1.61728 WP_003413891.1.61750 WP_003413891.1.61754 WP_003413891.1.61755 WP_003413891.1.61757 WP_003413891.1.61778 WP_003413891.1.6179 WP_003413891.1.61793 WP_003413891.1.61816 WP_003413891.1.61842 WP_003413891.1.61862 WP_003413891.1.61865 WP_003413891.1.61868 WP_003413891.1.61911 WP_003413891.1.61925 WP_003413891.1.61941 WP_003413891.1.61953 WP_003413891.1.61979 WP_003413891.1.61986 WP_003413891.1.61987 WP_003413891.1.61998 WP_003413891.1.62021 WP_003413891.1.62087 WP_003413891.1.62089 WP_003413891.1.62101 WP_003413891.1.62104 WP_003413891.1.6211 WP_003413891.1.62132 WP_003413891.1.62162 WP_003413891.1.62225 WP_003413891.1.62230 WP_003413891.1.62238 WP_003413891.1.62249 WP_003413891.1.62270 WP_003413891.1.62281 WP_003413891.1.62307 WP_003413891.1.6231 WP_003413891.1.62359 WP_003413891.1.62360 WP_003413891.1.62371 WP_003413891.1.62379 WP_003413891.1.62395 WP_003413891.1.62408 WP_003413891.1.62449 WP_003413891.1.62468 WP_003413891.1.6248 WP_003413891.1.62508 WP_003413891.1.62565 WP_003413891.1.62594 WP_003413891.1.62606 WP_003413891.1.62616 WP_003413891.1.62666 WP_003413891.1.62687 WP_003413891.1.62715 WP_003413891.1.62730 WP_003413891.1.62738 WP_003413891.1.62761 WP_003413891.1.62766 WP_003413891.1.62786 WP_003413891.1.62813 WP_003413891.1.62839 WP_003413891.1.62841 WP_003413891.1.62909 WP_003413891.1.62936 WP_003413891.1.6294 WP_003413891.1.6295 WP_003413891.1.62962 WP_003413891.1.63007 WP_003413891.1.63019 WP_003413891.1.63032 WP_003413891.1.63037 WP_003413891.1.63064 WP_003413891.1.63066 WP_003413891.1.63072 WP_003413891.1.6308 WP_003413891.1.63081 WP_003413891.1.63096 WP_003413891.1.63106 WP_003413891.1.6314 WP_003413891.1.63144 WP_003413891.1.63154 WP_003413891.1.63160 WP_003413891.1.63161 WP_003413891.1.63166 WP_003413891.1.63175 WP_003413891.1.63194 WP_003413891.1.6322 WP_003413891.1.63222 WP_003413891.1.63247 WP_003413891.1.6328 WP_003413891.1.63291 WP_003413891.1.63317 WP_003413891.1.63331 WP_003413891.1.63373 WP_003413891.1.63384 WP_003413891.1.63403 WP_003413891.1.63424 WP_003413891.1.63428 WP_003413891.1.6345 WP_003413891.1.63464 WP_003413891.1.63483 WP_003413891.1.63522 WP_003413891.1.63530 WP_003413891.1.63538 WP_003413891.1.63564 WP_003413891.1.63567 WP_003413891.1.63596 WP_003413891.1.63600 WP_003413891.1.63623 WP_003413891.1.63624 WP_003413891.1.63625 WP_003413891.1.63627 WP_003413891.1.63654 WP_003413891.1.63662 WP_003413891.1.63711 WP_003413891.1.63734 WP_003413891.1.63807 WP_003413891.1.63819 WP_003413891.1.63844 WP_003413891.1.63888 WP_003413891.1.63913 WP_003413891.1.63915 WP_003413891.1.63918 WP_003413891.1.63961 WP_003413891.1.63970 WP_003413891.1.64000 WP_003413891.1.64027 WP_003413891.1.64058 WP_003413891.1.64065 WP_003413891.1.6407 WP_003413891.1.64082 WP_003413891.1.64091 WP_003413891.1.64102 WP_003413891.1.64104 WP_003413891.1.64119 WP_003413891.1.64169 WP_003413891.1.64219 WP_003413891.1.6422 WP_003413891.1.64222 WP_003413891.1.64223 WP_003413891.1.64228 WP_003413891.1.64235 WP_003413891.1.64249 WP_003413891.1.6427 WP_003413891.1.64278 WP_003413891.1.64287 WP_003413891.1.64414 WP_003413891.1.64419 WP_003413891.1.6443 WP_003413891.1.64463 WP_003413891.1.64480 WP_003413891.1.64497 WP_003413891.1.64506 WP_003413891.1.64511 WP_003413891.1.64513 WP_003413891.1.64514 WP_003413891.1.64515 WP_003413891.1.64522 WP_003413891.1.64543 WP_003413891.1.6456 WP_003413891.1.64567 WP_003413891.1.64588 WP_003413891.1.64589 WP_003413891.1.64594 WP_003413891.1.64595 WP_003413891.1.64608 WP_003413891.1.64619 WP_003413891.1.64629 WP_003413891.1.6464 WP_003413891.1.64664 WP_003413891.1.64669 WP_003413891.1.64672 WP_003413891.1.64680 WP_003413891.1.64682 WP_003413891.1.64727 WP_003413891.1.64729 WP_003413891.1.64774 WP_003413891.1.64776 WP_003413891.1.64802 WP_003413891.1.64832 WP_003413891.1.6486 WP_003413891.1.64870 WP_003413891.1.64898 WP_003413891.1.64922 WP_003413891.1.64924 WP_003413891.1.6493 WP_003413891.1.64937 WP_003413891.1.64941 WP_003413891.1.64966 WP_003413891.1.64973 WP_003413891.1.65001 WP_003413891.1.65026 WP_003413891.1.65053 WP_003413891.1.65070 WP_003413891.1.65079 WP_003413891.1.65102 WP_003413891.1.65157 WP_003413891.1.65181 WP_003413891.1.65212 WP_003413891.1.65229 WP_003413891.1.6523 WP_003413891.1.65253 WP_003413891.1.65289 WP_003413891.1.65291 WP_003413891.1.65315 WP_003413891.1.65329 WP_003413891.1.65359 WP_003413891.1.6536 WP_003413891.1.65374 WP_003413891.1.65414 WP_003413891.1.65416 WP_003413891.1.65433 WP_003413891.1.65455 WP_003413891.1.65467 WP_003413891.1.65488 WP_003413891.1.65529 WP_003413891.1.65539 WP_003413891.1.65583 WP_003413891.1.65612 WP_003413891.1.65623 WP_003413891.1.65635 WP_003413891.1.65637 WP_003413891.1.65648 WP_003413891.1.65683 WP_003413891.1.65686 WP_003413891.1.65688 WP_003413891.1.65707 WP_003413891.1.65733 WP_003413891.1.65746 WP_003413891.1.65747 WP_003413891.1.65759 WP_003413891.1.65816 WP_003413891.1.65830 WP_003413891.1.65858 WP_003413891.1.65862 WP_003413891.1.65869 WP_003413891.1.65893 WP_003413891.1.65929 WP_003413891.1.65932 WP_003413891.1.65958 WP_003413891.1.65974 WP_003413891.1.66004 WP_003413891.1.66013 WP_003413891.1.6606 WP_003413891.1.66089 WP_003413891.1.66149 WP_003413891.1.66151 WP_003413891.1.66229 WP_003413891.1.66276 WP_003413891.1.66293 WP_003413891.1.66297 WP_003413891.1.66323 WP_003413891.1.66325 WP_003413891.1.6633 WP_003413891.1.66334 WP_003413891.1.66355 WP_003413891.1.66367 WP_003413891.1.66394 WP_003413891.1.66396 WP_003413891.1.66451 WP_003413891.1.66455 WP_003413891.1.66457 WP_003413891.1.66460 WP_003413891.1.66464 WP_003413891.1.66466 WP_003413891.1.66487 WP_003413891.1.66504 WP_003413891.1.66544 WP_003413891.1.66580 WP_003413891.1.66582 WP_003413891.1.66612 WP_003413891.1.66615 WP_003413891.1.66617 WP_003413891.1.66635 WP_003413891.1.66656 WP_003413891.1.66663 WP_003413891.1.66675 WP_003413891.1.66715 WP_003413891.1.66718 WP_003413891.1.66762 WP_003413891.1.66776 WP_003413891.1.66808 WP_003413891.1.66817 WP_003413891.1.66819 WP_003413891.1.66826 WP_003413891.1.66830 WP_003413891.1.66842 WP_003413891.1.66878 WP_003413891.1.66880 WP_003413891.1.66893 WP_003413891.1.66961 WP_003413891.1.67005 WP_003413891.1.6704 WP_003413891.1.67044 WP_003413891.1.67061 WP_003413891.1.67089 WP_003413891.1.67098 WP_003413891.1.67146 WP_003413891.1.67170 WP_003413891.1.67198 WP_003413891.1.6720 WP_003413891.1.67207 WP_003413891.1.67218 WP_003413891.1.67220 WP_003413891.1.67225 WP_003413891.1.67231 WP_003413891.1.6724 WP_003413891.1.67257 WP_003413891.1.67298 WP_003413891.1.67324 WP_003413891.1.67332 WP_003413891.1.67346 WP_003413891.1.67354 WP_003413891.1.67360 WP_003413891.1.67381 WP_003413891.1.67396 WP_003413891.1.67422 WP_003413891.1.67453 WP_003413891.1.67459 WP_003413891.1.6746 WP_003413891.1.67473 WP_003413891.1.67481 WP_003413891.1.67482 WP_003413891.1.67496 WP_003413891.1.67499 WP_003413891.1.67516 WP_003413891.1.67523 WP_003413891.1.67536 WP_003413891.1.67575 WP_003413891.1.67587 WP_003413891.1.67598 WP_003413891.1.67600 WP_003413891.1.67602 WP_003413891.1.67630 WP_003413891.1.67679 WP_003413891.1.67692 WP_003413891.1.67744 WP_003413891.1.6775 WP_003413891.1.67750 WP_003413891.1.6777 WP_003413891.1.67809 WP_003413891.1.67816 WP_003413891.1.67844 WP_003413891.1.67848 WP_003413891.1.67870 WP_003413891.1.67888 WP_003413891.1.67915 WP_003413891.1.67945 WP_003413891.1.67949 WP_003413891.1.67980 WP_003413891.1.67982 WP_003413891.1.68022 WP_003413891.1.68029 WP_003413891.1.68037 WP_003413891.1.68038 WP_003413891.1.68045 WP_003413891.1.68057 WP_003413891.1.68083 WP_003413891.1.68088 WP_003413891.1.68106 WP_003413891.1.68110 WP_003413891.1.68153 WP_003413891.1.68164 WP_003413891.1.68169 WP_003413891.1.68193 WP_003413891.1.68212 WP_003413891.1.68227 WP_003413891.1.68243 WP_003413891.1.6825 WP_003413891.1.68297 WP_003413891.1.68309 WP_003413891.1.68325 WP_003413891.1.68329 WP_003413891.1.68340 WP_003413891.1.68384 WP_003413891.1.68388 WP_003413891.1.6843 WP_003413891.1.68433 WP_003413891.1.68444 WP_003413891.1.68465 WP_003413891.1.68484 WP_003413891.1.68518 WP_003413891.1.68569 WP_003413891.1.68576 WP_003413891.1.68580 WP_003413891.1.68586 WP_003413891.1.68623 WP_003413891.1.68624 WP_003413891.1.68637 WP_003413891.1.68646 WP_003413891.1.68667 WP_003413891.1.68672 WP_003413891.1.68684 WP_003413891.1.68704 WP_003413891.1.68708 WP_003413891.1.6872 WP_003413891.1.68730 WP_003413891.1.68734 WP_003413891.1.68748 WP_003413891.1.68754 WP_003413891.1.68761 WP_003413891.1.68763 WP_003413891.1.68766 WP_003413891.1.68774 WP_003413891.1.68796 WP_003413891.1.68824 WP_003413891.1.68832 WP_003413891.1.68833 WP_003413891.1.68841 WP_003413891.1.68859 WP_003413891.1.68876 WP_003413891.1.68906 WP_003413891.1.68916 WP_003413891.1.68923 WP_003413891.1.68945 WP_003413891.1.6896 WP_003413891.1.68981 WP_003413891.1.68984 WP_003413891.1.68997 WP_003413891.1.69008 WP_003413891.1.69076 WP_003413891.1.69079 WP_003413891.1.6908 WP_003413891.1.69082 WP_003413891.1.69178 WP_003413891.1.69181 WP_003413891.1.69208 WP_003413891.1.69231 WP_003413891.1.69256 WP_003413891.1.69311 WP_003413891.1.69315 WP_003413891.1.69322 WP_003413891.1.69342 WP_003413891.1.6935 WP_003413891.1.6936 WP_003413891.1.69369 WP_003413891.1.69374 WP_003413891.1.69398 WP_003413891.1.69401 WP_003413891.1.69426 WP_003413891.1.69427 WP_003413891.1.69429 WP_003413891.1.6949 WP_003413891.1.6951 WP_003413891.1.69511 WP_003413891.1.69526 WP_003413891.1.69528 WP_003413891.1.69547 WP_003413891.1.69573 WP_003413891.1.69581 WP_003413891.1.6960 WP_003413891.1.69617 WP_003413891.1.69634 WP_003413891.1.69647 WP_003413891.1.69659 WP_003413891.1.69673 WP_003413891.1.69682 WP_003413891.1.69684 WP_003413891.1.69686 WP_003413891.1.69707 WP_003413891.1.69709 WP_003413891.1.69723 WP_003413891.1.69736 WP_003413891.1.69778 WP_003413891.1.69800 WP_003413891.1.69802 WP_003413891.1.69845 WP_003413891.1.69870 WP_003413891.1.69898 WP_003413891.1.69913 WP_003413891.1.69925 WP_003413891.1.69931 WP_003413891.1.69938 WP_003413891.1.69955 WP_003413891.1.69957 WP_003413891.1.69981 WP_003413891.1.69990 WP_003413891.1.70 WP_003413891.1.70000 WP_003413891.1.70017 WP_003413891.1.70032 WP_003413891.1.70055 WP_003413891.1.70062 WP_003413891.1.70072 WP_003413891.1.70131 WP_003413891.1.70132 WP_003413891.1.7022 WP_003413891.1.70227 WP_003413891.1.70255 WP_003413891.1.70271 WP_003413891.1.70274 WP_003413891.1.7029 WP_003413891.1.70325 WP_003413891.1.70328 WP_003413891.1.70356 WP_003413891.1.70364 WP_003413891.1.70368 WP_003413891.1.70369 WP_003413891.1.70418 WP_003413891.1.70422 WP_003413891.1.70435 WP_003413891.1.70444 WP_003413891.1.70463 WP_003413891.1.70471 WP_003413891.1.70480 WP_003413891.1.70494 WP_003413891.1.70498 WP_003413891.1.70505 WP_003413891.1.70573 WP_003413891.1.70577 WP_003413891.1.70610 WP_003413891.1.70615 WP_003413891.1.70618 WP_003413891.1.70622 WP_003413891.1.70626 WP_003413891.1.70668 WP_003413891.1.70699 WP_003413891.1.70704 WP_003413891.1.70729 WP_003413891.1.70757 WP_003413891.1.70782 WP_003413891.1.70796 WP_003413891.1.70830 WP_003413891.1.70834 WP_003413891.1.7084 WP_003413891.1.70840 WP_003413891.1.70864 WP_003413891.1.70871 WP_003413891.1.70915 WP_003413891.1.70955 WP_003413891.1.70958 WP_003413891.1.70964 WP_003413891.1.70976 WP_003413891.1.71015 WP_003413891.1.71026 WP_003413891.1.71063 WP_003413891.1.71076 WP_003413891.1.71083 WP_003413891.1.7111 WP_003413891.1.71118 WP_003413891.1.71128 WP_003413891.1.7113 WP_003413891.1.71187 WP_003413891.1.71191 WP_003413891.1.71255 WP_003413891.1.71258 WP_003413891.1.71259 WP_003413891.1.71289 WP_003413891.1.71326 WP_003413891.1.71329 WP_003413891.1.71331 WP_003413891.1.71344 WP_003413891.1.71390 WP_003413891.1.71399 WP_003413891.1.71414 WP_003413891.1.71440 WP_003413891.1.71457 WP_003413891.1.7146 WP_003413891.1.71464 WP_003413891.1.71490 WP_003413891.1.71492 WP_003413891.1.71509 WP_003413891.1.71516 WP_003413891.1.71517 WP_003413891.1.71527 WP_003413891.1.71545 WP_003413891.1.71546 WP_003413891.1.71604 WP_003413891.1.71621 WP_003413891.1.71630 WP_003413891.1.71638 WP_003413891.1.71654 WP_003413891.1.71664 WP_003413891.1.71665 WP_003413891.1.71683 WP_003413891.1.71701 WP_003413891.1.71718 WP_003413891.1.71731 WP_003413891.1.71778 WP_003413891.1.71781 WP_003413891.1.71803 WP_003413891.1.71820 WP_003413891.1.71847 WP_003413891.1.7185 WP_003413891.1.71851 WP_003413891.1.71871 WP_003413891.1.71909 WP_003413891.1.71957 WP_003413891.1.71970 WP_003413891.1.72047 WP_003413891.1.72061 WP_003413891.1.72062 WP_003413891.1.72072 WP_003413891.1.72111 WP_003413891.1.72122 WP_003413891.1.72128 WP_003413891.1.72143 WP_003413891.1.7216 WP_003413891.1.72168 WP_003413891.1.72179 WP_003413891.1.72209 WP_003413891.1.72218 WP_003413891.1.72219 WP_003413891.1.72227 WP_003413891.1.7224 WP_003413891.1.72268 WP_003413891.1.72332 WP_003413891.1.72380 WP_003413891.1.72401 WP_003413891.1.72405 WP_003413891.1.72420 WP_003413891.1.72441 WP_003413891.1.72451 WP_003413891.1.72452 WP_003413891.1.72459 WP_003413891.1.72460 WP_003413891.1.72466 WP_003413891.1.72487 WP_003413891.1.72488 WP_003413891.1.72492 WP_003413891.1.72506 WP_003413891.1.72543 WP_003413891.1.7256 WP_003413891.1.72576 WP_003413891.1.72578 WP_003413891.1.72585 WP_003413891.1.72591 WP_003413891.1.72592 WP_003413891.1.7266 WP_003413891.1.72661 WP_003413891.1.72739 WP_003413891.1.72744 WP_003413891.1.72755 WP_003413891.1.72759 WP_003413891.1.72784 WP_003413891.1.72792 WP_003413891.1.72826 WP_003413891.1.72831 WP_003413891.1.72852 WP_003413891.1.72853 WP_003413891.1.72879 WP_003413891.1.72880 WP_003413891.1.72938 WP_003413891.1.72954 WP_003413891.1.72957 WP_003413891.1.72959 WP_003413891.1.72973 WP_003413891.1.7298 WP_003413891.1.72982 WP_003413891.1.72988 WP_003413891.1.72993 WP_003413891.1.73006 WP_003413891.1.73013 WP_003413891.1.73025 WP_003413891.1.73028 WP_003413891.1.73045 WP_003413891.1.73092 WP_003413891.1.73118 WP_003413891.1.7312 WP_003413891.1.73127 WP_003413891.1.73134 WP_003413891.1.73150 WP_003413891.1.73154 WP_003413891.1.73163 WP_003413891.1.73182 WP_003413891.1.73205 WP_003413891.1.7321 WP_003413891.1.73310 WP_003413891.1.73315 WP_003413891.1.73365 WP_003413891.1.73391 WP_003413891.1.73404 WP_003413891.1.73424 WP_003413891.1.73436 WP_003413891.1.73445 WP_003413891.1.73453 WP_003413891.1.73465 WP_003413891.1.73466 WP_003413891.1.73470 WP_003413891.1.73471 WP_003413891.1.73478 WP_003413891.1.73482 WP_003413891.1.73507 WP_003413891.1.73532 WP_003413891.1.73550 WP_003413891.1.73564 WP_003413891.1.73623 WP_003413891.1.73629 WP_003413891.1.7366 WP_003413891.1.73661 WP_003413891.1.7368 WP_003413891.1.73688 WP_003413891.1.73723 WP_003413891.1.73744 WP_003413891.1.73750 WP_003413891.1.73774 WP_003413891.1.7379 WP_003413891.1.73813 WP_003413891.1.73840 WP_003413891.1.73876 WP_003413891.1.7389 WP_003413891.1.73986 WP_003413891.1.74016 WP_003413891.1.74039 WP_003413891.1.74083 WP_003413891.1.74101 WP_003413891.1.74107 WP_003413891.1.74120 WP_003413891.1.74129 WP_003413891.1.74144 WP_003413891.1.7417 WP_003413891.1.74190 WP_003413891.1.74210 WP_003413891.1.7423 WP_003413891.1.74259 WP_003413891.1.74262 WP_003413891.1.74269 WP_003413891.1.74282 WP_003413891.1.74291 WP_003413891.1.74296 WP_003413891.1.74304 WP_003413891.1.7432 WP_003413891.1.74347 WP_003413891.1.7436 WP_003413891.1.74378 WP_003413891.1.74382 WP_003413891.1.74395 WP_003413891.1.74400 WP_003413891.1.74401 WP_003413891.1.74432 WP_003413891.1.74442 WP_003413891.1.74477 WP_003413891.1.74487 WP_003413891.1.74499 WP_003413891.1.74504 WP_003413891.1.74511 WP_003413891.1.74523 WP_003413891.1.74525 WP_003413891.1.74551 WP_003413891.1.74555 WP_003413891.1.74628 WP_003413891.1.74641 WP_003413891.1.74653 WP_003413891.1.74660 WP_003413891.1.74683 WP_003413891.1.7469 WP_003413891.1.74725 WP_003413891.1.74760 WP_003413891.1.74809 WP_003413891.1.74820 WP_003413891.1.74870 WP_003413891.1.74881 WP_003413891.1.74952 WP_003413891.1.7496 WP_003413891.1.74988 WP_003413891.1.75045 WP_003413891.1.75055 WP_003413891.1.75078 WP_003413891.1.75081 WP_003413891.1.75120 WP_003413891.1.75163 WP_003413891.1.75200 WP_003413891.1.75202 WP_003413891.1.75234 WP_003413891.1.75239 WP_003413891.1.75250 WP_003413891.1.75263 WP_003413891.1.75281 WP_003413891.1.75342 WP_003413891.1.7535 WP_003413891.1.75376 WP_003413891.1.75391 WP_003413891.1.75395 WP_003413891.1.75441 WP_003413891.1.75510 WP_003413891.1.75581 WP_003413891.1.75598 WP_003413891.1.75635 WP_003413891.1.75645 WP_003413891.1.75665 WP_003413891.1.75671 WP_003413891.1.75749 WP_003413891.1.75772 WP_003413891.1.75774 WP_003413891.1.75811 WP_003413891.1.75833 WP_003413891.1.7585 WP_003413891.1.75868 WP_003413891.1.75878 WP_003413891.1.75927 WP_003413891.1.75946 WP_003413891.1.75968 WP_003413891.1.75974 WP_003413891.1.76007 WP_003413891.1.76016 WP_003413891.1.76032 WP_003413891.1.76037 WP_003413891.1.7604 WP_003413891.1.76045 WP_003413891.1.76052 WP_003413891.1.76058 WP_003413891.1.76064 WP_003413891.1.76110 WP_003413891.1.76133 WP_003413891.1.76138 WP_003413891.1.76157 WP_003413891.1.76177 WP_003413891.1.76183 WP_003413891.1.76209 WP_003413891.1.76272 WP_003413891.1.76277 WP_003413891.1.76280 WP_003413891.1.76281 WP_003413891.1.76291 WP_003413891.1.76297 WP_003413891.1.76403 WP_003413891.1.76413 WP_003413891.1.76414 WP_003413891.1.76427 WP_003413891.1.76436 WP_003413891.1.76443 WP_003413891.1.76456 WP_003413891.1.76521 WP_003413891.1.76533 WP_003413891.1.76616 WP_003413891.1.76625 WP_003413891.1.76629 WP_003413891.1.76635 WP_003413891.1.76638 WP_003413891.1.76639 WP_003413891.1.76640 WP_003413891.1.76644 WP_003413891.1.76677 WP_003413891.1.76678 WP_003413891.1.76679 WP_003413891.1.76734 WP_003413891.1.76744 WP_003413891.1.76750 WP_003413891.1.76754 WP_003413891.1.76757 WP_003413891.1.76781 WP_003413891.1.76818 WP_003413891.1.76824 WP_003413891.1.76835 WP_003413891.1.76873 WP_003413891.1.76881 WP_003413891.1.76888 WP_003413891.1.76900 WP_003413891.1.7691 WP_003413891.1.76947 WP_003413891.1.76954 WP_003413891.1.76955 WP_003413891.1.76963 WP_003413891.1.76976 WP_003413891.1.770 WP_003413891.1.77000 WP_003413891.1.77008 WP_003413891.1.77021 WP_003413891.1.77056 WP_003413891.1.77065 WP_003413891.1.77075 WP_003413891.1.77093 WP_003413891.1.77115 WP_003413891.1.77118 WP_003413891.1.77125 WP_003413891.1.77141 WP_003413891.1.77142 WP_003413891.1.77166 WP_003413891.1.77252 WP_003413891.1.77260 WP_003413891.1.77266 WP_003413891.1.77280 WP_003413891.1.77285 WP_003413891.1.77312 WP_003413891.1.77348 WP_003413891.1.77351 WP_003413891.1.77352 WP_003413891.1.77361 WP_003413891.1.774 WP_003413891.1.7740 WP_003413891.1.77404 WP_003413891.1.77425 WP_003413891.1.77463 WP_003413891.1.77474 WP_003413891.1.7748 WP_003413891.1.77491 WP_003413891.1.77499 WP_003413891.1.77510 WP_003413891.1.77530 WP_003413891.1.77554 WP_003413891.1.77559 WP_003413891.1.77599 WP_003413891.1.77605 WP_003413891.1.7762 WP_003413891.1.77627 WP_003413891.1.77649 WP_003413891.1.77654 WP_003413891.1.7766 WP_003413891.1.77667 WP_003413891.1.77704 WP_003413891.1.77706 WP_003413891.1.77726 WP_003413891.1.77774 WP_003413891.1.7778 WP_003413891.1.77790 WP_003413891.1.77809 WP_003413891.1.77820 WP_003413891.1.77843 WP_003413891.1.77855 WP_003413891.1.77865 WP_003413891.1.77868 WP_003413891.1.77879 WP_003413891.1.77890 WP_003413891.1.77909 WP_003413891.1.77911 WP_003413891.1.77931 WP_003413891.1.77984 WP_003413891.1.78020 WP_003413891.1.78024 WP_003413891.1.78075 WP_003413891.1.78084 WP_003413891.1.78086 WP_003413891.1.7809 WP_003413891.1.78098 WP_003413891.1.78105 WP_003413891.1.78113 WP_003413891.1.78136 WP_003413891.1.78162 WP_003413891.1.7817 WP_003413891.1.78200 WP_003413891.1.78216 WP_003413891.1.78236 WP_003413891.1.78238 WP_003413891.1.78322 WP_003413891.1.78338 WP_003413891.1.7836 WP_003413891.1.78360 WP_003413891.1.78386 WP_003413891.1.78429 WP_003413891.1.78435 WP_003413891.1.7844 WP_003413891.1.78459 WP_003413891.1.78488 WP_003413891.1.7849 WP_003413891.1.78499 WP_003413891.1.785 WP_003413891.1.78516 WP_003413891.1.78524 WP_003413891.1.78526 WP_003413891.1.78538 WP_003413891.1.78544 WP_003413891.1.78547 WP_003413891.1.78574 WP_003413891.1.78580 WP_003413891.1.7860 WP_003413891.1.78620 WP_003413891.1.78646 WP_003413891.1.78648 WP_003413891.1.78649 WP_003413891.1.78655 WP_003413891.1.78657 WP_003413891.1.78659 WP_003413891.1.7869 WP_003413891.1.78692 WP_003413891.1.78760 WP_003413891.1.78766 WP_003413891.1.78776 WP_003413891.1.78778 WP_003413891.1.78784 WP_003413891.1.78790 WP_003413891.1.78793 WP_003413891.1.78848 WP_003413891.1.78860 WP_003413891.1.7887 WP_003413891.1.78884 WP_003413891.1.78932 WP_003413891.1.78969 WP_003413891.1.78977 WP_003413891.1.78980 WP_003413891.1.79005 WP_003413891.1.79016 WP_003413891.1.79033 WP_003413891.1.79064 WP_003413891.1.79066 WP_003413891.1.79068 WP_003413891.1.79077 WP_003413891.1.79095 WP_003413891.1.79112 WP_003413891.1.79122 WP_003413891.1.79145 WP_003413891.1.79152 WP_003413891.1.79163 WP_003413891.1.79182 WP_003413891.1.79198 WP_003413891.1.79213 WP_003413891.1.79218 WP_003413891.1.79268 WP_003413891.1.79273 WP_003413891.1.79278 WP_003413891.1.79290 WP_003413891.1.79319 WP_003413891.1.79326 WP_003413891.1.7933 WP_003413891.1.79330 WP_003413891.1.79339 WP_003413891.1.79394 WP_003413891.1.79399 WP_003413891.1.79413 WP_003413891.1.79422 WP_003413891.1.79445 WP_003413891.1.79447 WP_003413891.1.79455 WP_003413891.1.79471 WP_003413891.1.79482 WP_003413891.1.79488 WP_003413891.1.79500 WP_003413891.1.79502 WP_003413891.1.79514 WP_003413891.1.79561 WP_003413891.1.79565 WP_003413891.1.79578 WP_003413891.1.79588 WP_003413891.1.79598 WP_003413891.1.79615 WP_003413891.1.79684 WP_003413891.1.79698 WP_003413891.1.797 WP_003413891.1.79744 WP_003413891.1.79784 WP_003413891.1.79802 WP_003413891.1.79806 WP_003413891.1.79819 WP_003413891.1.79826 WP_003413891.1.79828 WP_003413891.1.79851 WP_003413891.1.79853 WP_003413891.1.79863 WP_003413891.1.79881 WP_003413891.1.79885 WP_003413891.1.79898 WP_003413891.1.7990 WP_003413891.1.79900 WP_003413891.1.79913 WP_003413891.1.79918 WP_003413891.1.79947 WP_003413891.1.79948 WP_003413891.1.7995 WP_003413891.1.7997 WP_003413891.1.80004 WP_003413891.1.80015 WP_003413891.1.80022 WP_003413891.1.80030 WP_003413891.1.80054 WP_003413891.1.80084 WP_003413891.1.80099 WP_003413891.1.80129 WP_003413891.1.80177 WP_003413891.1.80234 WP_003413891.1.8026 WP_003413891.1.80275 WP_003413891.1.8029 WP_003413891.1.80299 WP_003413891.1.80300 WP_003413891.1.80304 WP_003413891.1.80326 WP_003413891.1.80351 WP_003413891.1.8037 WP_003413891.1.80370 WP_003413891.1.80399 WP_003413891.1.8044 WP_003413891.1.80451 WP_003413891.1.80458 WP_003413891.1.80461 WP_003413891.1.80490 WP_003413891.1.80503 WP_003413891.1.80507 WP_003413891.1.80552 WP_003413891.1.80576 WP_003413891.1.80588 WP_003413891.1.80599 WP_003413891.1.8060 WP_003413891.1.80624 WP_003413891.1.80636 WP_003413891.1.80669 WP_003413891.1.80673 WP_003413891.1.80711 WP_003413891.1.80714 WP_003413891.1.80743 WP_003413891.1.80784 WP_003413891.1.80815 WP_003413891.1.80853 WP_003413891.1.80918 WP_003413891.1.8093 WP_003413891.1.80967 WP_003413891.1.8097 WP_003413891.1.80988 WP_003413891.1.81007 WP_003413891.1.81013 WP_003413891.1.8105 WP_003413891.1.81059 WP_003413891.1.81063 WP_003413891.1.81066 WP_003413891.1.81075 WP_003413891.1.81091 WP_003413891.1.81119 WP_003413891.1.81125 WP_003413891.1.81136 WP_003413891.1.8114 WP_003413891.1.81189 WP_003413891.1.81192 WP_003413891.1.812 WP_003413891.1.81230 WP_003413891.1.81249 WP_003413891.1.81250 WP_003413891.1.81264 WP_003413891.1.8128 WP_003413891.1.81287 WP_003413891.1.81297 WP_003413891.1.8138 WP_003413891.1.81407 WP_003413891.1.8143 WP_003413891.1.81439 WP_003413891.1.81465 WP_003413891.1.81505 WP_003413891.1.81529 WP_003413891.1.81538 WP_003413891.1.81541 WP_003413891.1.81560 WP_003413891.1.81561 WP_003413891.1.81567 WP_003413891.1.81583 WP_003413891.1.81686 WP_003413891.1.81712 WP_003413891.1.81720 WP_003413891.1.81731 WP_003413891.1.81774 WP_003413891.1.81788 WP_003413891.1.81809 WP_003413891.1.81820 WP_003413891.1.81850 WP_003413891.1.81883 WP_003413891.1.81891 WP_003413891.1.81911 WP_003413891.1.81918 WP_003413891.1.82011 WP_003413891.1.82048 WP_003413891.1.82069 WP_003413891.1.82071 WP_003413891.1.82108 WP_003413891.1.82136 WP_003413891.1.82142 WP_003413891.1.8215 WP_003413891.1.82158 WP_003413891.1.8217 WP_003413891.1.82209 WP_003413891.1.82210 WP_003413891.1.82228 WP_003413891.1.82236 WP_003413891.1.82251 WP_003413891.1.82271 WP_003413891.1.82305 WP_003413891.1.82307 WP_003413891.1.82309 WP_003413891.1.82317 WP_003413891.1.8232 WP_003413891.1.82346 WP_003413891.1.82374 WP_003413891.1.82385 WP_003413891.1.82429 WP_003413891.1.82460 WP_003413891.1.82462 WP_003413891.1.82483 WP_003413891.1.82494 WP_003413891.1.82531 WP_003413891.1.82546 WP_003413891.1.82549 WP_003413891.1.82577 WP_003413891.1.82592 WP_003413891.1.82597 WP_003413891.1.82598 WP_003413891.1.82625 WP_003413891.1.82642 WP_003413891.1.82651 WP_003413891.1.82653 WP_003413891.1.82681 WP_003413891.1.82685 WP_003413891.1.8271 WP_003413891.1.82712 WP_003413891.1.8273 WP_003413891.1.82743 WP_003413891.1.82757 WP_003413891.1.82774 WP_003413891.1.82803 WP_003413891.1.82836 WP_003413891.1.82860 WP_003413891.1.82871 WP_003413891.1.82892 WP_003413891.1.82935 WP_003413891.1.82957 WP_003413891.1.82973 WP_003413891.1.82981 WP_003413891.1.82983 WP_003413891.1.83009 WP_003413891.1.83044 WP_003413891.1.83065 WP_003413891.1.83074 WP_003413891.1.83110 WP_003413891.1.83146 WP_003413891.1.83149 WP_003413891.1.83159 WP_003413891.1.8317 WP_003413891.1.83173 WP_003413891.1.83181 WP_003413891.1.83182 WP_003413891.1.83191 WP_003413891.1.83197 WP_003413891.1.83212 WP_003413891.1.8326 WP_003413891.1.83262 WP_003413891.1.83268 WP_003413891.1.83273 WP_003413891.1.83309 WP_003413891.1.83332 WP_003413891.1.83334 WP_003413891.1.83341 WP_003413891.1.83349 WP_003413891.1.8335 WP_003413891.1.83353 WP_003413891.1.83367 WP_003413891.1.83380 WP_003413891.1.83381 WP_003413891.1.83389 WP_003413891.1.83408 WP_003413891.1.83409 WP_003413891.1.83435 WP_003413891.1.83470 WP_003413891.1.83524 WP_003413891.1.83526 WP_003413891.1.8358 WP_003413891.1.83589 WP_003413891.1.83601 WP_003413891.1.83611 WP_003413891.1.83638 WP_003413891.1.83648 WP_003413891.1.83656 WP_003413891.1.83667 WP_003413891.1.83689 WP_003413891.1.83692 WP_003413891.1.83704 WP_003413891.1.83766 WP_003413891.1.83793 WP_003413891.1.83794 WP_003413891.1.83802 WP_003413891.1.83805 WP_003413891.1.83839 WP_003413891.1.83842 WP_003413891.1.83861 WP_003413891.1.83884 WP_003413891.1.83920 WP_003413891.1.83929 WP_003413891.1.83930 WP_003413891.1.83975 WP_003413891.1.83991 WP_003413891.1.8400 WP_003413891.1.84027 WP_003413891.1.8404 WP_003413891.1.84057 WP_003413891.1.84070 WP_003413891.1.8409 WP_003413891.1.84112 WP_003413891.1.84146 WP_003413891.1.8415 WP_003413891.1.84176 WP_003413891.1.84186 WP_003413891.1.84192 WP_003413891.1.84228 WP_003413891.1.8424 WP_003413891.1.84244 WP_003413891.1.84259 WP_003413891.1.8426 WP_003413891.1.84287 WP_003413891.1.8434 WP_003413891.1.84388 WP_003413891.1.84408 WP_003413891.1.84409 WP_003413891.1.84438 WP_003413891.1.84460 WP_003413891.1.84488 WP_003413891.1.84504 WP_003413891.1.84525 WP_003413891.1.84620 WP_003413891.1.84623 WP_003413891.1.84641 WP_003413891.1.84655 WP_003413891.1.84666 WP_003413891.1.84670 WP_003413891.1.84739 WP_003413891.1.84748 WP_003413891.1.84766 WP_003413891.1.84772 WP_003413891.1.84774 WP_003413891.1.848 WP_003413891.1.84812 WP_003413891.1.84836 WP_003413891.1.84839 WP_003413891.1.84846 WP_003413891.1.84873 WP_003413891.1.84911 WP_003413891.1.84938 WP_003413891.1.84968 WP_003413891.1.84973 WP_003413891.1.84981 WP_003413891.1.84985 WP_003413891.1.8503 WP_003413891.1.85038 WP_003413891.1.85041 WP_003413891.1.85043 WP_003413891.1.8505 WP_003413891.1.85074 WP_003413891.1.8509 WP_003413891.1.8512 WP_003413891.1.85148 WP_003413891.1.8518 WP_003413891.1.8522 WP_003413891.1.85242 WP_003413891.1.85276 WP_003413891.1.85281 WP_003413891.1.85284 WP_003413891.1.85314 WP_003413891.1.85319 WP_003413891.1.85330 WP_003413891.1.85341 WP_003413891.1.85346 WP_003413891.1.8535 WP_003413891.1.85363 WP_003413891.1.85371 WP_003413891.1.85377 WP_003413891.1.85387 WP_003413891.1.85399 WP_003413891.1.85458 WP_003413891.1.8546 WP_003413891.1.85464 WP_003413891.1.85478 WP_003413891.1.85480 WP_003413891.1.85488 WP_003413891.1.85495 WP_003413891.1.85551 WP_003413891.1.85577 WP_003413891.1.85597 WP_003413891.1.85599 WP_003413891.1.85610 WP_003413891.1.8563 WP_003413891.1.85648 WP_003413891.1.85679 WP_003413891.1.85704 WP_003413891.1.85717 WP_003413891.1.85737 WP_003413891.1.85763 WP_003413891.1.85808 WP_003413891.1.85819 WP_003413891.1.85820 WP_003413891.1.85823 WP_003413891.1.85832 WP_003413891.1.8586 WP_003413891.1.85872 WP_003413891.1.85894 WP_003413891.1.85909 WP_003413891.1.85913 WP_003413891.1.85953 WP_003413891.1.85986 WP_003413891.1.86000 WP_003413891.1.86024 WP_003413891.1.86025 WP_003413891.1.86032 WP_003413891.1.86048 WP_003413891.1.86052 WP_003413891.1.86067 WP_003413891.1.86103 WP_003413891.1.86122 WP_003413891.1.86124 WP_003413891.1.86160 WP_003413891.1.86164 WP_003413891.1.86168 WP_003413891.1.86190 WP_003413891.1.86204 WP_003413891.1.86208 WP_003413891.1.86235 WP_003413891.1.86249 WP_003413891.1.86260 WP_003413891.1.86290 WP_003413891.1.863 WP_003413891.1.86327 WP_003413891.1.86334 WP_003413891.1.86337 WP_003413891.1.86368 WP_003413891.1.86377 WP_003413891.1.86425 WP_003413891.1.86459 WP_003413891.1.8649 WP_003413891.1.86499 WP_003413891.1.86520 WP_003413891.1.86561 WP_003413891.1.86568 WP_003413891.1.86575 WP_003413891.1.86584 WP_003413891.1.86605 WP_003413891.1.86626 WP_003413891.1.86648 WP_003413891.1.8666 WP_003413891.1.86684 WP_003413891.1.86705 WP_003413891.1.86718 WP_003413891.1.86757 WP_003413891.1.86801 WP_003413891.1.86814 WP_003413891.1.86820 WP_003413891.1.86825 WP_003413891.1.86834 WP_003413891.1.8685 WP_003413891.1.86851 WP_003413891.1.86855 WP_003413891.1.86867 WP_003413891.1.86877 WP_003413891.1.86883 WP_003413891.1.8689 WP_003413891.1.86892 WP_003413891.1.86933 WP_003413891.1.86941 WP_003413891.1.86950 WP_003413891.1.86962 WP_003413891.1.86963 WP_003413891.1.86979 WP_003413891.1.8700 WP_003413891.1.87001 WP_003413891.1.87002 WP_003413891.1.87031 WP_003413891.1.87116 WP_003413891.1.87117 WP_003413891.1.8714 WP_003413891.1.87162 WP_003413891.1.87178 WP_003413891.1.87191 WP_003413891.1.87201 WP_003413891.1.87209 WP_003413891.1.87240 WP_003413891.1.87266 WP_003413891.1.87273 WP_003413891.1.87275 WP_003413891.1.8733 WP_003413891.1.87345 WP_003413891.1.87369 WP_003413891.1.8737 WP_003413891.1.87401 WP_003413891.1.87404 WP_003413891.1.87406 WP_003413891.1.87409 WP_003413891.1.87444 WP_003413891.1.87446 WP_003413891.1.87459 WP_003413891.1.87472 WP_003413891.1.87489 WP_003413891.1.87494 WP_003413891.1.87496 WP_003413891.1.87582 WP_003413891.1.87588 WP_003413891.1.87617 WP_003413891.1.87620 WP_003413891.1.87634 WP_003413891.1.87643 WP_003413891.1.8765 WP_003413891.1.87650 WP_003413891.1.87654 WP_003413891.1.87658 WP_003413891.1.87665 WP_003413891.1.87676 WP_003413891.1.87677 WP_003413891.1.87684 WP_003413891.1.87692 WP_003413891.1.87707 WP_003413891.1.87732 WP_003413891.1.87784 WP_003413891.1.87796 WP_003413891.1.87809 WP_003413891.1.87817 WP_003413891.1.87827 WP_003413891.1.87831 WP_003413891.1.87835 WP_003413891.1.87837 WP_003413891.1.87866 WP_003413891.1.8789 WP_003413891.1.87911 WP_003413891.1.87924 WP_003413891.1.87951 WP_003413891.1.87955 WP_003413891.1.87956 WP_003413891.1.87991 WP_003413891.1.88 WP_003413891.1.88002 WP_003413891.1.88037 WP_003413891.1.88039 WP_003413891.1.88072 WP_003413891.1.88077 WP_003413891.1.88121 WP_003413891.1.88180 WP_003413891.1.88191 WP_003413891.1.88205 WP_003413891.1.88217 WP_003413891.1.88219 WP_003413891.1.88245 WP_003413891.1.88253 WP_003413891.1.88294 WP_003413891.1.88315 WP_003413891.1.88316 WP_003413891.1.88320 WP_003413891.1.88338 WP_003413891.1.8840 WP_003413891.1.88437 WP_003413891.1.88453 WP_003413891.1.88469 WP_003413891.1.88489 WP_003413891.1.88507 WP_003413891.1.88521 WP_003413891.1.88530 WP_003413891.1.88537 WP_003413891.1.88541 WP_003413891.1.88592 WP_003413891.1.88616 WP_003413891.1.88618 WP_003413891.1.88625 WP_003413891.1.88632 WP_003413891.1.88634 WP_003413891.1.88649 WP_003413891.1.8870 WP_003413891.1.88737 WP_003413891.1.88756 WP_003413891.1.888 WP_003413891.1.88824 WP_003413891.1.88886 WP_003413891.1.88965 WP_003413891.1.88985 WP_003413891.1.89025 WP_003413891.1.89041 WP_003413891.1.89082 WP_003413891.1.89162 WP_003413891.1.89168 WP_003413891.1.8917 WP_003413891.1.89193 WP_003413891.1.89205 WP_003413891.1.89207 WP_003413891.1.89225 WP_003413891.1.8925 WP_003413891.1.89277 WP_003413891.1.89286 WP_003413891.1.89293 WP_003413891.1.89320 WP_003413891.1.8935 WP_003413891.1.89371 WP_003413891.1.89378 WP_003413891.1.89392 WP_003413891.1.89406 WP_003413891.1.8943 WP_003413891.1.89451 WP_003413891.1.89453 WP_003413891.1.89473 WP_003413891.1.89475 WP_003413891.1.89483 WP_003413891.1.895 WP_003413891.1.89513 WP_003413891.1.89517 WP_003413891.1.89522 WP_003413891.1.89543 WP_003413891.1.89567 WP_003413891.1.8957 WP_003413891.1.89572 WP_003413891.1.89607 WP_003413891.1.89613 WP_003413891.1.89625 WP_003413891.1.89648 WP_003413891.1.8967 WP_003413891.1.89670 WP_003413891.1.89676 WP_003413891.1.89739 WP_003413891.1.89762 WP_003413891.1.8977 WP_003413891.1.89808 WP_003413891.1.8982 WP_003413891.1.89829 WP_003413891.1.89831 WP_003413891.1.89844 WP_003413891.1.89849 WP_003413891.1.8989 WP_003413891.1.89901 WP_003413891.1.89903 WP_003413891.1.89909 WP_003413891.1.89922 WP_003413891.1.89926 WP_003413891.1.89963 WP_003413891.1.89971 WP_003413891.1.8998 WP_003413891.1.89987 WP_003413891.1.900 WP_003413891.1.90048 WP_003413891.1.9007 WP_003413891.1.90080 WP_003413891.1.90130 WP_003413891.1.90134 WP_003413891.1.90137 WP_003413891.1.90157 WP_003413891.1.90184 WP_003413891.1.90199 WP_003413891.1.90231 WP_003413891.1.90245 WP_003413891.1.90308 WP_003413891.1.90322 WP_003413891.1.90328 WP_003413891.1.90372 WP_003413891.1.90439 WP_003413891.1.90481 WP_003413891.1.90499 WP_003413891.1.9050 WP_003413891.1.90527 WP_003413891.1.90550 WP_003413891.1.90560 WP_003413891.1.90612 WP_003413891.1.90640 WP_003413891.1.90672 WP_003413891.1.90687 WP_003413891.1.90691 WP_003413891.1.90711 WP_003413891.1.90722 WP_003413891.1.90744 WP_003413891.1.9075 WP_003413891.1.90756 WP_003413891.1.90767 WP_003413891.1.90771 WP_003413891.1.90785 WP_003413891.1.90788 WP_003413891.1.90800 WP_003413891.1.90810 WP_003413891.1.90816 WP_003413891.1.90819 WP_003413891.1.9082 WP_003413891.1.90831 WP_003413891.1.90884 WP_003413891.1.90899 WP_003413891.1.90906 WP_003413891.1.90958 WP_003413891.1.90976 WP_003413891.1.90987 WP_003413891.1.9102 WP_003413891.1.91026 WP_003413891.1.91032 WP_003413891.1.91043 WP_003413891.1.91053 WP_003413891.1.91082 WP_003413891.1.91106 WP_003413891.1.91144 WP_003413891.1.91151 WP_003413891.1.91157 WP_003413891.1.91167 WP_003413891.1.91169 WP_003413891.1.91192 WP_003413891.1.91201 WP_003413891.1.91207 WP_003413891.1.91208 WP_003413891.1.91211 WP_003413891.1.91214 WP_003413891.1.91244 WP_003413891.1.91251 WP_003413891.1.91260 WP_003413891.1.91265 WP_003413891.1.9128 WP_003413891.1.91284 WP_003413891.1.91294 WP_003413891.1.91303 WP_003413891.1.91322 WP_003413891.1.91352 WP_003413891.1.91386 WP_003413891.1.9139 WP_003413891.1.91398 WP_003413891.1.91411 WP_003413891.1.91430 WP_003413891.1.91436 WP_003413891.1.91483 WP_003413891.1.91496 WP_003413891.1.91508 WP_003413891.1.91576 WP_003413891.1.91589 WP_003413891.1.91694 WP_003413891.1.91713 WP_003413891.1.91716 WP_003413891.1.91717 WP_003413891.1.91728 WP_003413891.1.91743 WP_003413891.1.91759 WP_003413891.1.91784 WP_003413891.1.91785 WP_003413891.1.91786 WP_003413891.1.91802 WP_003413891.1.91822 WP_003413891.1.91828 WP_003413891.1.9189 WP_003413891.1.91896 WP_003413891.1.9190 WP_003413891.1.91915 WP_003413891.1.91931 WP_003413891.1.91937 WP_003413891.1.91944 WP_003413891.1.91953 WP_003413891.1.91957 WP_003413891.1.91976 WP_003413891.1.91978 WP_003413891.1.92021 WP_003413891.1.92083 WP_003413891.1.92127 WP_003413891.1.92144 WP_003413891.1.92150 WP_003413891.1.92153 WP_003413891.1.92190 WP_003413891.1.92192 WP_003413891.1.92200 WP_003413891.1.92220 WP_003413891.1.92221 WP_003413891.1.92222 WP_003413891.1.92273 WP_003413891.1.92289 WP_003413891.1.9229 WP_003413891.1.92294 WP_003413891.1.92300 WP_003413891.1.92317 WP_003413891.1.92334 WP_003413891.1.92338 WP_003413891.1.92345 WP_003413891.1.92356 WP_003413891.1.92364 WP_003413891.1.92380 WP_003413891.1.92416 WP_003413891.1.92428 WP_003413891.1.92447 WP_003413891.1.92456 WP_003413891.1.92467 WP_003413891.1.92471 WP_003413891.1.92490 WP_003413891.1.92508 WP_003413891.1.9251 WP_003413891.1.92511 WP_003413891.1.92523 WP_003413891.1.92527 WP_003413891.1.92536 WP_003413891.1.92592 WP_003413891.1.92597 WP_003413891.1.92603 WP_003413891.1.92606 WP_003413891.1.92610 WP_003413891.1.92613 WP_003413891.1.9263 WP_003413891.1.9265 WP_003413891.1.92650 WP_003413891.1.92660 WP_003413891.1.92677 WP_003413891.1.92685 WP_003413891.1.92689 WP_003413891.1.92690 WP_003413891.1.92706 WP_003413891.1.92714 WP_003413891.1.92736 WP_003413891.1.9274 WP_003413891.1.92752 WP_003413891.1.92760 WP_003413891.1.92777 WP_003413891.1.92803 WP_003413891.1.92833 WP_003413891.1.92856 WP_003413891.1.92892 WP_003413891.1.92907 WP_003413891.1.92908 WP_003413891.1.9291 WP_003413891.1.92917 WP_003413891.1.92996 WP_003413891.1.93006 WP_003413891.1.93008 WP_003413891.1.93009 WP_003413891.1.93043 WP_003413891.1.9307 WP_003413891.1.93083 WP_003413891.1.93097 WP_003413891.1.93137 WP_003413891.1.93192 WP_003413891.1.93199 WP_003413891.1.93203 WP_003413891.1.93212 WP_003413891.1.93234 WP_003413891.1.93245 WP_003413891.1.93257 WP_003413891.1.93265 WP_003413891.1.93297 WP_003413891.1.93320 WP_003413891.1.93328 WP_003413891.1.93337 WP_003413891.1.93343 WP_003413891.1.93349 WP_003413891.1.93363 WP_003413891.1.93377 WP_003413891.1.9338 WP_003413891.1.93407 WP_003413891.1.93417 WP_003413891.1.93419 WP_003413891.1.93426 WP_003413891.1.9344 WP_003413891.1.93443 WP_003413891.1.93447 WP_003413891.1.93470 WP_003413891.1.93483 WP_003413891.1.93487 WP_003413891.1.93495 WP_003413891.1.93499 WP_003413891.1.93516 WP_003413891.1.93536 WP_003413891.1.93544 WP_003413891.1.93555 WP_003413891.1.93560 WP_003413891.1.93564 WP_003413891.1.9357 WP_003413891.1.93573 WP_003413891.1.93576 WP_003413891.1.93588 WP_003413891.1.9363 WP_003413891.1.93649 WP_003413891.1.93659 WP_003413891.1.93677 WP_003413891.1.9368 WP_003413891.1.93689 WP_003413891.1.93693 WP_003413891.1.93698 WP_003413891.1.93706 WP_003413891.1.9371 WP_003413891.1.93792 WP_003413891.1.93823 WP_003413891.1.93871 WP_003413891.1.9388 WP_003413891.1.93894 WP_003413891.1.93903 WP_003413891.1.93907 WP_003413891.1.93913 WP_003413891.1.93946 WP_003413891.1.93950 WP_003413891.1.93953 WP_003413891.1.93988 WP_003413891.1.9407 WP_003413891.1.94143 WP_003413891.1.94154 WP_003413891.1.94184 WP_003413891.1.94204 WP_003413891.1.94205 WP_003413891.1.94226 WP_003413891.1.94231 WP_003413891.1.94256 WP_003413891.1.94261 WP_003413891.1.94281 WP_003413891.1.94292 WP_003413891.1.94297 WP_003413891.1.9431 WP_003413891.1.94326 WP_003413891.1.94339 WP_003413891.1.94392 WP_003413891.1.94416 WP_003413891.1.94421 WP_003413891.1.94456 WP_003413891.1.94470 WP_003413891.1.94480 WP_003413891.1.94495 WP_003413891.1.94511 WP_003413891.1.94512 WP_003413891.1.94525 WP_003413891.1.94528 WP_003413891.1.94564 WP_003413891.1.946 WP_003413891.1.94602 WP_003413891.1.94623 WP_003413891.1.94629 WP_003413891.1.9465 WP_003413891.1.94673 WP_003413891.1.94714 WP_003413891.1.94730 WP_003413891.1.94736 WP_003413891.1.94776 WP_003413891.1.9478 WP_003413891.1.94834 WP_003413891.1.94852 WP_003413891.1.94872 WP_003413891.1.9488 WP_003413891.1.94902 WP_003413891.1.94916 WP_003413891.1.94979 WP_003413891.1.94994 WP_003413891.1.94998 WP_003413891.1.95007 WP_003413891.1.95010 WP_003413891.1.95015 WP_003413891.1.95034 WP_003413891.1.95068 WP_003413891.1.95081 WP_003413891.1.95082 WP_003413891.1.9509 WP_003413891.1.95096 WP_003413891.1.95112 WP_003413891.1.95138 WP_003413891.1.9514 WP_003413891.1.95179 WP_003413891.1.95188 WP_003413891.1.95190 WP_003413891.1.95234 WP_003413891.1.95245 WP_003413891.1.95257 WP_003413891.1.95279 WP_003413891.1.9531 WP_003413891.1.95335 WP_003413891.1.95344 WP_003413891.1.9535 WP_003413891.1.95370 WP_003413891.1.95392 WP_003413891.1.95416 WP_003413891.1.95417 WP_003413891.1.95454 WP_003413891.1.95455 WP_003413891.1.95491 WP_003413891.1.95497 WP_003413891.1.95508 WP_003413891.1.95509 WP_003413891.1.95529 WP_003413891.1.95556 WP_003413891.1.95557 WP_003413891.1.95565 WP_003413891.1.95578 WP_003413891.1.95580 WP_003413891.1.95643 WP_003413891.1.95679 WP_003413891.1.95685 WP_003413891.1.957 WP_003413891.1.95724 WP_003413891.1.95727 WP_003413891.1.95730 WP_003413891.1.95735 WP_003413891.1.95758 WP_003413891.1.95772 WP_003413891.1.95797 WP_003413891.1.95839 WP_003413891.1.9585 WP_003413891.1.9590 WP_003413891.1.95902 WP_003413891.1.95908 WP_003413891.1.95924 WP_003413891.1.95926 WP_003413891.1.95953 WP_003413891.1.95958 WP_003413891.1.95964 WP_003413891.1.95973 WP_003413891.1.96006 WP_003413891.1.9602 WP_003413891.1.96036 WP_003413891.1.96062 WP_003413891.1.96065 WP_003413891.1.96098 WP_003413891.1.96146 WP_003413891.1.96166 WP_003413891.1.96171 WP_003413891.1.96182 WP_003413891.1.96204 WP_003413891.1.96230 WP_003413891.1.96235 WP_003413891.1.96242 WP_003413891.1.96245 WP_003413891.1.96254 WP_003413891.1.96259 WP_003413891.1.96286 WP_003413891.1.96313 WP_003413891.1.96318 WP_003413891.1.96345 WP_003413891.1.96360 WP_003413891.1.96373 WP_003413891.1.96456 WP_003413891.1.96486 WP_003413891.1.96560 WP_003413891.1.96569 WP_003413891.1.96573 WP_003413891.1.96575 WP_003413891.1.96576 WP_003413891.1.96611 WP_003413891.1.96621 WP_003413891.1.9667 WP_003413891.1.96681 WP_003413891.1.96726 WP_003413891.1.96733 WP_003413891.1.96742 WP_003413891.1.96754 WP_003413891.1.9678 WP_003413891.1.9685 WP_003413891.1.97008 WP_003413891.1.97009 WP_003413891.1.97056 WP_003413891.1.97084 WP_003413891.1.97087 WP_003413891.1.97094 WP_003413891.1.97096 WP_003413891.1.97099 WP_003413891.1.97108 WP_003413891.1.97113 WP_003413891.1.97122 WP_003413891.1.97127 WP_003413891.1.97129 WP_003413891.1.97136 WP_003413891.1.9716 WP_003413891.1.97176 WP_003413891.1.97222 WP_003413891.1.97223 WP_003413891.1.97237 WP_003413891.1.97242 WP_003413891.1.97270 WP_003413891.1.97283 WP_003413891.1.97296 WP_003413891.1.97321 WP_003413891.1.97325 WP_003413891.1.97330 WP_003413891.1.97366 WP_003413891.1.97376 WP_003413891.1.97380 WP_003413891.1.9739 WP_003413891.1.97462 WP_003413891.1.97517 WP_003413891.1.97519 WP_003413891.1.97535 WP_003413891.1.97540 WP_003413891.1.97545 WP_003413891.1.97546 WP_003413891.1.97550 WP_003413891.1.97568 WP_003413891.1.97577 WP_003413891.1.97584 WP_003413891.1.9759 WP_003413891.1.97591 WP_003413891.1.97596 WP_003413891.1.97609 WP_003413891.1.97618 WP_003413891.1.9763 WP_003413891.1.97669 WP_003413891.1.97673 WP_003413891.1.97700 WP_003413891.1.97701 WP_003413891.1.9773 WP_003413891.1.97730 WP_003413891.1.97740 WP_003413891.1.97751 WP_003413891.1.97754 WP_003413891.1.97797 WP_003413891.1.9782 WP_003413891.1.9784 WP_003413891.1.97888 WP_003413891.1.9795 WP_003413891.1.97951 WP_003413891.1.97958 WP_003413891.1.97966 WP_003413891.1.97977 WP_003413891.1.97979 WP_003413891.1.97995 WP_003413891.1.98018 WP_003413891.1.98034 WP_003413891.1.98071 WP_003413891.1.98072 WP_003413891.1.98113 WP_003413891.1.98114 WP_003413891.1.98128 WP_003413891.1.98181 WP_003413891.1.98188 WP_003413891.1.98189 WP_003413891.1.98213 WP_003413891.1.98225 WP_003413891.1.98291 WP_003413891.1.98335 WP_003413891.1.98350 WP_003413891.1.98395 WP_003413891.1.98412 WP_003413891.1.98441 WP_003413891.1.98443 WP_003413891.1.98462 WP_003413891.1.9848 WP_003413891.1.98482 WP_003413891.1.98486 WP_003413891.1.98488 WP_003413891.1.98503 WP_003413891.1.98516 WP_003413891.1.98524 WP_003413891.1.98536 WP_003413891.1.98541 WP_003413891.1.98566 WP_003413891.1.98576 WP_003413891.1.98590 WP_003413891.1.98594 WP_003413891.1.98599 WP_003413891.1.98629 WP_003413891.1.98645 WP_003413891.1.98646 WP_003413891.1.98649 WP_003413891.1.98656 WP_003413891.1.9867 WP_003413891.1.98674 WP_003413891.1.98697 WP_003413891.1.98701 WP_003413891.1.98739 WP_003413891.1.98749 WP_003413891.1.98765 WP_003413891.1.98770 WP_003413891.1.98777 WP_003413891.1.98778 WP_003413891.1.98802 WP_003413891.1.98838 WP_003413891.1.98850 WP_003413891.1.98906 WP_003413891.1.98935 WP_003413891.1.98948 WP_003413891.1.98953 WP_003413891.1.98984 WP_003413891.1.99000 WP_003413891.1.99023 WP_003413891.1.99030 WP_003413891.1.99037 WP_003413891.1.99055 WP_003413891.1.99062 WP_003413891.1.99086 WP_003413891.1.99115 WP_003413891.1.99117 WP_003413891.1.99161 WP_003413891.1.99176 WP_003413891.1.99205 WP_003413891.1.99211 WP_003413891.1.99216 WP_003413891.1.99269 WP_003413891.1.99294 WP_003413891.1.99312 WP_003413891.1.99315 WP_003413891.1.99316 WP_003413891.1.99322 WP_003413891.1.99328 WP_003413891.1.99365 WP_003413891.1.99368 WP_003413891.1.99379 WP_003413891.1.99396 WP_003413891.1.99402 WP_003413891.1.99404 WP_003413891.1.99419 WP_003413891.1.99438 WP_003413891.1.99460 WP_003413891.1.99468 WP_003413891.1.99473 WP_003413891.1.99513 WP_003413891.1.99529 WP_003413891.1.99548 WP_003413891.1.99572 WP_003413891.1.99575 WP_003413891.1.99578 WP_003413891.1.99605 WP_003413891.1.99609 WP_003413891.1.99617 WP_003413891.1.99635 WP_003413891.1.99650 WP_003413891.1.99672 WP_003413891.1.99701 WP_003413891.1.99711 WP_003413891.1.99716 WP_003413891.1.99740 WP_003413891.1.99745 WP_003413891.1.99749 WP_003413891.1.9976 WP_003413891.1.99798 WP_003413891.1.99817 WP_003413891.1.99832 WP_003413891.1.99847 WP_003413891.1.99852 WP_003413891.1.99886 WP_003413891.1.99897 WP_003413891.1.99899 WP_003413891.1.99915 WP_003413891.1.9993 WP_003413891.1.99982 YP_177898.1.84033 gi|392387314|ref|YP_005308943.1| gi|525675212|ref|YP_008226777.1| gi|197738334|ref|YP_002159649.1| gi|339632694|ref|YP_004724336.1| gi|253798236|ref|YP_003031237.1| gi|506927220|ref|YP_008007670.1| gi|506927220|ref|YP_008007670.1| gi|471338688|ref|YP_007611401.1| gi|57117013|ref|YP_177898.1| gi|385991969|ref|YP_005910267.1| gi|148823872|ref|YP_001288626.1| gi|224991049|ref|YP_002645738.1| 233413.Mb2701c 336982.TBFG_12697 410289.BCG_2695c 419947.MRA_2710 478434.TBMG_01291 561275.JTY_2689 83331.MT2756 83332.Rv2682c gi|31793854|ref|NP_856347.1| gi|378772412|ref|YP_005172145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]