SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378772742|ref|YP_005172475.1| from Mycobacterium bovis BCG str. Mexico

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378772742|ref|YP_005172475.1|
Domain Number 1 Region: 403-605
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.93e-67
Family Pyruvate oxidase and decarboxylase PP module 0.00001
Further Details:      
 
Domain Number 2 Region: 220-394
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 8.79e-63
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000308
Further Details:      
 
Domain Number 3 Region: 36-219
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.79e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378772742|ref|YP_005172475.1|
Sequence length 618
Comment acetolactate synthase [Mycobacterium bovis BCG str. Mexico]
Sequence
MSAPTKPHSPTFKPEPHSAANEPKHPAARPKHVALQQLTGAQAVIRSLEELGVDVIFGIP
GGAVLPVYDPLFDSKKLRHVLVRHEQGAGHAASGYAHVTGRVGVCMATSGPGATNLVTPL
ADAQMDSIPVVAITGQVGRGLIGTDAFQEADISGITMPITKHNFLVRSGDDIPRVLAEAF
HIAASGRPGAVLVDIPKDVLQGQCTFSWPPRMELPGYKPNTKPHSRQVREAAKLIAAARK
PVLYVGGGVIRGEATEQLRELAELTGIPVVTTLMARGAFPDSHRQNLGMPGMHGTVAAVA
ALQRSDLLIALGTRFDDRVTGKLDSFAPEAKVIHADIDPAEIGKNRHADVPIVGDVKAVI
TELIAMLRHHHIPGTIEMADWWAYLNGVRKTYPLSYGPQSDGSLSPEYVIEKLGEIAGPD
AVFVAGVGQHQMWAAQFIRYEKPRSWLNSGGLGTMGFAIPAAMGAKIALPGTEVWAIDGD
GCFQMTNQELATCAVEGIPVKVALINNGNLGMVRQWQSLFYAERYSQTDLATHSHRIPDF
VKLAEALGCVGLRCEREEDVVDVINQARAINDCPVVIDFIVGADAQVWPMVAAGTSNDEI
QAARGIRPLFDDITEGHA
Download sequence
Identical sequences A0A045JGR5 A0A083VXC4 A0A0H3LKE9 A0A0H3MGU7 A0A0K2HZW5 A0A109SQU3 A0A109SZS5 A0A197IU62 A0A1S1B7U2 A5U715 F8M503 I6YEX6 M8CJ76 P0A623 P9WG40 P9WG41
gi|392431381|ref|YP_006472425.1| gi|385992257|ref|YP_005910555.1| gi|148662854|ref|YP_001284377.1| Rv3003c gi|471339033|ref|YP_007611746.1| WP_003415168.1.100000 WP_003415168.1.100021 WP_003415168.1.100069 WP_003415168.1.100087 WP_003415168.1.10015 WP_003415168.1.100208 WP_003415168.1.100216 WP_003415168.1.10022 WP_003415168.1.100255 WP_003415168.1.100260 WP_003415168.1.100270 WP_003415168.1.100279 WP_003415168.1.100286 WP_003415168.1.100308 WP_003415168.1.100309 WP_003415168.1.100318 WP_003415168.1.100337 WP_003415168.1.100338 WP_003415168.1.10037 WP_003415168.1.100396 WP_003415168.1.1004 WP_003415168.1.100401 WP_003415168.1.100459 WP_003415168.1.100460 WP_003415168.1.100552 WP_003415168.1.100581 WP_003415168.1.100600 WP_003415168.1.100625 WP_003415168.1.10064 WP_003415168.1.100666 WP_003415168.1.100671 WP_003415168.1.100677 WP_003415168.1.100682 WP_003415168.1.100697 WP_003415168.1.100703 WP_003415168.1.100716 WP_003415168.1.100722 WP_003415168.1.100754 WP_003415168.1.100757 WP_003415168.1.100772 WP_003415168.1.1008 WP_003415168.1.100812 WP_003415168.1.100845 WP_003415168.1.100866 WP_003415168.1.10088 WP_003415168.1.100889 WP_003415168.1.10090 WP_003415168.1.100910 WP_003415168.1.100915 WP_003415168.1.100918 WP_003415168.1.100935 WP_003415168.1.100984 WP_003415168.1.100992 WP_003415168.1.100998 WP_003415168.1.101028 WP_003415168.1.10104 WP_003415168.1.101048 WP_003415168.1.101054 WP_003415168.1.101075 WP_003415168.1.101143 WP_003415168.1.101146 WP_003415168.1.10116 WP_003415168.1.10117 WP_003415168.1.101209 WP_003415168.1.10125 WP_003415168.1.101290 WP_003415168.1.101323 WP_003415168.1.101324 WP_003415168.1.101350 WP_003415168.1.101367 WP_003415168.1.101398 WP_003415168.1.101403 WP_003415168.1.101421 WP_003415168.1.10144 WP_003415168.1.101442 WP_003415168.1.10145 WP_003415168.1.101452 WP_003415168.1.101456 WP_003415168.1.101493 WP_003415168.1.101496 WP_003415168.1.101525 WP_003415168.1.101533 WP_003415168.1.101535 WP_003415168.1.101553 WP_003415168.1.101558 WP_003415168.1.10156 WP_003415168.1.101573 WP_003415168.1.101576 WP_003415168.1.10159 WP_003415168.1.101592 WP_003415168.1.101604 WP_003415168.1.101607 WP_003415168.1.101622 WP_003415168.1.101644 WP_003415168.1.101659 WP_003415168.1.101671 WP_003415168.1.101687 WP_003415168.1.101698 WP_003415168.1.10170 WP_003415168.1.101713 WP_003415168.1.101722 WP_003415168.1.101733 WP_003415168.1.101743 WP_003415168.1.101753 WP_003415168.1.101754 WP_003415168.1.101764 WP_003415168.1.101773 WP_003415168.1.101795 WP_003415168.1.101797 WP_003415168.1.101798 WP_003415168.1.101802 WP_003415168.1.101826 WP_003415168.1.101836 WP_003415168.1.101858 WP_003415168.1.101859 WP_003415168.1.101862 WP_003415168.1.101888 WP_003415168.1.101894 WP_003415168.1.101899 WP_003415168.1.1019 WP_003415168.1.101923 WP_003415168.1.101925 WP_003415168.1.10193 WP_003415168.1.101996 WP_003415168.1.102 WP_003415168.1.102008 WP_003415168.1.102017 WP_003415168.1.102053 WP_003415168.1.102055 WP_003415168.1.102063 WP_003415168.1.102099 WP_003415168.1.10211 WP_003415168.1.102119 WP_003415168.1.102121 WP_003415168.1.102143 WP_003415168.1.10216 WP_003415168.1.10224 WP_003415168.1.10253 WP_003415168.1.10262 WP_003415168.1.10272 WP_003415168.1.10277 WP_003415168.1.1033 WP_003415168.1.10350 WP_003415168.1.10362 WP_003415168.1.10366 WP_003415168.1.10376 WP_003415168.1.10396 WP_003415168.1.10410 WP_003415168.1.10414 WP_003415168.1.10421 WP_003415168.1.10430 WP_003415168.1.1044 WP_003415168.1.10440 WP_003415168.1.10445 WP_003415168.1.10471 WP_003415168.1.10472 WP_003415168.1.10489 WP_003415168.1.105 WP_003415168.1.10518 WP_003415168.1.10523 WP_003415168.1.10545 WP_003415168.1.1057 WP_003415168.1.10594 WP_003415168.1.10603 WP_003415168.1.10606 WP_003415168.1.10615 WP_003415168.1.10623 WP_003415168.1.10635 WP_003415168.1.10643 WP_003415168.1.10648 WP_003415168.1.10662 WP_003415168.1.10709 WP_003415168.1.10735 WP_003415168.1.10740 WP_003415168.1.10756 WP_003415168.1.1078 WP_003415168.1.10791 WP_003415168.1.10799 WP_003415168.1.10825 WP_003415168.1.10848 WP_003415168.1.10863 WP_003415168.1.10879 WP_003415168.1.10912 WP_003415168.1.10916 WP_003415168.1.10923 WP_003415168.1.10927 WP_003415168.1.1095 WP_003415168.1.10956 WP_003415168.1.10958 WP_003415168.1.10962 WP_003415168.1.10980 WP_003415168.1.10981 WP_003415168.1.10993 WP_003415168.1.1100 WP_003415168.1.11040 WP_003415168.1.11061 WP_003415168.1.11070 WP_003415168.1.11141 WP_003415168.1.11171 WP_003415168.1.11175 WP_003415168.1.11176 WP_003415168.1.11222 WP_003415168.1.11236 WP_003415168.1.11329 WP_003415168.1.1133 WP_003415168.1.11342 WP_003415168.1.11373 WP_003415168.1.11376 WP_003415168.1.11390 WP_003415168.1.11402 WP_003415168.1.11481 WP_003415168.1.11487 WP_003415168.1.11489 WP_003415168.1.11491 WP_003415168.1.11514 WP_003415168.1.11587 WP_003415168.1.11589 WP_003415168.1.11596 WP_003415168.1.11604 WP_003415168.1.11610 WP_003415168.1.11697 WP_003415168.1.11707 WP_003415168.1.11752 WP_003415168.1.11758 WP_003415168.1.11761 WP_003415168.1.11775 WP_003415168.1.11804 WP_003415168.1.11822 WP_003415168.1.11826 WP_003415168.1.11898 WP_003415168.1.11906 WP_003415168.1.11939 WP_003415168.1.11960 WP_003415168.1.11961 WP_003415168.1.11972 WP_003415168.1.11984 WP_003415168.1.120 WP_003415168.1.12001 WP_003415168.1.12049 WP_003415168.1.12052 WP_003415168.1.12100 WP_003415168.1.12116 WP_003415168.1.12130 WP_003415168.1.12133 WP_003415168.1.12161 WP_003415168.1.12165 WP_003415168.1.12184 WP_003415168.1.12187 WP_003415168.1.12190 WP_003415168.1.12216 WP_003415168.1.12265 WP_003415168.1.12275 WP_003415168.1.12293 WP_003415168.1.12294 WP_003415168.1.123 WP_003415168.1.1231 WP_003415168.1.12314 WP_003415168.1.12327 WP_003415168.1.12338 WP_003415168.1.12371 WP_003415168.1.12372 WP_003415168.1.12389 WP_003415168.1.12406 WP_003415168.1.1241 WP_003415168.1.12421 WP_003415168.1.12424 WP_003415168.1.12464 WP_003415168.1.12479 WP_003415168.1.12519 WP_003415168.1.12523 WP_003415168.1.1255 WP_003415168.1.12550 WP_003415168.1.12551 WP_003415168.1.12563 WP_003415168.1.12611 WP_003415168.1.12669 WP_003415168.1.1267 WP_003415168.1.12672 WP_003415168.1.12692 WP_003415168.1.1271 WP_003415168.1.12710 WP_003415168.1.12768 WP_003415168.1.1279 WP_003415168.1.12794 WP_003415168.1.12801 WP_003415168.1.12804 WP_003415168.1.12821 WP_003415168.1.12841 WP_003415168.1.12854 WP_003415168.1.12871 WP_003415168.1.12901 WP_003415168.1.12941 WP_003415168.1.12947 WP_003415168.1.12957 WP_003415168.1.12972 WP_003415168.1.13028 WP_003415168.1.13043 WP_003415168.1.13086 WP_003415168.1.13087 WP_003415168.1.13090 WP_003415168.1.13096 WP_003415168.1.13163 WP_003415168.1.13175 WP_003415168.1.13183 WP_003415168.1.132 WP_003415168.1.13249 WP_003415168.1.13282 WP_003415168.1.13284 WP_003415168.1.13296 WP_003415168.1.13298 WP_003415168.1.13302 WP_003415168.1.13306 WP_003415168.1.13312 WP_003415168.1.13321 WP_003415168.1.13345 WP_003415168.1.13358 WP_003415168.1.13370 WP_003415168.1.13375 WP_003415168.1.1338 WP_003415168.1.13420 WP_003415168.1.13433 WP_003415168.1.13435 WP_003415168.1.13438 WP_003415168.1.13461 WP_003415168.1.13466 WP_003415168.1.13489 WP_003415168.1.13526 WP_003415168.1.13551 WP_003415168.1.13561 WP_003415168.1.13564 WP_003415168.1.13579 WP_003415168.1.13687 WP_003415168.1.13697 WP_003415168.1.13719 WP_003415168.1.13763 WP_003415168.1.1377 WP_003415168.1.13774 WP_003415168.1.13786 WP_003415168.1.13793 WP_003415168.1.13794 WP_003415168.1.13817 WP_003415168.1.13834 WP_003415168.1.13866 WP_003415168.1.13880 WP_003415168.1.13899 WP_003415168.1.13909 WP_003415168.1.13910 WP_003415168.1.13919 WP_003415168.1.13920 WP_003415168.1.13952 WP_003415168.1.13953 WP_003415168.1.13962 WP_003415168.1.1398 WP_003415168.1.13988 WP_003415168.1.14027 WP_003415168.1.14046 WP_003415168.1.14115 WP_003415168.1.1415 WP_003415168.1.14152 WP_003415168.1.14158 WP_003415168.1.14162 WP_003415168.1.14175 WP_003415168.1.14178 WP_003415168.1.14194 WP_003415168.1.14195 WP_003415168.1.14208 WP_003415168.1.14238 WP_003415168.1.14266 WP_003415168.1.14273 WP_003415168.1.14303 WP_003415168.1.14306 WP_003415168.1.14307 WP_003415168.1.14310 WP_003415168.1.14341 WP_003415168.1.14382 WP_003415168.1.14416 WP_003415168.1.14428 WP_003415168.1.14441 WP_003415168.1.14469 WP_003415168.1.14477 WP_003415168.1.14504 WP_003415168.1.14514 WP_003415168.1.1452 WP_003415168.1.14527 WP_003415168.1.1454 WP_003415168.1.14544 WP_003415168.1.14548 WP_003415168.1.14551 WP_003415168.1.14561 WP_003415168.1.14573 WP_003415168.1.1462 WP_003415168.1.14658 WP_003415168.1.14667 WP_003415168.1.14668 WP_003415168.1.14675 WP_003415168.1.14694 WP_003415168.1.14695 WP_003415168.1.14709 WP_003415168.1.14766 WP_003415168.1.14783 WP_003415168.1.14865 WP_003415168.1.14872 WP_003415168.1.14905 WP_003415168.1.14926 WP_003415168.1.14951 WP_003415168.1.14955 WP_003415168.1.15009 WP_003415168.1.15028 WP_003415168.1.15040 WP_003415168.1.15052 WP_003415168.1.15065 WP_003415168.1.15072 WP_003415168.1.15089 WP_003415168.1.1509 WP_003415168.1.15126 WP_003415168.1.15131 WP_003415168.1.15168 WP_003415168.1.15172 WP_003415168.1.15174 WP_003415168.1.15187 WP_003415168.1.15196 WP_003415168.1.15210 WP_003415168.1.15216 WP_003415168.1.15217 WP_003415168.1.1523 WP_003415168.1.15232 WP_003415168.1.15238 WP_003415168.1.15240 WP_003415168.1.15253 WP_003415168.1.15267 WP_003415168.1.1527 WP_003415168.1.15292 WP_003415168.1.15299 WP_003415168.1.15302 WP_003415168.1.15322 WP_003415168.1.1534 WP_003415168.1.15345 WP_003415168.1.15365 WP_003415168.1.15372 WP_003415168.1.15386 WP_003415168.1.15387 WP_003415168.1.15442 WP_003415168.1.15447 WP_003415168.1.15449 WP_003415168.1.15477 WP_003415168.1.15481 WP_003415168.1.15492 WP_003415168.1.15511 WP_003415168.1.15512 WP_003415168.1.15558 WP_003415168.1.15559 WP_003415168.1.15566 WP_003415168.1.15599 WP_003415168.1.1560 WP_003415168.1.15611 WP_003415168.1.1563 WP_003415168.1.15633 WP_003415168.1.15643 WP_003415168.1.15688 WP_003415168.1.15755 WP_003415168.1.15763 WP_003415168.1.15774 WP_003415168.1.1578 WP_003415168.1.15780 WP_003415168.1.15827 WP_003415168.1.15834 WP_003415168.1.15842 WP_003415168.1.15848 WP_003415168.1.15853 WP_003415168.1.15870 WP_003415168.1.15877 WP_003415168.1.15893 WP_003415168.1.15896 WP_003415168.1.15926 WP_003415168.1.15933 WP_003415168.1.15946 WP_003415168.1.15958 WP_003415168.1.15973 WP_003415168.1.15987 WP_003415168.1.15993 WP_003415168.1.16009 WP_003415168.1.16025 WP_003415168.1.16043 WP_003415168.1.16066 WP_003415168.1.16069 WP_003415168.1.16077 WP_003415168.1.16106 WP_003415168.1.16108 WP_003415168.1.16110 WP_003415168.1.16130 WP_003415168.1.16136 WP_003415168.1.16139 WP_003415168.1.16143 WP_003415168.1.1630 WP_003415168.1.16318 WP_003415168.1.1632 WP_003415168.1.16327 WP_003415168.1.16334 WP_003415168.1.16341 WP_003415168.1.16345 WP_003415168.1.16374 WP_003415168.1.16384 WP_003415168.1.16386 WP_003415168.1.164 WP_003415168.1.1642 WP_003415168.1.16424 WP_003415168.1.16426 WP_003415168.1.16431 WP_003415168.1.1644 WP_003415168.1.16442 WP_003415168.1.16448 WP_003415168.1.16451 WP_003415168.1.16476 WP_003415168.1.16480 WP_003415168.1.16494 WP_003415168.1.1652 WP_003415168.1.16549 WP_003415168.1.16560 WP_003415168.1.16598 WP_003415168.1.16609 WP_003415168.1.16619 WP_003415168.1.16620 WP_003415168.1.16622 WP_003415168.1.16637 WP_003415168.1.1669 WP_003415168.1.16707 WP_003415168.1.16724 WP_003415168.1.16731 WP_003415168.1.16743 WP_003415168.1.1683 WP_003415168.1.16837 WP_003415168.1.16852 WP_003415168.1.16937 WP_003415168.1.16940 WP_003415168.1.16950 WP_003415168.1.16959 WP_003415168.1.16968 WP_003415168.1.1697 WP_003415168.1.16973 WP_003415168.1.16977 WP_003415168.1.16987 WP_003415168.1.17005 WP_003415168.1.17006 WP_003415168.1.17010 WP_003415168.1.17015 WP_003415168.1.17019 WP_003415168.1.17039 WP_003415168.1.17041 WP_003415168.1.17052 WP_003415168.1.17057 WP_003415168.1.17062 WP_003415168.1.1707 WP_003415168.1.17094 WP_003415168.1.17130 WP_003415168.1.17138 WP_003415168.1.17147 WP_003415168.1.17167 WP_003415168.1.17224 WP_003415168.1.17251 WP_003415168.1.17288 WP_003415168.1.17304 WP_003415168.1.17314 WP_003415168.1.17345 WP_003415168.1.17381 WP_003415168.1.17391 WP_003415168.1.17412 WP_003415168.1.1743 WP_003415168.1.17440 WP_003415168.1.17466 WP_003415168.1.17477 WP_003415168.1.17483 WP_003415168.1.17505 WP_003415168.1.17527 WP_003415168.1.17535 WP_003415168.1.17540 WP_003415168.1.17553 WP_003415168.1.17558 WP_003415168.1.17599 WP_003415168.1.17635 WP_003415168.1.17655 WP_003415168.1.17679 WP_003415168.1.1768 WP_003415168.1.17687 WP_003415168.1.17700 WP_003415168.1.17710 WP_003415168.1.17713 WP_003415168.1.17722 WP_003415168.1.17746 WP_003415168.1.17788 WP_003415168.1.17798 WP_003415168.1.17803 WP_003415168.1.17816 WP_003415168.1.17821 WP_003415168.1.17830 WP_003415168.1.17868 WP_003415168.1.17878 WP_003415168.1.1792 WP_003415168.1.1795 WP_003415168.1.17955 WP_003415168.1.17973 WP_003415168.1.18009 WP_003415168.1.18013 WP_003415168.1.18033 WP_003415168.1.18057 WP_003415168.1.18065 WP_003415168.1.18070 WP_003415168.1.18116 WP_003415168.1.18120 WP_003415168.1.18126 WP_003415168.1.1817 WP_003415168.1.18170 WP_003415168.1.18206 WP_003415168.1.18216 WP_003415168.1.18240 WP_003415168.1.18257 WP_003415168.1.18297 WP_003415168.1.18306 WP_003415168.1.18364 WP_003415168.1.18399 WP_003415168.1.18411 WP_003415168.1.18444 WP_003415168.1.18448 WP_003415168.1.18467 WP_003415168.1.18476 WP_003415168.1.18522 WP_003415168.1.18580 WP_003415168.1.18582 WP_003415168.1.18587 WP_003415168.1.186 WP_003415168.1.18601 WP_003415168.1.18639 WP_003415168.1.18646 WP_003415168.1.18647 WP_003415168.1.1868 WP_003415168.1.18694 WP_003415168.1.18710 WP_003415168.1.18781 WP_003415168.1.18793 WP_003415168.1.18804 WP_003415168.1.18816 WP_003415168.1.18823 WP_003415168.1.18827 WP_003415168.1.18838 WP_003415168.1.18849 WP_003415168.1.18856 WP_003415168.1.18945 WP_003415168.1.1898 WP_003415168.1.19005 WP_003415168.1.19056 WP_003415168.1.19063 WP_003415168.1.19066 WP_003415168.1.19071 WP_003415168.1.19085 WP_003415168.1.19094 WP_003415168.1.19144 WP_003415168.1.19159 WP_003415168.1.19193 WP_003415168.1.19231 WP_003415168.1.19243 WP_003415168.1.19264 WP_003415168.1.19295 WP_003415168.1.19307 WP_003415168.1.19326 WP_003415168.1.1933 WP_003415168.1.19364 WP_003415168.1.19382 WP_003415168.1.19400 WP_003415168.1.19426 WP_003415168.1.19429 WP_003415168.1.19464 WP_003415168.1.19480 WP_003415168.1.19512 WP_003415168.1.19553 WP_003415168.1.19562 WP_003415168.1.19564 WP_003415168.1.19568 WP_003415168.1.19572 WP_003415168.1.19596 WP_003415168.1.19600 WP_003415168.1.19630 WP_003415168.1.1967 WP_003415168.1.19694 WP_003415168.1.1970 WP_003415168.1.19707 WP_003415168.1.19742 WP_003415168.1.19785 WP_003415168.1.19820 WP_003415168.1.19868 WP_003415168.1.19874 WP_003415168.1.19890 WP_003415168.1.19900 WP_003415168.1.19922 WP_003415168.1.19936 WP_003415168.1.19946 WP_003415168.1.19949 WP_003415168.1.19960 WP_003415168.1.19964 WP_003415168.1.20007 WP_003415168.1.20016 WP_003415168.1.20028 WP_003415168.1.2003 WP_003415168.1.20037 WP_003415168.1.20039 WP_003415168.1.20082 WP_003415168.1.20085 WP_003415168.1.20097 WP_003415168.1.20116 WP_003415168.1.20130 WP_003415168.1.20140 WP_003415168.1.20141 WP_003415168.1.20142 WP_003415168.1.20158 WP_003415168.1.20239 WP_003415168.1.20243 WP_003415168.1.20259 WP_003415168.1.20262 WP_003415168.1.20268 WP_003415168.1.20272 WP_003415168.1.20273 WP_003415168.1.20280 WP_003415168.1.20294 WP_003415168.1.20300 WP_003415168.1.20309 WP_003415168.1.20322 WP_003415168.1.2037 WP_003415168.1.20372 WP_003415168.1.20381 WP_003415168.1.204 WP_003415168.1.20427 WP_003415168.1.20457 WP_003415168.1.20459 WP_003415168.1.20460 WP_003415168.1.20542 WP_003415168.1.20578 WP_003415168.1.20608 WP_003415168.1.20624 WP_003415168.1.20628 WP_003415168.1.2066 WP_003415168.1.20707 WP_003415168.1.20722 WP_003415168.1.20729 WP_003415168.1.20742 WP_003415168.1.20751 WP_003415168.1.20776 WP_003415168.1.20843 WP_003415168.1.20850 WP_003415168.1.2086 WP_003415168.1.20868 WP_003415168.1.20876 WP_003415168.1.20897 WP_003415168.1.20898 WP_003415168.1.20911 WP_003415168.1.20916 WP_003415168.1.20921 WP_003415168.1.20926 WP_003415168.1.20927 WP_003415168.1.20951 WP_003415168.1.20970 WP_003415168.1.2104 WP_003415168.1.21070 WP_003415168.1.21127 WP_003415168.1.21135 WP_003415168.1.21187 WP_003415168.1.212 WP_003415168.1.2120 WP_003415168.1.21218 WP_003415168.1.21219 WP_003415168.1.2123 WP_003415168.1.21231 WP_003415168.1.21234 WP_003415168.1.2126 WP_003415168.1.21292 WP_003415168.1.21307 WP_003415168.1.2131 WP_003415168.1.21311 WP_003415168.1.21321 WP_003415168.1.21365 WP_003415168.1.2137 WP_003415168.1.21392 WP_003415168.1.21397 WP_003415168.1.21403 WP_003415168.1.21415 WP_003415168.1.21418 WP_003415168.1.21430 WP_003415168.1.21434 WP_003415168.1.21444 WP_003415168.1.21468 WP_003415168.1.21498 WP_003415168.1.21509 WP_003415168.1.21513 WP_003415168.1.21560 WP_003415168.1.21565 WP_003415168.1.21586 WP_003415168.1.21591 WP_003415168.1.21594 WP_003415168.1.21602 WP_003415168.1.21615 WP_003415168.1.21638 WP_003415168.1.21639 WP_003415168.1.21655 WP_003415168.1.21658 WP_003415168.1.2168 WP_003415168.1.2174 WP_003415168.1.21741 WP_003415168.1.21742 WP_003415168.1.21777 WP_003415168.1.21786 WP_003415168.1.21795 WP_003415168.1.218 WP_003415168.1.21826 WP_003415168.1.21829 WP_003415168.1.21840 WP_003415168.1.21843 WP_003415168.1.21872 WP_003415168.1.2188 WP_003415168.1.21882 WP_003415168.1.21906 WP_003415168.1.21912 WP_003415168.1.2194 WP_003415168.1.21941 WP_003415168.1.21956 WP_003415168.1.21958 WP_003415168.1.21960 WP_003415168.1.21971 WP_003415168.1.21973 WP_003415168.1.21983 WP_003415168.1.22003 WP_003415168.1.22013 WP_003415168.1.22025 WP_003415168.1.22036 WP_003415168.1.22075 WP_003415168.1.22092 WP_003415168.1.2212 WP_003415168.1.22127 WP_003415168.1.22140 WP_003415168.1.22233 WP_003415168.1.22255 WP_003415168.1.22277 WP_003415168.1.22305 WP_003415168.1.22348 WP_003415168.1.22356 WP_003415168.1.22366 WP_003415168.1.2238 WP_003415168.1.22380 WP_003415168.1.22437 WP_003415168.1.22438 WP_003415168.1.22445 WP_003415168.1.22511 WP_003415168.1.22524 WP_003415168.1.2253 WP_003415168.1.22585 WP_003415168.1.22589 WP_003415168.1.22606 WP_003415168.1.22608 WP_003415168.1.22609 WP_003415168.1.22618 WP_003415168.1.2262 WP_003415168.1.22624 WP_003415168.1.22629 WP_003415168.1.22647 WP_003415168.1.22664 WP_003415168.1.22665 WP_003415168.1.22670 WP_003415168.1.22674 WP_003415168.1.22680 WP_003415168.1.22725 WP_003415168.1.22728 WP_003415168.1.22733 WP_003415168.1.22737 WP_003415168.1.2275 WP_003415168.1.22754 WP_003415168.1.22797 WP_003415168.1.22800 WP_003415168.1.22804 WP_003415168.1.22829 WP_003415168.1.22840 WP_003415168.1.22844 WP_003415168.1.22963 WP_003415168.1.22970 WP_003415168.1.22996 WP_003415168.1.22997 WP_003415168.1.22999 WP_003415168.1.23015 WP_003415168.1.23032 WP_003415168.1.231 WP_003415168.1.23101 WP_003415168.1.2312 WP_003415168.1.23140 WP_003415168.1.23153 WP_003415168.1.23171 WP_003415168.1.23199 WP_003415168.1.2320 WP_003415168.1.23204 WP_003415168.1.23216 WP_003415168.1.23229 WP_003415168.1.23233 WP_003415168.1.2326 WP_003415168.1.23261 WP_003415168.1.23272 WP_003415168.1.23289 WP_003415168.1.2329 WP_003415168.1.23308 WP_003415168.1.23316 WP_003415168.1.23321 WP_003415168.1.23325 WP_003415168.1.2339 WP_003415168.1.23406 WP_003415168.1.23438 WP_003415168.1.23445 WP_003415168.1.23447 WP_003415168.1.23452 WP_003415168.1.23461 WP_003415168.1.2349 WP_003415168.1.23496 WP_003415168.1.23497 WP_003415168.1.23506 WP_003415168.1.23530 WP_003415168.1.23539 WP_003415168.1.23546 WP_003415168.1.23551 WP_003415168.1.23573 WP_003415168.1.23583 WP_003415168.1.23588 WP_003415168.1.23628 WP_003415168.1.23677 WP_003415168.1.23683 WP_003415168.1.23692 WP_003415168.1.23694 WP_003415168.1.23699 WP_003415168.1.2371 WP_003415168.1.23807 WP_003415168.1.23825 WP_003415168.1.23832 WP_003415168.1.2384 WP_003415168.1.23843 WP_003415168.1.23863 WP_003415168.1.2387 WP_003415168.1.23894 WP_003415168.1.23993 WP_003415168.1.2400 WP_003415168.1.24007 WP_003415168.1.24008 WP_003415168.1.24046 WP_003415168.1.24057 WP_003415168.1.24062 WP_003415168.1.24113 WP_003415168.1.24119 WP_003415168.1.24128 WP_003415168.1.24140 WP_003415168.1.24176 WP_003415168.1.24190 WP_003415168.1.24202 WP_003415168.1.24261 WP_003415168.1.24284 WP_003415168.1.24294 WP_003415168.1.24357 WP_003415168.1.24396 WP_003415168.1.24414 WP_003415168.1.24423 WP_003415168.1.2443 WP_003415168.1.24446 WP_003415168.1.24461 WP_003415168.1.24500 WP_003415168.1.24507 WP_003415168.1.24509 WP_003415168.1.24529 WP_003415168.1.24553 WP_003415168.1.24599 WP_003415168.1.24629 WP_003415168.1.24638 WP_003415168.1.24648 WP_003415168.1.2466 WP_003415168.1.24824 WP_003415168.1.24831 WP_003415168.1.24840 WP_003415168.1.24848 WP_003415168.1.24857 WP_003415168.1.2487 WP_003415168.1.24893 WP_003415168.1.24907 WP_003415168.1.24933 WP_003415168.1.24956 WP_003415168.1.24958 WP_003415168.1.24985 WP_003415168.1.2499 WP_003415168.1.25004 WP_003415168.1.2505 WP_003415168.1.25051 WP_003415168.1.2507 WP_003415168.1.25096 WP_003415168.1.25103 WP_003415168.1.25129 WP_003415168.1.25171 WP_003415168.1.25184 WP_003415168.1.25247 WP_003415168.1.25252 WP_003415168.1.25278 WP_003415168.1.25283 WP_003415168.1.25309 WP_003415168.1.25313 WP_003415168.1.25338 WP_003415168.1.25342 WP_003415168.1.25343 WP_003415168.1.25367 WP_003415168.1.25393 WP_003415168.1.25406 WP_003415168.1.25435 WP_003415168.1.25437 WP_003415168.1.25445 WP_003415168.1.25455 WP_003415168.1.25473 WP_003415168.1.25504 WP_003415168.1.25513 WP_003415168.1.25542 WP_003415168.1.25579 WP_003415168.1.25594 WP_003415168.1.25606 WP_003415168.1.25645 WP_003415168.1.25673 WP_003415168.1.25674 WP_003415168.1.25693 WP_003415168.1.25699 WP_003415168.1.25727 WP_003415168.1.25736 WP_003415168.1.25738 WP_003415168.1.25756 WP_003415168.1.25759 WP_003415168.1.2580 WP_003415168.1.25813 WP_003415168.1.25853 WP_003415168.1.25854 WP_003415168.1.25874 WP_003415168.1.25885 WP_003415168.1.25892 WP_003415168.1.25906 WP_003415168.1.25914 WP_003415168.1.25916 WP_003415168.1.2594 WP_003415168.1.25954 WP_003415168.1.25965 WP_003415168.1.25972 WP_003415168.1.26017 WP_003415168.1.26032 WP_003415168.1.26038 WP_003415168.1.26072 WP_003415168.1.26089 WP_003415168.1.26097 WP_003415168.1.26098 WP_003415168.1.26108 WP_003415168.1.26109 WP_003415168.1.26118 WP_003415168.1.26126 WP_003415168.1.2614 WP_003415168.1.26168 WP_003415168.1.26182 WP_003415168.1.26190 WP_003415168.1.2620 WP_003415168.1.26234 WP_003415168.1.26243 WP_003415168.1.26265 WP_003415168.1.26267 WP_003415168.1.26292 WP_003415168.1.26310 WP_003415168.1.26328 WP_003415168.1.26349 WP_003415168.1.26366 WP_003415168.1.26374 WP_003415168.1.26407 WP_003415168.1.26412 WP_003415168.1.26454 WP_003415168.1.26464 WP_003415168.1.2653 WP_003415168.1.26560 WP_003415168.1.26571 WP_003415168.1.2659 WP_003415168.1.26597 WP_003415168.1.26603 WP_003415168.1.26629 WP_003415168.1.26651 WP_003415168.1.26702 WP_003415168.1.26707 WP_003415168.1.26710 WP_003415168.1.26737 WP_003415168.1.26738 WP_003415168.1.26745 WP_003415168.1.26756 WP_003415168.1.2676 WP_003415168.1.2677 WP_003415168.1.26779 WP_003415168.1.26780 WP_003415168.1.26798 WP_003415168.1.26854 WP_003415168.1.26868 WP_003415168.1.26876 WP_003415168.1.26888 WP_003415168.1.26914 WP_003415168.1.26945 WP_003415168.1.26959 WP_003415168.1.26969 WP_003415168.1.26984 WP_003415168.1.26992 WP_003415168.1.27004 WP_003415168.1.27017 WP_003415168.1.27045 WP_003415168.1.27075 WP_003415168.1.27128 WP_003415168.1.27130 WP_003415168.1.27139 WP_003415168.1.27152 WP_003415168.1.27162 WP_003415168.1.27164 WP_003415168.1.27193 WP_003415168.1.27235 WP_003415168.1.27254 WP_003415168.1.27278 WP_003415168.1.27343 WP_003415168.1.27352 WP_003415168.1.27369 WP_003415168.1.27391 WP_003415168.1.27398 WP_003415168.1.27402 WP_003415168.1.27410 WP_003415168.1.27411 WP_003415168.1.27449 WP_003415168.1.27460 WP_003415168.1.27463 WP_003415168.1.27492 WP_003415168.1.27528 WP_003415168.1.27541 WP_003415168.1.27576 WP_003415168.1.27582 WP_003415168.1.27596 WP_003415168.1.27607 WP_003415168.1.2766 WP_003415168.1.277 WP_003415168.1.27724 WP_003415168.1.27730 WP_003415168.1.27736 WP_003415168.1.27743 WP_003415168.1.27750 WP_003415168.1.27771 WP_003415168.1.27779 WP_003415168.1.27795 WP_003415168.1.27803 WP_003415168.1.27819 WP_003415168.1.27835 WP_003415168.1.27915 WP_003415168.1.27935 WP_003415168.1.27962 WP_003415168.1.28053 WP_003415168.1.28092 WP_003415168.1.28106 WP_003415168.1.28131 WP_003415168.1.28142 WP_003415168.1.28159 WP_003415168.1.2816 WP_003415168.1.28161 WP_003415168.1.28192 WP_003415168.1.28202 WP_003415168.1.28241 WP_003415168.1.28242 WP_003415168.1.28251 WP_003415168.1.28269 WP_003415168.1.28276 WP_003415168.1.28293 WP_003415168.1.28331 WP_003415168.1.28367 WP_003415168.1.28378 WP_003415168.1.28391 WP_003415168.1.2842 WP_003415168.1.28448 WP_003415168.1.2847 WP_003415168.1.28471 WP_003415168.1.28473 WP_003415168.1.28493 WP_003415168.1.28497 WP_003415168.1.28530 WP_003415168.1.28545 WP_003415168.1.28561 WP_003415168.1.28567 WP_003415168.1.28585 WP_003415168.1.286 WP_003415168.1.28610 WP_003415168.1.28617 WP_003415168.1.28634 WP_003415168.1.28642 WP_003415168.1.28671 WP_003415168.1.28682 WP_003415168.1.28739 WP_003415168.1.28758 WP_003415168.1.28781 WP_003415168.1.28787 WP_003415168.1.28827 WP_003415168.1.28839 WP_003415168.1.28847 WP_003415168.1.28851 WP_003415168.1.28865 WP_003415168.1.28897 WP_003415168.1.28914 WP_003415168.1.28935 WP_003415168.1.28936 WP_003415168.1.28939 WP_003415168.1.28943 WP_003415168.1.28952 WP_003415168.1.28975 WP_003415168.1.2899 WP_003415168.1.28993 WP_003415168.1.29000 WP_003415168.1.2901 WP_003415168.1.29028 WP_003415168.1.29033 WP_003415168.1.29058 WP_003415168.1.29078 WP_003415168.1.29102 WP_003415168.1.29115 WP_003415168.1.2916 WP_003415168.1.29217 WP_003415168.1.29223 WP_003415168.1.29234 WP_003415168.1.29264 WP_003415168.1.29275 WP_003415168.1.29306 WP_003415168.1.29339 WP_003415168.1.29348 WP_003415168.1.29364 WP_003415168.1.29367 WP_003415168.1.29426 WP_003415168.1.2944 WP_003415168.1.29450 WP_003415168.1.29452 WP_003415168.1.29510 WP_003415168.1.29515 WP_003415168.1.29525 WP_003415168.1.2953 WP_003415168.1.29559 WP_003415168.1.29587 WP_003415168.1.2959 WP_003415168.1.29592 WP_003415168.1.29611 WP_003415168.1.29632 WP_003415168.1.29649 WP_003415168.1.2965 WP_003415168.1.29659 WP_003415168.1.2969 WP_003415168.1.29696 WP_003415168.1.29698 WP_003415168.1.29718 WP_003415168.1.29742 WP_003415168.1.29745 WP_003415168.1.29747 WP_003415168.1.29769 WP_003415168.1.29825 WP_003415168.1.29830 WP_003415168.1.29847 WP_003415168.1.29861 WP_003415168.1.29869 WP_003415168.1.29883 WP_003415168.1.29890 WP_003415168.1.299 WP_003415168.1.29931 WP_003415168.1.29960 WP_003415168.1.30014 WP_003415168.1.3004 WP_003415168.1.30040 WP_003415168.1.30043 WP_003415168.1.30074 WP_003415168.1.30097 WP_003415168.1.30101 WP_003415168.1.30106 WP_003415168.1.30114 WP_003415168.1.30126 WP_003415168.1.30131 WP_003415168.1.30138 WP_003415168.1.30145 WP_003415168.1.30224 WP_003415168.1.30235 WP_003415168.1.30237 WP_003415168.1.3027 WP_003415168.1.30279 WP_003415168.1.30282 WP_003415168.1.30283 WP_003415168.1.30288 WP_003415168.1.30291 WP_003415168.1.30363 WP_003415168.1.30374 WP_003415168.1.30404 WP_003415168.1.30433 WP_003415168.1.30438 WP_003415168.1.30462 WP_003415168.1.30464 WP_003415168.1.30468 WP_003415168.1.30500 WP_003415168.1.3057 WP_003415168.1.30574 WP_003415168.1.30628 WP_003415168.1.30641 WP_003415168.1.30642 WP_003415168.1.30661 WP_003415168.1.30669 WP_003415168.1.30683 WP_003415168.1.30699 WP_003415168.1.30709 WP_003415168.1.30713 WP_003415168.1.30716 WP_003415168.1.30719 WP_003415168.1.30730 WP_003415168.1.30732 WP_003415168.1.30736 WP_003415168.1.30745 WP_003415168.1.30760 WP_003415168.1.30791 WP_003415168.1.30807 WP_003415168.1.30818 WP_003415168.1.30824 WP_003415168.1.30848 WP_003415168.1.30877 WP_003415168.1.30888 WP_003415168.1.30901 WP_003415168.1.30903 WP_003415168.1.30912 WP_003415168.1.30913 WP_003415168.1.30914 WP_003415168.1.30919 WP_003415168.1.30977 WP_003415168.1.3100 WP_003415168.1.31002 WP_003415168.1.3101 WP_003415168.1.31034 WP_003415168.1.31047 WP_003415168.1.31070 WP_003415168.1.31074 WP_003415168.1.31102 WP_003415168.1.31127 WP_003415168.1.31184 WP_003415168.1.31199 WP_003415168.1.31226 WP_003415168.1.31230 WP_003415168.1.31233 WP_003415168.1.31263 WP_003415168.1.31264 WP_003415168.1.31270 WP_003415168.1.31287 WP_003415168.1.31290 WP_003415168.1.31304 WP_003415168.1.31346 WP_003415168.1.31348 WP_003415168.1.31354 WP_003415168.1.31390 WP_003415168.1.31414 WP_003415168.1.31417 WP_003415168.1.31428 WP_003415168.1.3143 WP_003415168.1.31458 WP_003415168.1.31483 WP_003415168.1.3149 WP_003415168.1.31498 WP_003415168.1.31507 WP_003415168.1.31537 WP_003415168.1.31548 WP_003415168.1.31569 WP_003415168.1.31573 WP_003415168.1.316 WP_003415168.1.31629 WP_003415168.1.31666 WP_003415168.1.31693 WP_003415168.1.31703 WP_003415168.1.31744 WP_003415168.1.31745 WP_003415168.1.31770 WP_003415168.1.31776 WP_003415168.1.31783 WP_003415168.1.318 WP_003415168.1.3184 WP_003415168.1.31840 WP_003415168.1.31880 WP_003415168.1.31911 WP_003415168.1.31930 WP_003415168.1.31932 WP_003415168.1.31955 WP_003415168.1.31985 WP_003415168.1.31991 WP_003415168.1.31995 WP_003415168.1.32004 WP_003415168.1.32039 WP_003415168.1.3204 WP_003415168.1.32045 WP_003415168.1.32071 WP_003415168.1.32098 WP_003415168.1.32132 WP_003415168.1.32157 WP_003415168.1.32164 WP_003415168.1.32179 WP_003415168.1.32297 WP_003415168.1.32317 WP_003415168.1.32383 WP_003415168.1.32403 WP_003415168.1.32416 WP_003415168.1.32421 WP_003415168.1.32433 WP_003415168.1.32461 WP_003415168.1.32503 WP_003415168.1.32556 WP_003415168.1.32562 WP_003415168.1.32569 WP_003415168.1.32592 WP_003415168.1.32620 WP_003415168.1.32647 WP_003415168.1.32653 WP_003415168.1.32654 WP_003415168.1.3268 WP_003415168.1.32695 WP_003415168.1.32706 WP_003415168.1.32716 WP_003415168.1.32738 WP_003415168.1.32752 WP_003415168.1.32780 WP_003415168.1.32781 WP_003415168.1.32793 WP_003415168.1.32799 WP_003415168.1.32822 WP_003415168.1.32833 WP_003415168.1.32862 WP_003415168.1.32880 WP_003415168.1.32897 WP_003415168.1.32909 WP_003415168.1.32935 WP_003415168.1.32974 WP_003415168.1.33007 WP_003415168.1.3302 WP_003415168.1.33028 WP_003415168.1.33035 WP_003415168.1.33044 WP_003415168.1.33054 WP_003415168.1.33082 WP_003415168.1.33141 WP_003415168.1.33148 WP_003415168.1.33155 WP_003415168.1.33168 WP_003415168.1.3321 WP_003415168.1.33215 WP_003415168.1.3325 WP_003415168.1.3327 WP_003415168.1.33278 WP_003415168.1.33288 WP_003415168.1.33305 WP_003415168.1.3331 WP_003415168.1.33319 WP_003415168.1.3333 WP_003415168.1.33393 WP_003415168.1.33403 WP_003415168.1.33452 WP_003415168.1.33467 WP_003415168.1.33477 WP_003415168.1.3349 WP_003415168.1.33519 WP_003415168.1.33542 WP_003415168.1.33601 WP_003415168.1.33602 WP_003415168.1.33633 WP_003415168.1.33646 WP_003415168.1.33673 WP_003415168.1.3369 WP_003415168.1.33705 WP_003415168.1.33762 WP_003415168.1.33783 WP_003415168.1.33789 WP_003415168.1.3383 WP_003415168.1.33832 WP_003415168.1.33848 WP_003415168.1.3387 WP_003415168.1.33886 WP_003415168.1.33895 WP_003415168.1.33906 WP_003415168.1.33912 WP_003415168.1.33954 WP_003415168.1.3399 WP_003415168.1.34042 WP_003415168.1.3405 WP_003415168.1.34055 WP_003415168.1.34056 WP_003415168.1.34065 WP_003415168.1.34090 WP_003415168.1.34109 WP_003415168.1.34111 WP_003415168.1.34131 WP_003415168.1.34152 WP_003415168.1.34153 WP_003415168.1.34163 WP_003415168.1.34181 WP_003415168.1.34197 WP_003415168.1.34198 WP_003415168.1.34215 WP_003415168.1.34219 WP_003415168.1.34255 WP_003415168.1.34260 WP_003415168.1.34275 WP_003415168.1.343 WP_003415168.1.34347 WP_003415168.1.34358 WP_003415168.1.34392 WP_003415168.1.344 WP_003415168.1.34428 WP_003415168.1.3443 WP_003415168.1.34435 WP_003415168.1.34446 WP_003415168.1.34499 WP_003415168.1.34505 WP_003415168.1.34516 WP_003415168.1.34529 WP_003415168.1.34551 WP_003415168.1.34563 WP_003415168.1.34576 WP_003415168.1.34581 WP_003415168.1.34588 WP_003415168.1.34596 WP_003415168.1.34599 WP_003415168.1.34639 WP_003415168.1.34673 WP_003415168.1.34724 WP_003415168.1.34740 WP_003415168.1.34755 WP_003415168.1.34777 WP_003415168.1.34783 WP_003415168.1.34841 WP_003415168.1.34908 WP_003415168.1.34919 WP_003415168.1.3492 WP_003415168.1.34933 WP_003415168.1.34945 WP_003415168.1.34946 WP_003415168.1.34954 WP_003415168.1.34960 WP_003415168.1.34961 WP_003415168.1.34963 WP_003415168.1.34965 WP_003415168.1.34968 WP_003415168.1.35023 WP_003415168.1.35069 WP_003415168.1.35072 WP_003415168.1.35078 WP_003415168.1.35146 WP_003415168.1.35156 WP_003415168.1.35162 WP_003415168.1.35173 WP_003415168.1.35176 WP_003415168.1.3520 WP_003415168.1.35213 WP_003415168.1.35221 WP_003415168.1.35246 WP_003415168.1.35278 WP_003415168.1.35301 WP_003415168.1.35311 WP_003415168.1.35312 WP_003415168.1.35317 WP_003415168.1.35347 WP_003415168.1.35363 WP_003415168.1.35382 WP_003415168.1.35385 WP_003415168.1.35396 WP_003415168.1.35397 WP_003415168.1.35426 WP_003415168.1.35439 WP_003415168.1.35455 WP_003415168.1.3548 WP_003415168.1.35484 WP_003415168.1.35492 WP_003415168.1.3553 WP_003415168.1.35553 WP_003415168.1.35555 WP_003415168.1.35561 WP_003415168.1.35610 WP_003415168.1.35635 WP_003415168.1.35657 WP_003415168.1.35680 WP_003415168.1.35687 WP_003415168.1.35689 WP_003415168.1.35707 WP_003415168.1.35732 WP_003415168.1.35754 WP_003415168.1.35767 WP_003415168.1.35770 WP_003415168.1.35771 WP_003415168.1.35780 WP_003415168.1.35805 WP_003415168.1.35811 WP_003415168.1.3584 WP_003415168.1.35848 WP_003415168.1.35864 WP_003415168.1.35874 WP_003415168.1.35876 WP_003415168.1.35897 WP_003415168.1.35899 WP_003415168.1.35923 WP_003415168.1.3593 WP_003415168.1.35954 WP_003415168.1.36005 WP_003415168.1.36014 WP_003415168.1.36023 WP_003415168.1.36051 WP_003415168.1.36053 WP_003415168.1.36075 WP_003415168.1.36089 WP_003415168.1.36097 WP_003415168.1.36098 WP_003415168.1.36116 WP_003415168.1.36145 WP_003415168.1.36156 WP_003415168.1.36205 WP_003415168.1.36228 WP_003415168.1.36246 WP_003415168.1.36252 WP_003415168.1.36260 WP_003415168.1.36270 WP_003415168.1.36271 WP_003415168.1.36303 WP_003415168.1.36309 WP_003415168.1.36315 WP_003415168.1.36319 WP_003415168.1.36321 WP_003415168.1.36326 WP_003415168.1.3634 WP_003415168.1.36356 WP_003415168.1.36357 WP_003415168.1.3636 WP_003415168.1.36385 WP_003415168.1.36399 WP_003415168.1.36436 WP_003415168.1.36465 WP_003415168.1.36469 WP_003415168.1.36473 WP_003415168.1.36485 WP_003415168.1.36508 WP_003415168.1.36540 WP_003415168.1.36561 WP_003415168.1.36571 WP_003415168.1.36573 WP_003415168.1.36578 WP_003415168.1.36585 WP_003415168.1.36597 WP_003415168.1.36614 WP_003415168.1.36657 WP_003415168.1.36674 WP_003415168.1.36720 WP_003415168.1.36727 WP_003415168.1.36733 WP_003415168.1.36785 WP_003415168.1.36810 WP_003415168.1.36844 WP_003415168.1.36851 WP_003415168.1.36862 WP_003415168.1.36893 WP_003415168.1.36901 WP_003415168.1.36921 WP_003415168.1.36935 WP_003415168.1.36941 WP_003415168.1.3695 WP_003415168.1.36951 WP_003415168.1.36968 WP_003415168.1.3700 WP_003415168.1.37004 WP_003415168.1.37012 WP_003415168.1.37071 WP_003415168.1.37088 WP_003415168.1.37131 WP_003415168.1.37157 WP_003415168.1.37175 WP_003415168.1.37188 WP_003415168.1.37213 WP_003415168.1.37229 WP_003415168.1.3724 WP_003415168.1.37277 WP_003415168.1.37305 WP_003415168.1.37330 WP_003415168.1.37389 WP_003415168.1.37400 WP_003415168.1.37440 WP_003415168.1.37459 WP_003415168.1.37468 WP_003415168.1.37475 WP_003415168.1.37484 WP_003415168.1.37601 WP_003415168.1.37612 WP_003415168.1.37632 WP_003415168.1.37643 WP_003415168.1.37655 WP_003415168.1.37660 WP_003415168.1.37674 WP_003415168.1.37700 WP_003415168.1.37701 WP_003415168.1.37709 WP_003415168.1.37711 WP_003415168.1.37721 WP_003415168.1.37722 WP_003415168.1.37747 WP_003415168.1.37765 WP_003415168.1.37772 WP_003415168.1.37809 WP_003415168.1.37859 WP_003415168.1.37877 WP_003415168.1.37912 WP_003415168.1.37913 WP_003415168.1.37943 WP_003415168.1.37950 WP_003415168.1.37973 WP_003415168.1.37975 WP_003415168.1.38 WP_003415168.1.38002 WP_003415168.1.3802 WP_003415168.1.38039 WP_003415168.1.38040 WP_003415168.1.38067 WP_003415168.1.38068 WP_003415168.1.38135 WP_003415168.1.38138 WP_003415168.1.38144 WP_003415168.1.38158 WP_003415168.1.38159 WP_003415168.1.38210 WP_003415168.1.38233 WP_003415168.1.38240 WP_003415168.1.38299 WP_003415168.1.38332 WP_003415168.1.38347 WP_003415168.1.38354 WP_003415168.1.38380 WP_003415168.1.38384 WP_003415168.1.38389 WP_003415168.1.38398 WP_003415168.1.38402 WP_003415168.1.38418 WP_003415168.1.38421 WP_003415168.1.38466 WP_003415168.1.38483 WP_003415168.1.3849 WP_003415168.1.385 WP_003415168.1.38530 WP_003415168.1.38535 WP_003415168.1.38539 WP_003415168.1.38601 WP_003415168.1.38611 WP_003415168.1.38638 WP_003415168.1.38639 WP_003415168.1.38646 WP_003415168.1.38648 WP_003415168.1.38654 WP_003415168.1.38659 WP_003415168.1.38660 WP_003415168.1.38666 WP_003415168.1.38671 WP_003415168.1.38672 WP_003415168.1.38677 WP_003415168.1.38750 WP_003415168.1.38772 WP_003415168.1.38812 WP_003415168.1.38821 WP_003415168.1.38844 WP_003415168.1.38863 WP_003415168.1.38865 WP_003415168.1.38873 WP_003415168.1.3889 WP_003415168.1.38894 WP_003415168.1.38909 WP_003415168.1.38939 WP_003415168.1.38974 WP_003415168.1.38975 WP_003415168.1.38991 WP_003415168.1.39025 WP_003415168.1.39070 WP_003415168.1.39072 WP_003415168.1.39095 WP_003415168.1.39106 WP_003415168.1.39174 WP_003415168.1.39176 WP_003415168.1.39178 WP_003415168.1.39190 WP_003415168.1.39201 WP_003415168.1.39207 WP_003415168.1.39211 WP_003415168.1.39236 WP_003415168.1.39239 WP_003415168.1.39252 WP_003415168.1.39288 WP_003415168.1.39295 WP_003415168.1.39306 WP_003415168.1.39359 WP_003415168.1.39364 WP_003415168.1.39400 WP_003415168.1.39447 WP_003415168.1.3945 WP_003415168.1.39450 WP_003415168.1.39455 WP_003415168.1.3949 WP_003415168.1.39521 WP_003415168.1.39560 WP_003415168.1.39592 WP_003415168.1.39593 WP_003415168.1.396 WP_003415168.1.3960 WP_003415168.1.39616 WP_003415168.1.39654 WP_003415168.1.39657 WP_003415168.1.39661 WP_003415168.1.39674 WP_003415168.1.39678 WP_003415168.1.3968 WP_003415168.1.39694 WP_003415168.1.3971 WP_003415168.1.39718 WP_003415168.1.39728 WP_003415168.1.39739 WP_003415168.1.39748 WP_003415168.1.39751 WP_003415168.1.39759 WP_003415168.1.39801 WP_003415168.1.39804 WP_003415168.1.39848 WP_003415168.1.39877 WP_003415168.1.39925 WP_003415168.1.3994 WP_003415168.1.39959 WP_003415168.1.3996 WP_003415168.1.39960 WP_003415168.1.3997 WP_003415168.1.39980 WP_003415168.1.40000 WP_003415168.1.40028 WP_003415168.1.40029 WP_003415168.1.4003 WP_003415168.1.40094 WP_003415168.1.40096 WP_003415168.1.40150 WP_003415168.1.40156 WP_003415168.1.40174 WP_003415168.1.40186 WP_003415168.1.40277 WP_003415168.1.40323 WP_003415168.1.40336 WP_003415168.1.40353 WP_003415168.1.4036 WP_003415168.1.40372 WP_003415168.1.40402 WP_003415168.1.40413 WP_003415168.1.40440 WP_003415168.1.40446 WP_003415168.1.40451 WP_003415168.1.40455 WP_003415168.1.40523 WP_003415168.1.40641 WP_003415168.1.40646 WP_003415168.1.40651 WP_003415168.1.40653 WP_003415168.1.40705 WP_003415168.1.40723 WP_003415168.1.40731 WP_003415168.1.40735 WP_003415168.1.40799 WP_003415168.1.40852 WP_003415168.1.40876 WP_003415168.1.40881 WP_003415168.1.40922 WP_003415168.1.40948 WP_003415168.1.4095 WP_003415168.1.40956 WP_003415168.1.40957 WP_003415168.1.40964 WP_003415168.1.4097 WP_003415168.1.410 WP_003415168.1.41000 WP_003415168.1.41055 WP_003415168.1.41108 WP_003415168.1.41123 WP_003415168.1.41177 WP_003415168.1.41202 WP_003415168.1.41219 WP_003415168.1.41231 WP_003415168.1.41249 WP_003415168.1.4127 WP_003415168.1.41296 WP_003415168.1.41355 WP_003415168.1.41376 WP_003415168.1.41447 WP_003415168.1.41469 WP_003415168.1.41504 WP_003415168.1.41553 WP_003415168.1.41564 WP_003415168.1.41583 WP_003415168.1.41632 WP_003415168.1.41635 WP_003415168.1.41636 WP_003415168.1.41648 WP_003415168.1.41660 WP_003415168.1.41685 WP_003415168.1.41695 WP_003415168.1.41704 WP_003415168.1.4171 WP_003415168.1.41719 WP_003415168.1.41733 WP_003415168.1.41744 WP_003415168.1.41774 WP_003415168.1.41791 WP_003415168.1.41820 WP_003415168.1.41828 WP_003415168.1.41829 WP_003415168.1.41860 WP_003415168.1.41912 WP_003415168.1.41921 WP_003415168.1.41933 WP_003415168.1.41944 WP_003415168.1.42043 WP_003415168.1.42075 WP_003415168.1.42078 WP_003415168.1.42094 WP_003415168.1.42112 WP_003415168.1.4212 WP_003415168.1.42122 WP_003415168.1.42134 WP_003415168.1.42183 WP_003415168.1.42201 WP_003415168.1.42202 WP_003415168.1.42208 WP_003415168.1.42247 WP_003415168.1.42255 WP_003415168.1.42273 WP_003415168.1.42278 WP_003415168.1.42304 WP_003415168.1.42309 WP_003415168.1.42370 WP_003415168.1.42385 WP_003415168.1.42409 WP_003415168.1.42414 WP_003415168.1.42417 WP_003415168.1.42430 WP_003415168.1.42461 WP_003415168.1.42465 WP_003415168.1.42467 WP_003415168.1.42473 WP_003415168.1.42474 WP_003415168.1.4248 WP_003415168.1.42494 WP_003415168.1.42519 WP_003415168.1.42524 WP_003415168.1.42534 WP_003415168.1.4255 WP_003415168.1.42562 WP_003415168.1.42568 WP_003415168.1.42570 WP_003415168.1.42618 WP_003415168.1.42660 WP_003415168.1.42695 WP_003415168.1.42704 WP_003415168.1.42705 WP_003415168.1.42722 WP_003415168.1.42777 WP_003415168.1.42782 WP_003415168.1.42839 WP_003415168.1.42905 WP_003415168.1.42916 WP_003415168.1.42930 WP_003415168.1.42971 WP_003415168.1.43005 WP_003415168.1.43009 WP_003415168.1.43053 WP_003415168.1.43082 WP_003415168.1.43087 WP_003415168.1.43098 WP_003415168.1.43208 WP_003415168.1.43236 WP_003415168.1.43246 WP_003415168.1.43255 WP_003415168.1.43266 WP_003415168.1.43269 WP_003415168.1.43273 WP_003415168.1.43296 WP_003415168.1.43306 WP_003415168.1.4335 WP_003415168.1.43368 WP_003415168.1.43395 WP_003415168.1.43457 WP_003415168.1.43462 WP_003415168.1.43475 WP_003415168.1.43478 WP_003415168.1.43484 WP_003415168.1.43557 WP_003415168.1.43578 WP_003415168.1.43588 WP_003415168.1.43643 WP_003415168.1.43664 WP_003415168.1.43684 WP_003415168.1.43686 WP_003415168.1.43706 WP_003415168.1.4377 WP_003415168.1.43781 WP_003415168.1.43794 WP_003415168.1.43815 WP_003415168.1.43846 WP_003415168.1.43861 WP_003415168.1.43863 WP_003415168.1.43866 WP_003415168.1.43872 WP_003415168.1.43885 WP_003415168.1.43897 WP_003415168.1.4390 WP_003415168.1.43902 WP_003415168.1.43921 WP_003415168.1.43936 WP_003415168.1.43937 WP_003415168.1.43960 WP_003415168.1.43965 WP_003415168.1.43993 WP_003415168.1.43996 WP_003415168.1.44001 WP_003415168.1.44008 WP_003415168.1.44016 WP_003415168.1.44033 WP_003415168.1.44037 WP_003415168.1.44041 WP_003415168.1.44070 WP_003415168.1.44071 WP_003415168.1.44076 WP_003415168.1.44104 WP_003415168.1.44111 WP_003415168.1.44124 WP_003415168.1.44169 WP_003415168.1.44219 WP_003415168.1.44237 WP_003415168.1.44277 WP_003415168.1.44279 WP_003415168.1.44336 WP_003415168.1.44355 WP_003415168.1.44358 WP_003415168.1.44390 WP_003415168.1.44392 WP_003415168.1.4441 WP_003415168.1.44415 WP_003415168.1.44464 WP_003415168.1.44466 WP_003415168.1.44489 WP_003415168.1.44492 WP_003415168.1.44494 WP_003415168.1.44500 WP_003415168.1.44519 WP_003415168.1.44526 WP_003415168.1.44532 WP_003415168.1.44534 WP_003415168.1.44562 WP_003415168.1.44589 WP_003415168.1.44597 WP_003415168.1.44600 WP_003415168.1.44602 WP_003415168.1.44615 WP_003415168.1.4464 WP_003415168.1.44651 WP_003415168.1.44659 WP_003415168.1.44665 WP_003415168.1.44694 WP_003415168.1.44700 WP_003415168.1.44713 WP_003415168.1.44735 WP_003415168.1.44740 WP_003415168.1.44757 WP_003415168.1.4476 WP_003415168.1.44761 WP_003415168.1.44767 WP_003415168.1.44776 WP_003415168.1.44786 WP_003415168.1.44808 WP_003415168.1.44864 WP_003415168.1.44901 WP_003415168.1.44908 WP_003415168.1.44913 WP_003415168.1.4492 WP_003415168.1.44939 WP_003415168.1.44979 WP_003415168.1.44981 WP_003415168.1.45002 WP_003415168.1.45011 WP_003415168.1.4504 WP_003415168.1.45066 WP_003415168.1.45081 WP_003415168.1.45113 WP_003415168.1.45129 WP_003415168.1.45135 WP_003415168.1.45147 WP_003415168.1.45168 WP_003415168.1.4517 WP_003415168.1.45181 WP_003415168.1.45185 WP_003415168.1.45192 WP_003415168.1.45200 WP_003415168.1.45205 WP_003415168.1.45211 WP_003415168.1.45249 WP_003415168.1.4526 WP_003415168.1.45286 WP_003415168.1.45326 WP_003415168.1.45347 WP_003415168.1.45374 WP_003415168.1.45390 WP_003415168.1.454 WP_003415168.1.45407 WP_003415168.1.45451 WP_003415168.1.45453 WP_003415168.1.45460 WP_003415168.1.45463 WP_003415168.1.45470 WP_003415168.1.45474 WP_003415168.1.45491 WP_003415168.1.45510 WP_003415168.1.45563 WP_003415168.1.45584 WP_003415168.1.45590 WP_003415168.1.45619 WP_003415168.1.45626 WP_003415168.1.45631 WP_003415168.1.45666 WP_003415168.1.45697 WP_003415168.1.4571 WP_003415168.1.45731 WP_003415168.1.45743 WP_003415168.1.45765 WP_003415168.1.45776 WP_003415168.1.45783 WP_003415168.1.45805 WP_003415168.1.45815 WP_003415168.1.45849 WP_003415168.1.45884 WP_003415168.1.4590 WP_003415168.1.45923 WP_003415168.1.45926 WP_003415168.1.45963 WP_003415168.1.45989 WP_003415168.1.45992 WP_003415168.1.46025 WP_003415168.1.46083 WP_003415168.1.46090 WP_003415168.1.46092 WP_003415168.1.46100 WP_003415168.1.46101 WP_003415168.1.46103 WP_003415168.1.46107 WP_003415168.1.46127 WP_003415168.1.46128 WP_003415168.1.46129 WP_003415168.1.46141 WP_003415168.1.46150 WP_003415168.1.46201 WP_003415168.1.46226 WP_003415168.1.4624 WP_003415168.1.46253 WP_003415168.1.46268 WP_003415168.1.46285 WP_003415168.1.46300 WP_003415168.1.46336 WP_003415168.1.46365 WP_003415168.1.46370 WP_003415168.1.46381 WP_003415168.1.46411 WP_003415168.1.4644 WP_003415168.1.46442 WP_003415168.1.46453 WP_003415168.1.46463 WP_003415168.1.46478 WP_003415168.1.46492 WP_003415168.1.46521 WP_003415168.1.4653 WP_003415168.1.46532 WP_003415168.1.46539 WP_003415168.1.46568 WP_003415168.1.46585 WP_003415168.1.46613 WP_003415168.1.46625 WP_003415168.1.46642 WP_003415168.1.46647 WP_003415168.1.46674 WP_003415168.1.46724 WP_003415168.1.46758 WP_003415168.1.46773 WP_003415168.1.46777 WP_003415168.1.46786 WP_003415168.1.46792 WP_003415168.1.46847 WP_003415168.1.46851 WP_003415168.1.4687 WP_003415168.1.46897 WP_003415168.1.46936 WP_003415168.1.46980 WP_003415168.1.47011 WP_003415168.1.47012 WP_003415168.1.47066 WP_003415168.1.47077 WP_003415168.1.47083 WP_003415168.1.47106 WP_003415168.1.47142 WP_003415168.1.47147 WP_003415168.1.47166 WP_003415168.1.47178 WP_003415168.1.47179 WP_003415168.1.47194 WP_003415168.1.47207 WP_003415168.1.47210 WP_003415168.1.47261 WP_003415168.1.47262 WP_003415168.1.47402 WP_003415168.1.47423 WP_003415168.1.47467 WP_003415168.1.47502 WP_003415168.1.4751 WP_003415168.1.47511 WP_003415168.1.47537 WP_003415168.1.47540 WP_003415168.1.47568 WP_003415168.1.47572 WP_003415168.1.47636 WP_003415168.1.4764 WP_003415168.1.47679 WP_003415168.1.47681 WP_003415168.1.47690 WP_003415168.1.4771 WP_003415168.1.47717 WP_003415168.1.47743 WP_003415168.1.47754 WP_003415168.1.47773 WP_003415168.1.47776 WP_003415168.1.47780 WP_003415168.1.47805 WP_003415168.1.47832 WP_003415168.1.47847 WP_003415168.1.47858 WP_003415168.1.47861 WP_003415168.1.47868 WP_003415168.1.47893 WP_003415168.1.47899 WP_003415168.1.479 WP_003415168.1.47912 WP_003415168.1.47913 WP_003415168.1.47926 WP_003415168.1.4794 WP_003415168.1.47943 WP_003415168.1.47944 WP_003415168.1.47959 WP_003415168.1.47974 WP_003415168.1.47993 WP_003415168.1.48004 WP_003415168.1.48039 WP_003415168.1.48050 WP_003415168.1.48084 WP_003415168.1.48097 WP_003415168.1.48101 WP_003415168.1.48109 WP_003415168.1.4813 WP_003415168.1.48130 WP_003415168.1.48135 WP_003415168.1.48143 WP_003415168.1.48152 WP_003415168.1.48155 WP_003415168.1.48170 WP_003415168.1.48173 WP_003415168.1.48177 WP_003415168.1.48185 WP_003415168.1.48204 WP_003415168.1.48219 WP_003415168.1.4823 WP_003415168.1.48240 WP_003415168.1.48256 WP_003415168.1.48264 WP_003415168.1.48287 WP_003415168.1.48330 WP_003415168.1.48333 WP_003415168.1.48348 WP_003415168.1.48354 WP_003415168.1.48372 WP_003415168.1.48383 WP_003415168.1.48388 WP_003415168.1.48419 WP_003415168.1.48423 WP_003415168.1.48443 WP_003415168.1.48450 WP_003415168.1.48462 WP_003415168.1.48543 WP_003415168.1.48550 WP_003415168.1.48605 WP_003415168.1.48618 WP_003415168.1.4863 WP_003415168.1.48648 WP_003415168.1.48658 WP_003415168.1.48666 WP_003415168.1.48687 WP_003415168.1.48779 WP_003415168.1.4878 WP_003415168.1.48798 WP_003415168.1.48802 WP_003415168.1.48826 WP_003415168.1.48843 WP_003415168.1.48857 WP_003415168.1.4890 WP_003415168.1.48946 WP_003415168.1.48979 WP_003415168.1.49017 WP_003415168.1.49048 WP_003415168.1.49059 WP_003415168.1.4906 WP_003415168.1.4907 WP_003415168.1.49103 WP_003415168.1.49110 WP_003415168.1.49111 WP_003415168.1.49112 WP_003415168.1.4919 WP_003415168.1.49251 WP_003415168.1.49254 WP_003415168.1.49263 WP_003415168.1.49291 WP_003415168.1.49296 WP_003415168.1.49335 WP_003415168.1.49337 WP_003415168.1.49419 WP_003415168.1.49426 WP_003415168.1.49437 WP_003415168.1.49439 WP_003415168.1.49474 WP_003415168.1.49506 WP_003415168.1.49516 WP_003415168.1.49523 WP_003415168.1.49526 WP_003415168.1.49532 WP_003415168.1.49588 WP_003415168.1.4959 WP_003415168.1.49678 WP_003415168.1.49687 WP_003415168.1.49699 WP_003415168.1.49709 WP_003415168.1.4971 WP_003415168.1.4972 WP_003415168.1.49746 WP_003415168.1.49764 WP_003415168.1.49773 WP_003415168.1.49796 WP_003415168.1.49814 WP_003415168.1.49815 WP_003415168.1.49816 WP_003415168.1.49839 WP_003415168.1.49857 WP_003415168.1.49878 WP_003415168.1.49880 WP_003415168.1.49944 WP_003415168.1.4999 WP_003415168.1.49990 WP_003415168.1.50068 WP_003415168.1.50077 WP_003415168.1.5008 WP_003415168.1.50081 WP_003415168.1.50122 WP_003415168.1.50126 WP_003415168.1.50149 WP_003415168.1.50162 WP_003415168.1.5018 WP_003415168.1.50194 WP_003415168.1.50218 WP_003415168.1.50235 WP_003415168.1.50249 WP_003415168.1.50265 WP_003415168.1.50271 WP_003415168.1.50324 WP_003415168.1.50347 WP_003415168.1.50372 WP_003415168.1.50398 WP_003415168.1.50407 WP_003415168.1.50444 WP_003415168.1.50466 WP_003415168.1.50472 WP_003415168.1.5048 WP_003415168.1.50498 WP_003415168.1.5050 WP_003415168.1.50540 WP_003415168.1.50554 WP_003415168.1.50557 WP_003415168.1.50601 WP_003415168.1.50610 WP_003415168.1.50632 WP_003415168.1.50633 WP_003415168.1.50642 WP_003415168.1.50655 WP_003415168.1.50659 WP_003415168.1.50683 WP_003415168.1.50689 WP_003415168.1.50692 WP_003415168.1.50714 WP_003415168.1.50729 WP_003415168.1.50756 WP_003415168.1.50784 WP_003415168.1.50794 WP_003415168.1.50841 WP_003415168.1.50860 WP_003415168.1.50868 WP_003415168.1.50877 WP_003415168.1.5096 WP_003415168.1.50981 WP_003415168.1.50987 WP_003415168.1.51003 WP_003415168.1.51009 WP_003415168.1.51037 WP_003415168.1.51074 WP_003415168.1.51082 WP_003415168.1.51101 WP_003415168.1.51116 WP_003415168.1.51149 WP_003415168.1.51157 WP_003415168.1.51213 WP_003415168.1.51232 WP_003415168.1.51239 WP_003415168.1.51247 WP_003415168.1.51266 WP_003415168.1.51279 WP_003415168.1.51291 WP_003415168.1.51294 WP_003415168.1.51301 WP_003415168.1.51329 WP_003415168.1.51391 WP_003415168.1.51422 WP_003415168.1.51445 WP_003415168.1.51455 WP_003415168.1.51466 WP_003415168.1.51468 WP_003415168.1.51478 WP_003415168.1.51497 WP_003415168.1.51593 WP_003415168.1.51628 WP_003415168.1.5164 WP_003415168.1.51660 WP_003415168.1.51696 WP_003415168.1.51721 WP_003415168.1.51788 WP_003415168.1.51795 WP_003415168.1.51801 WP_003415168.1.51817 WP_003415168.1.51819 WP_003415168.1.51854 WP_003415168.1.51923 WP_003415168.1.51942 WP_003415168.1.51948 WP_003415168.1.51963 WP_003415168.1.51969 WP_003415168.1.52000 WP_003415168.1.52001 WP_003415168.1.52003 WP_003415168.1.52006 WP_003415168.1.52036 WP_003415168.1.52038 WP_003415168.1.52046 WP_003415168.1.52059 WP_003415168.1.52069 WP_003415168.1.52082 WP_003415168.1.52102 WP_003415168.1.52106 WP_003415168.1.52166 WP_003415168.1.52168 WP_003415168.1.52173 WP_003415168.1.52178 WP_003415168.1.52206 WP_003415168.1.52216 WP_003415168.1.52238 WP_003415168.1.52241 WP_003415168.1.52280 WP_003415168.1.52314 WP_003415168.1.52385 WP_003415168.1.52390 WP_003415168.1.524 WP_003415168.1.52460 WP_003415168.1.52485 WP_003415168.1.52486 WP_003415168.1.52495 WP_003415168.1.52504 WP_003415168.1.52522 WP_003415168.1.52531 WP_003415168.1.52533 WP_003415168.1.52545 WP_003415168.1.52553 WP_003415168.1.52563 WP_003415168.1.52564 WP_003415168.1.52574 WP_003415168.1.52641 WP_003415168.1.52673 WP_003415168.1.52674 WP_003415168.1.52708 WP_003415168.1.52713 WP_003415168.1.52761 WP_003415168.1.52778 WP_003415168.1.52791 WP_003415168.1.52797 WP_003415168.1.52818 WP_003415168.1.52872 WP_003415168.1.52873 WP_003415168.1.52891 WP_003415168.1.52892 WP_003415168.1.52909 WP_003415168.1.52970 WP_003415168.1.52998 WP_003415168.1.53053 WP_003415168.1.53056 WP_003415168.1.5306 WP_003415168.1.53088 WP_003415168.1.5309 WP_003415168.1.531 WP_003415168.1.53117 WP_003415168.1.53118 WP_003415168.1.53142 WP_003415168.1.53143 WP_003415168.1.53157 WP_003415168.1.53167 WP_003415168.1.53200 WP_003415168.1.53204 WP_003415168.1.53213 WP_003415168.1.53217 WP_003415168.1.53226 WP_003415168.1.53229 WP_003415168.1.53230 WP_003415168.1.53237 WP_003415168.1.53254 WP_003415168.1.53257 WP_003415168.1.5327 WP_003415168.1.53276 WP_003415168.1.53278 WP_003415168.1.533 WP_003415168.1.53302 WP_003415168.1.53306 WP_003415168.1.5334 WP_003415168.1.5335 WP_003415168.1.53353 WP_003415168.1.53381 WP_003415168.1.53413 WP_003415168.1.53458 WP_003415168.1.53460 WP_003415168.1.53480 WP_003415168.1.53517 WP_003415168.1.53522 WP_003415168.1.53525 WP_003415168.1.53526 WP_003415168.1.53553 WP_003415168.1.53606 WP_003415168.1.53628 WP_003415168.1.53643 WP_003415168.1.53667 WP_003415168.1.53679 WP_003415168.1.53715 WP_003415168.1.53730 WP_003415168.1.53742 WP_003415168.1.53743 WP_003415168.1.53754 WP_003415168.1.53775 WP_003415168.1.53787 WP_003415168.1.53803 WP_003415168.1.53818 WP_003415168.1.53853 WP_003415168.1.53865 WP_003415168.1.53888 WP_003415168.1.53900 WP_003415168.1.53912 WP_003415168.1.53914 WP_003415168.1.53952 WP_003415168.1.5398 WP_003415168.1.5408 WP_003415168.1.54089 WP_003415168.1.54093 WP_003415168.1.54099 WP_003415168.1.54112 WP_003415168.1.54125 WP_003415168.1.54141 WP_003415168.1.54162 WP_003415168.1.54179 WP_003415168.1.54218 WP_003415168.1.54225 WP_003415168.1.54227 WP_003415168.1.54232 WP_003415168.1.54241 WP_003415168.1.54245 WP_003415168.1.54247 WP_003415168.1.54260 WP_003415168.1.54275 WP_003415168.1.54280 WP_003415168.1.5429 WP_003415168.1.54294 WP_003415168.1.54314 WP_003415168.1.54347 WP_003415168.1.54351 WP_003415168.1.54370 WP_003415168.1.54428 WP_003415168.1.54449 WP_003415168.1.54494 WP_003415168.1.54502 WP_003415168.1.54514 WP_003415168.1.54519 WP_003415168.1.5452 WP_003415168.1.54531 WP_003415168.1.54537 WP_003415168.1.54553 WP_003415168.1.54555 WP_003415168.1.54575 WP_003415168.1.54633 WP_003415168.1.54686 WP_003415168.1.54687 WP_003415168.1.54705 WP_003415168.1.54730 WP_003415168.1.54732 WP_003415168.1.5475 WP_003415168.1.54797 WP_003415168.1.54807 WP_003415168.1.54836 WP_003415168.1.54838 WP_003415168.1.54860 WP_003415168.1.54888 WP_003415168.1.54897 WP_003415168.1.54905 WP_003415168.1.54909 WP_003415168.1.54937 WP_003415168.1.54939 WP_003415168.1.54944 WP_003415168.1.54945 WP_003415168.1.54953 WP_003415168.1.54964 WP_003415168.1.55015 WP_003415168.1.55022 WP_003415168.1.55023 WP_003415168.1.55051 WP_003415168.1.55088 WP_003415168.1.55106 WP_003415168.1.55126 WP_003415168.1.55128 WP_003415168.1.55140 WP_003415168.1.55150 WP_003415168.1.55210 WP_003415168.1.55227 WP_003415168.1.55248 WP_003415168.1.55257 WP_003415168.1.55258 WP_003415168.1.55267 WP_003415168.1.55279 WP_003415168.1.55307 WP_003415168.1.55326 WP_003415168.1.55328 WP_003415168.1.5533 WP_003415168.1.55345 WP_003415168.1.55396 WP_003415168.1.55398 WP_003415168.1.55441 WP_003415168.1.55459 WP_003415168.1.55501 WP_003415168.1.55504 WP_003415168.1.55578 WP_003415168.1.55626 WP_003415168.1.55641 WP_003415168.1.5569 WP_003415168.1.55723 WP_003415168.1.55735 WP_003415168.1.5574 WP_003415168.1.55772 WP_003415168.1.55802 WP_003415168.1.55819 WP_003415168.1.55821 WP_003415168.1.5583 WP_003415168.1.55849 WP_003415168.1.55856 WP_003415168.1.55860 WP_003415168.1.55882 WP_003415168.1.55883 WP_003415168.1.55894 WP_003415168.1.55902 WP_003415168.1.55908 WP_003415168.1.5591 WP_003415168.1.55961 WP_003415168.1.55977 WP_003415168.1.55983 WP_003415168.1.56028 WP_003415168.1.56057 WP_003415168.1.56060 WP_003415168.1.56107 WP_003415168.1.56132 WP_003415168.1.56163 WP_003415168.1.56167 WP_003415168.1.56178 WP_003415168.1.56287 WP_003415168.1.56292 WP_003415168.1.56327 WP_003415168.1.56341 WP_003415168.1.56359 WP_003415168.1.56365 WP_003415168.1.56394 WP_003415168.1.56473 WP_003415168.1.56478 WP_003415168.1.56500 WP_003415168.1.56517 WP_003415168.1.56534 WP_003415168.1.5656 WP_003415168.1.56577 WP_003415168.1.56593 WP_003415168.1.56625 WP_003415168.1.56637 WP_003415168.1.56670 WP_003415168.1.56697 WP_003415168.1.567 WP_003415168.1.56701 WP_003415168.1.56709 WP_003415168.1.56729 WP_003415168.1.56743 WP_003415168.1.56755 WP_003415168.1.56769 WP_003415168.1.56770 WP_003415168.1.56795 WP_003415168.1.5681 WP_003415168.1.56827 WP_003415168.1.56839 WP_003415168.1.56863 WP_003415168.1.56869 WP_003415168.1.56915 WP_003415168.1.56926 WP_003415168.1.56961 WP_003415168.1.56971 WP_003415168.1.56972 WP_003415168.1.57023 WP_003415168.1.57035 WP_003415168.1.57077 WP_003415168.1.57087 WP_003415168.1.57094 WP_003415168.1.57134 WP_003415168.1.57151 WP_003415168.1.57169 WP_003415168.1.57208 WP_003415168.1.57212 WP_003415168.1.57230 WP_003415168.1.5724 WP_003415168.1.5725 WP_003415168.1.5727 WP_003415168.1.57273 WP_003415168.1.573 WP_003415168.1.57314 WP_003415168.1.57326 WP_003415168.1.57328 WP_003415168.1.57331 WP_003415168.1.57340 WP_003415168.1.57351 WP_003415168.1.57352 WP_003415168.1.57380 WP_003415168.1.57430 WP_003415168.1.5744 WP_003415168.1.57440 WP_003415168.1.5745 WP_003415168.1.57461 WP_003415168.1.57469 WP_003415168.1.57489 WP_003415168.1.575 WP_003415168.1.57509 WP_003415168.1.57519 WP_003415168.1.57525 WP_003415168.1.57551 WP_003415168.1.5758 WP_003415168.1.57596 WP_003415168.1.57604 WP_003415168.1.57616 WP_003415168.1.57617 WP_003415168.1.57619 WP_003415168.1.57627 WP_003415168.1.57642 WP_003415168.1.57658 WP_003415168.1.57667 WP_003415168.1.57675 WP_003415168.1.57689 WP_003415168.1.57708 WP_003415168.1.57794 WP_003415168.1.57821 WP_003415168.1.57825 WP_003415168.1.57843 WP_003415168.1.57906 WP_003415168.1.57924 WP_003415168.1.57926 WP_003415168.1.57930 WP_003415168.1.57957 WP_003415168.1.57960 WP_003415168.1.57964 WP_003415168.1.57991 WP_003415168.1.58000 WP_003415168.1.58086 WP_003415168.1.58101 WP_003415168.1.58103 WP_003415168.1.58108 WP_003415168.1.5811 WP_003415168.1.58121 WP_003415168.1.58145 WP_003415168.1.58164 WP_003415168.1.58174 WP_003415168.1.582 WP_003415168.1.58202 WP_003415168.1.58209 WP_003415168.1.58215 WP_003415168.1.5824 WP_003415168.1.58250 WP_003415168.1.58259 WP_003415168.1.58283 WP_003415168.1.5830 WP_003415168.1.58303 WP_003415168.1.58311 WP_003415168.1.58330 WP_003415168.1.58359 WP_003415168.1.58386 WP_003415168.1.58393 WP_003415168.1.58431 WP_003415168.1.5844 WP_003415168.1.58457 WP_003415168.1.58518 WP_003415168.1.58534 WP_003415168.1.58559 WP_003415168.1.58567 WP_003415168.1.58573 WP_003415168.1.58602 WP_003415168.1.58612 WP_003415168.1.58619 WP_003415168.1.58630 WP_003415168.1.5865 WP_003415168.1.58671 WP_003415168.1.58690 WP_003415168.1.58702 WP_003415168.1.58743 WP_003415168.1.58754 WP_003415168.1.5879 WP_003415168.1.5881 WP_003415168.1.58824 WP_003415168.1.58848 WP_003415168.1.58857 WP_003415168.1.58891 WP_003415168.1.58892 WP_003415168.1.5890 WP_003415168.1.58904 WP_003415168.1.58921 WP_003415168.1.58930 WP_003415168.1.58939 WP_003415168.1.58941 WP_003415168.1.58953 WP_003415168.1.58961 WP_003415168.1.5898 WP_003415168.1.59025 WP_003415168.1.59029 WP_003415168.1.59037 WP_003415168.1.59044 WP_003415168.1.59085 WP_003415168.1.59088 WP_003415168.1.59112 WP_003415168.1.59130 WP_003415168.1.5914 WP_003415168.1.59147 WP_003415168.1.59166 WP_003415168.1.59205 WP_003415168.1.59209 WP_003415168.1.59237 WP_003415168.1.59240 WP_003415168.1.59253 WP_003415168.1.59254 WP_003415168.1.59262 WP_003415168.1.59270 WP_003415168.1.5928 WP_003415168.1.59304 WP_003415168.1.59305 WP_003415168.1.59309 WP_003415168.1.59316 WP_003415168.1.59326 WP_003415168.1.59328 WP_003415168.1.59333 WP_003415168.1.59338 WP_003415168.1.59388 WP_003415168.1.59428 WP_003415168.1.59487 WP_003415168.1.59537 WP_003415168.1.59561 WP_003415168.1.59677 WP_003415168.1.59722 WP_003415168.1.59727 WP_003415168.1.59732 WP_003415168.1.59738 WP_003415168.1.59750 WP_003415168.1.59757 WP_003415168.1.59761 WP_003415168.1.59808 WP_003415168.1.59850 WP_003415168.1.59856 WP_003415168.1.59860 WP_003415168.1.59861 WP_003415168.1.5987 WP_003415168.1.59878 WP_003415168.1.59888 WP_003415168.1.59952 WP_003415168.1.5996 WP_003415168.1.59961 WP_003415168.1.59974 WP_003415168.1.6000 WP_003415168.1.60007 WP_003415168.1.60016 WP_003415168.1.6003 WP_003415168.1.60047 WP_003415168.1.6007 WP_003415168.1.60121 WP_003415168.1.60125 WP_003415168.1.60135 WP_003415168.1.60139 WP_003415168.1.60152 WP_003415168.1.60171 WP_003415168.1.60197 WP_003415168.1.6020 WP_003415168.1.60205 WP_003415168.1.60207 WP_003415168.1.60215 WP_003415168.1.60217 WP_003415168.1.60267 WP_003415168.1.60288 WP_003415168.1.60291 WP_003415168.1.60301 WP_003415168.1.60305 WP_003415168.1.60312 WP_003415168.1.60313 WP_003415168.1.60314 WP_003415168.1.60367 WP_003415168.1.60376 WP_003415168.1.60403 WP_003415168.1.60413 WP_003415168.1.60421 WP_003415168.1.60451 WP_003415168.1.60460 WP_003415168.1.60479 WP_003415168.1.60512 WP_003415168.1.60573 WP_003415168.1.60583 WP_003415168.1.60632 WP_003415168.1.60657 WP_003415168.1.60687 WP_003415168.1.60689 WP_003415168.1.60727 WP_003415168.1.60738 WP_003415168.1.60763 WP_003415168.1.6077 WP_003415168.1.60791 WP_003415168.1.60834 WP_003415168.1.60870 WP_003415168.1.60878 WP_003415168.1.60879 WP_003415168.1.60913 WP_003415168.1.60978 WP_003415168.1.61000 WP_003415168.1.61001 WP_003415168.1.61012 WP_003415168.1.61014 WP_003415168.1.61015 WP_003415168.1.61037 WP_003415168.1.61052 WP_003415168.1.61065 WP_003415168.1.61100 WP_003415168.1.61101 WP_003415168.1.61138 WP_003415168.1.61142 WP_003415168.1.61198 WP_003415168.1.612 WP_003415168.1.61234 WP_003415168.1.61256 WP_003415168.1.61281 WP_003415168.1.61314 WP_003415168.1.61321 WP_003415168.1.61326 WP_003415168.1.61328 WP_003415168.1.61368 WP_003415168.1.61391 WP_003415168.1.61406 WP_003415168.1.61409 WP_003415168.1.61420 WP_003415168.1.61422 WP_003415168.1.61425 WP_003415168.1.61428 WP_003415168.1.61469 WP_003415168.1.61494 WP_003415168.1.61522 WP_003415168.1.61552 WP_003415168.1.61557 WP_003415168.1.61567 WP_003415168.1.61571 WP_003415168.1.61573 WP_003415168.1.61584 WP_003415168.1.61586 WP_003415168.1.6159 WP_003415168.1.61592 WP_003415168.1.6160 WP_003415168.1.61614 WP_003415168.1.6163 WP_003415168.1.61665 WP_003415168.1.61669 WP_003415168.1.61682 WP_003415168.1.61692 WP_003415168.1.61719 WP_003415168.1.61728 WP_003415168.1.61750 WP_003415168.1.61754 WP_003415168.1.61755 WP_003415168.1.61757 WP_003415168.1.61778 WP_003415168.1.6179 WP_003415168.1.61816 WP_003415168.1.61842 WP_003415168.1.61850 WP_003415168.1.61862 WP_003415168.1.61865 WP_003415168.1.61868 WP_003415168.1.61911 WP_003415168.1.61941 WP_003415168.1.61953 WP_003415168.1.61987 WP_003415168.1.62021 WP_003415168.1.62089 WP_003415168.1.62101 WP_003415168.1.62104 WP_003415168.1.6211 WP_003415168.1.62132 WP_003415168.1.62162 WP_003415168.1.62225 WP_003415168.1.62230 WP_003415168.1.62238 WP_003415168.1.62249 WP_003415168.1.62270 WP_003415168.1.62281 WP_003415168.1.62307 WP_003415168.1.6231 WP_003415168.1.62359 WP_003415168.1.62360 WP_003415168.1.62379 WP_003415168.1.62395 WP_003415168.1.62408 WP_003415168.1.62449 WP_003415168.1.62468 WP_003415168.1.6248 WP_003415168.1.62508 WP_003415168.1.62565 WP_003415168.1.62594 WP_003415168.1.62606 WP_003415168.1.62616 WP_003415168.1.62666 WP_003415168.1.62687 WP_003415168.1.62715 WP_003415168.1.62730 WP_003415168.1.62738 WP_003415168.1.62761 WP_003415168.1.62766 WP_003415168.1.62786 WP_003415168.1.62813 WP_003415168.1.62839 WP_003415168.1.62841 WP_003415168.1.62909 WP_003415168.1.62936 WP_003415168.1.6294 WP_003415168.1.6295 WP_003415168.1.62962 WP_003415168.1.63007 WP_003415168.1.63019 WP_003415168.1.63032 WP_003415168.1.63037 WP_003415168.1.63064 WP_003415168.1.63066 WP_003415168.1.63072 WP_003415168.1.6308 WP_003415168.1.63081 WP_003415168.1.63096 WP_003415168.1.63106 WP_003415168.1.6314 WP_003415168.1.63144 WP_003415168.1.63154 WP_003415168.1.63160 WP_003415168.1.63161 WP_003415168.1.63175 WP_003415168.1.63194 WP_003415168.1.6322 WP_003415168.1.63222 WP_003415168.1.63247 WP_003415168.1.6328 WP_003415168.1.63312 WP_003415168.1.63317 WP_003415168.1.63331 WP_003415168.1.63373 WP_003415168.1.63384 WP_003415168.1.63403 WP_003415168.1.63424 WP_003415168.1.63428 WP_003415168.1.6345 WP_003415168.1.63464 WP_003415168.1.63483 WP_003415168.1.63502 WP_003415168.1.63504 WP_003415168.1.63522 WP_003415168.1.63530 WP_003415168.1.63538 WP_003415168.1.63564 WP_003415168.1.63567 WP_003415168.1.63596 WP_003415168.1.63600 WP_003415168.1.63623 WP_003415168.1.63624 WP_003415168.1.63625 WP_003415168.1.63627 WP_003415168.1.63654 WP_003415168.1.63662 WP_003415168.1.63711 WP_003415168.1.63734 WP_003415168.1.63807 WP_003415168.1.63819 WP_003415168.1.63844 WP_003415168.1.63888 WP_003415168.1.63913 WP_003415168.1.63915 WP_003415168.1.63918 WP_003415168.1.63961 WP_003415168.1.63970 WP_003415168.1.64000 WP_003415168.1.64027 WP_003415168.1.64058 WP_003415168.1.64065 WP_003415168.1.6407 WP_003415168.1.64082 WP_003415168.1.64091 WP_003415168.1.64102 WP_003415168.1.64104 WP_003415168.1.64119 WP_003415168.1.64169 WP_003415168.1.64219 WP_003415168.1.6422 WP_003415168.1.64222 WP_003415168.1.64223 WP_003415168.1.64235 WP_003415168.1.64249 WP_003415168.1.6427 WP_003415168.1.64278 WP_003415168.1.64287 WP_003415168.1.64414 WP_003415168.1.64419 WP_003415168.1.6443 WP_003415168.1.64463 WP_003415168.1.64480 WP_003415168.1.64497 WP_003415168.1.64506 WP_003415168.1.64511 WP_003415168.1.64513 WP_003415168.1.64514 WP_003415168.1.64515 WP_003415168.1.64522 WP_003415168.1.64526 WP_003415168.1.64543 WP_003415168.1.6456 WP_003415168.1.64567 WP_003415168.1.64588 WP_003415168.1.64589 WP_003415168.1.64594 WP_003415168.1.64608 WP_003415168.1.64619 WP_003415168.1.64629 WP_003415168.1.6464 WP_003415168.1.64664 WP_003415168.1.64669 WP_003415168.1.64672 WP_003415168.1.64680 WP_003415168.1.64682 WP_003415168.1.64727 WP_003415168.1.64729 WP_003415168.1.64774 WP_003415168.1.64776 WP_003415168.1.64802 WP_003415168.1.64832 WP_003415168.1.6486 WP_003415168.1.64870 WP_003415168.1.64898 WP_003415168.1.64922 WP_003415168.1.64924 WP_003415168.1.6493 WP_003415168.1.64937 WP_003415168.1.64941 WP_003415168.1.64966 WP_003415168.1.64973 WP_003415168.1.65001 WP_003415168.1.65026 WP_003415168.1.65053 WP_003415168.1.65070 WP_003415168.1.65079 WP_003415168.1.65102 WP_003415168.1.65157 WP_003415168.1.65181 WP_003415168.1.65212 WP_003415168.1.65229 WP_003415168.1.6523 WP_003415168.1.65253 WP_003415168.1.65289 WP_003415168.1.65291 WP_003415168.1.65315 WP_003415168.1.65329 WP_003415168.1.6536 WP_003415168.1.65374 WP_003415168.1.65414 WP_003415168.1.65416 WP_003415168.1.65433 WP_003415168.1.65455 WP_003415168.1.65467 WP_003415168.1.65488 WP_003415168.1.65529 WP_003415168.1.65539 WP_003415168.1.65583 WP_003415168.1.65623 WP_003415168.1.65635 WP_003415168.1.65637 WP_003415168.1.65683 WP_003415168.1.65686 WP_003415168.1.65688 WP_003415168.1.65707 WP_003415168.1.65733 WP_003415168.1.65746 WP_003415168.1.65747 WP_003415168.1.65759 WP_003415168.1.65816 WP_003415168.1.65830 WP_003415168.1.65858 WP_003415168.1.65862 WP_003415168.1.65869 WP_003415168.1.65893 WP_003415168.1.65929 WP_003415168.1.65932 WP_003415168.1.65958 WP_003415168.1.65974 WP_003415168.1.66004 WP_003415168.1.66013 WP_003415168.1.6606 WP_003415168.1.66089 WP_003415168.1.66149 WP_003415168.1.66151 WP_003415168.1.66229 WP_003415168.1.66276 WP_003415168.1.66297 WP_003415168.1.66323 WP_003415168.1.66325 WP_003415168.1.6633 WP_003415168.1.66334 WP_003415168.1.66355 WP_003415168.1.66367 WP_003415168.1.66394 WP_003415168.1.66396 WP_003415168.1.66451 WP_003415168.1.66455 WP_003415168.1.66457 WP_003415168.1.66460 WP_003415168.1.66464 WP_003415168.1.66466 WP_003415168.1.66487 WP_003415168.1.66504 WP_003415168.1.66544 WP_003415168.1.66558 WP_003415168.1.66580 WP_003415168.1.66582 WP_003415168.1.66612 WP_003415168.1.66615 WP_003415168.1.66617 WP_003415168.1.66635 WP_003415168.1.66656 WP_003415168.1.66663 WP_003415168.1.66675 WP_003415168.1.66715 WP_003415168.1.66718 WP_003415168.1.66762 WP_003415168.1.66776 WP_003415168.1.66808 WP_003415168.1.66817 WP_003415168.1.66819 WP_003415168.1.66826 WP_003415168.1.66830 WP_003415168.1.66842 WP_003415168.1.66868 WP_003415168.1.66878 WP_003415168.1.66880 WP_003415168.1.66893 WP_003415168.1.66961 WP_003415168.1.67005 WP_003415168.1.6704 WP_003415168.1.67044 WP_003415168.1.67061 WP_003415168.1.67098 WP_003415168.1.67146 WP_003415168.1.67170 WP_003415168.1.67197 WP_003415168.1.67198 WP_003415168.1.6720 WP_003415168.1.67207 WP_003415168.1.67218 WP_003415168.1.67220 WP_003415168.1.67225 WP_003415168.1.67231 WP_003415168.1.6724 WP_003415168.1.67257 WP_003415168.1.67298 WP_003415168.1.67307 WP_003415168.1.67324 WP_003415168.1.67332 WP_003415168.1.67346 WP_003415168.1.67354 WP_003415168.1.67360 WP_003415168.1.67381 WP_003415168.1.67396 WP_003415168.1.67417 WP_003415168.1.67422 WP_003415168.1.67453 WP_003415168.1.67459 WP_003415168.1.6746 WP_003415168.1.67473 WP_003415168.1.67481 WP_003415168.1.67482 WP_003415168.1.67496 WP_003415168.1.67499 WP_003415168.1.67516 WP_003415168.1.67523 WP_003415168.1.67536 WP_003415168.1.67575 WP_003415168.1.67587 WP_003415168.1.67598 WP_003415168.1.67600 WP_003415168.1.67602 WP_003415168.1.67630 WP_003415168.1.67679 WP_003415168.1.67692 WP_003415168.1.67744 WP_003415168.1.6775 WP_003415168.1.67750 WP_003415168.1.6777 WP_003415168.1.67809 WP_003415168.1.67816 WP_003415168.1.67844 WP_003415168.1.67848 WP_003415168.1.67870 WP_003415168.1.67888 WP_003415168.1.67915 WP_003415168.1.67945 WP_003415168.1.67949 WP_003415168.1.67980 WP_003415168.1.67982 WP_003415168.1.68022 WP_003415168.1.68029 WP_003415168.1.68037 WP_003415168.1.68038 WP_003415168.1.68045 WP_003415168.1.68057 WP_003415168.1.68083 WP_003415168.1.68088 WP_003415168.1.68106 WP_003415168.1.68110 WP_003415168.1.68153 WP_003415168.1.68164 WP_003415168.1.68169 WP_003415168.1.68193 WP_003415168.1.68212 WP_003415168.1.68227 WP_003415168.1.68243 WP_003415168.1.6825 WP_003415168.1.68297 WP_003415168.1.68309 WP_003415168.1.68325 WP_003415168.1.68329 WP_003415168.1.68340 WP_003415168.1.68384 WP_003415168.1.68388 WP_003415168.1.68429 WP_003415168.1.6843 WP_003415168.1.68433 WP_003415168.1.68444 WP_003415168.1.68465 WP_003415168.1.68484 WP_003415168.1.68518 WP_003415168.1.68569 WP_003415168.1.68576 WP_003415168.1.68580 WP_003415168.1.68586 WP_003415168.1.68623 WP_003415168.1.68624 WP_003415168.1.68637 WP_003415168.1.68646 WP_003415168.1.68667 WP_003415168.1.68669 WP_003415168.1.68672 WP_003415168.1.68684 WP_003415168.1.68704 WP_003415168.1.68708 WP_003415168.1.6872 WP_003415168.1.68730 WP_003415168.1.68734 WP_003415168.1.68748 WP_003415168.1.68754 WP_003415168.1.6876 WP_003415168.1.68761 WP_003415168.1.68763 WP_003415168.1.68766 WP_003415168.1.68774 WP_003415168.1.68796 WP_003415168.1.68824 WP_003415168.1.68832 WP_003415168.1.68833 WP_003415168.1.68841 WP_003415168.1.68859 WP_003415168.1.68876 WP_003415168.1.68906 WP_003415168.1.68916 WP_003415168.1.68923 WP_003415168.1.68945 WP_003415168.1.6896 WP_003415168.1.68981 WP_003415168.1.68984 WP_003415168.1.68997 WP_003415168.1.69008 WP_003415168.1.69076 WP_003415168.1.69079 WP_003415168.1.6908 WP_003415168.1.69082 WP_003415168.1.69178 WP_003415168.1.69181 WP_003415168.1.69208 WP_003415168.1.69231 WP_003415168.1.69256 WP_003415168.1.69311 WP_003415168.1.69315 WP_003415168.1.69322 WP_003415168.1.69342 WP_003415168.1.6935 WP_003415168.1.6936 WP_003415168.1.69369 WP_003415168.1.69374 WP_003415168.1.69398 WP_003415168.1.69401 WP_003415168.1.69426 WP_003415168.1.69427 WP_003415168.1.69429 WP_003415168.1.6949 WP_003415168.1.6951 WP_003415168.1.69511 WP_003415168.1.69526 WP_003415168.1.69528 WP_003415168.1.69547 WP_003415168.1.69573 WP_003415168.1.69581 WP_003415168.1.6960 WP_003415168.1.69617 WP_003415168.1.69634 WP_003415168.1.69647 WP_003415168.1.69659 WP_003415168.1.69673 WP_003415168.1.69682 WP_003415168.1.69684 WP_003415168.1.69686 WP_003415168.1.69707 WP_003415168.1.69709 WP_003415168.1.69723 WP_003415168.1.69736 WP_003415168.1.69778 WP_003415168.1.69800 WP_003415168.1.69802 WP_003415168.1.69845 WP_003415168.1.69870 WP_003415168.1.69873 WP_003415168.1.69898 WP_003415168.1.69913 WP_003415168.1.69931 WP_003415168.1.69938 WP_003415168.1.69955 WP_003415168.1.69957 WP_003415168.1.69981 WP_003415168.1.69990 WP_003415168.1.70 WP_003415168.1.70000 WP_003415168.1.70017 WP_003415168.1.70032 WP_003415168.1.70055 WP_003415168.1.70062 WP_003415168.1.70072 WP_003415168.1.70131 WP_003415168.1.70132 WP_003415168.1.7022 WP_003415168.1.70227 WP_003415168.1.70255 WP_003415168.1.70271 WP_003415168.1.70274 WP_003415168.1.7029 WP_003415168.1.70325 WP_003415168.1.70328 WP_003415168.1.70356 WP_003415168.1.70364 WP_003415168.1.70368 WP_003415168.1.70369 WP_003415168.1.70418 WP_003415168.1.70422 WP_003415168.1.70435 WP_003415168.1.70444 WP_003415168.1.70463 WP_003415168.1.70471 WP_003415168.1.70480 WP_003415168.1.70494 WP_003415168.1.70498 WP_003415168.1.70505 WP_003415168.1.70525 WP_003415168.1.70573 WP_003415168.1.70577 WP_003415168.1.70610 WP_003415168.1.70615 WP_003415168.1.70618 WP_003415168.1.70622 WP_003415168.1.70626 WP_003415168.1.70668 WP_003415168.1.70699 WP_003415168.1.70704 WP_003415168.1.70729 WP_003415168.1.70757 WP_003415168.1.70782 WP_003415168.1.70796 WP_003415168.1.70830 WP_003415168.1.70834 WP_003415168.1.7084 WP_003415168.1.70840 WP_003415168.1.70864 WP_003415168.1.70871 WP_003415168.1.70915 WP_003415168.1.70955 WP_003415168.1.70958 WP_003415168.1.70964 WP_003415168.1.70976 WP_003415168.1.71015 WP_003415168.1.71026 WP_003415168.1.71063 WP_003415168.1.71076 WP_003415168.1.71083 WP_003415168.1.71118 WP_003415168.1.7113 WP_003415168.1.71187 WP_003415168.1.71191 WP_003415168.1.71255 WP_003415168.1.71258 WP_003415168.1.71259 WP_003415168.1.71289 WP_003415168.1.71326 WP_003415168.1.71329 WP_003415168.1.71331 WP_003415168.1.71344 WP_003415168.1.71390 WP_003415168.1.71414 WP_003415168.1.71440 WP_003415168.1.71457 WP_003415168.1.71464 WP_003415168.1.71490 WP_003415168.1.71492 WP_003415168.1.71509 WP_003415168.1.71516 WP_003415168.1.71517 WP_003415168.1.71527 WP_003415168.1.71532 WP_003415168.1.71545 WP_003415168.1.71546 WP_003415168.1.71569 WP_003415168.1.71604 WP_003415168.1.71621 WP_003415168.1.71630 WP_003415168.1.71638 WP_003415168.1.71654 WP_003415168.1.71664 WP_003415168.1.71665 WP_003415168.1.71683 WP_003415168.1.71701 WP_003415168.1.71718 WP_003415168.1.71731 WP_003415168.1.71778 WP_003415168.1.71781 WP_003415168.1.71803 WP_003415168.1.71820 WP_003415168.1.71847 WP_003415168.1.7185 WP_003415168.1.71851 WP_003415168.1.71871 WP_003415168.1.71909 WP_003415168.1.71957 WP_003415168.1.71970 WP_003415168.1.72047 WP_003415168.1.72061 WP_003415168.1.72062 WP_003415168.1.72072 WP_003415168.1.72111 WP_003415168.1.72122 WP_003415168.1.72128 WP_003415168.1.72143 WP_003415168.1.7216 WP_003415168.1.72168 WP_003415168.1.72179 WP_003415168.1.72209 WP_003415168.1.72218 WP_003415168.1.72219 WP_003415168.1.72227 WP_003415168.1.7224 WP_003415168.1.72268 WP_003415168.1.72332 WP_003415168.1.72380 WP_003415168.1.72401 WP_003415168.1.72405 WP_003415168.1.72420 WP_003415168.1.72441 WP_003415168.1.72451 WP_003415168.1.72452 WP_003415168.1.72457 WP_003415168.1.72459 WP_003415168.1.72460 WP_003415168.1.72466 WP_003415168.1.72487 WP_003415168.1.72488 WP_003415168.1.72492 WP_003415168.1.72506 WP_003415168.1.72543 WP_003415168.1.7256 WP_003415168.1.72576 WP_003415168.1.72578 WP_003415168.1.72585 WP_003415168.1.72591 WP_003415168.1.72592 WP_003415168.1.72640 WP_003415168.1.7266 WP_003415168.1.72661 WP_003415168.1.72684 WP_003415168.1.72739 WP_003415168.1.72744 WP_003415168.1.72755 WP_003415168.1.72759 WP_003415168.1.72784 WP_003415168.1.72792 WP_003415168.1.72826 WP_003415168.1.72831 WP_003415168.1.72852 WP_003415168.1.72853 WP_003415168.1.72879 WP_003415168.1.72880 WP_003415168.1.72938 WP_003415168.1.72954 WP_003415168.1.72957 WP_003415168.1.72959 WP_003415168.1.72973 WP_003415168.1.7298 WP_003415168.1.72982 WP_003415168.1.72988 WP_003415168.1.72993 WP_003415168.1.73006 WP_003415168.1.73013 WP_003415168.1.73025 WP_003415168.1.73028 WP_003415168.1.73042 WP_003415168.1.73045 WP_003415168.1.73092 WP_003415168.1.73118 WP_003415168.1.7312 WP_003415168.1.73127 WP_003415168.1.73134 WP_003415168.1.73150 WP_003415168.1.73154 WP_003415168.1.73163 WP_003415168.1.73182 WP_003415168.1.7321 WP_003415168.1.73310 WP_003415168.1.73365 WP_003415168.1.73391 WP_003415168.1.73404 WP_003415168.1.73424 WP_003415168.1.73436 WP_003415168.1.73445 WP_003415168.1.73453 WP_003415168.1.73465 WP_003415168.1.73466 WP_003415168.1.73470 WP_003415168.1.73471 WP_003415168.1.73478 WP_003415168.1.73482 WP_003415168.1.73507 WP_003415168.1.73532 WP_003415168.1.73550 WP_003415168.1.73564 WP_003415168.1.73623 WP_003415168.1.73629 WP_003415168.1.73644 WP_003415168.1.7366 WP_003415168.1.73661 WP_003415168.1.7368 WP_003415168.1.73688 WP_003415168.1.73744 WP_003415168.1.73750 WP_003415168.1.73760 WP_003415168.1.73774 WP_003415168.1.7379 WP_003415168.1.73813 WP_003415168.1.73840 WP_003415168.1.74016 WP_003415168.1.74039 WP_003415168.1.74083 WP_003415168.1.74101 WP_003415168.1.74107 WP_003415168.1.74129 WP_003415168.1.74144 WP_003415168.1.7417 WP_003415168.1.74190 WP_003415168.1.74210 WP_003415168.1.7423 WP_003415168.1.74259 WP_003415168.1.74262 WP_003415168.1.74269 WP_003415168.1.74282 WP_003415168.1.74291 WP_003415168.1.74296 WP_003415168.1.74304 WP_003415168.1.7432 WP_003415168.1.74347 WP_003415168.1.7436 WP_003415168.1.74378 WP_003415168.1.74382 WP_003415168.1.74395 WP_003415168.1.74400 WP_003415168.1.74401 WP_003415168.1.74432 WP_003415168.1.74442 WP_003415168.1.74477 WP_003415168.1.74487 WP_003415168.1.74499 WP_003415168.1.74504 WP_003415168.1.74511 WP_003415168.1.74523 WP_003415168.1.74525 WP_003415168.1.74551 WP_003415168.1.74555 WP_003415168.1.74628 WP_003415168.1.74641 WP_003415168.1.74653 WP_003415168.1.74660 WP_003415168.1.74683 WP_003415168.1.7469 WP_003415168.1.74725 WP_003415168.1.74760 WP_003415168.1.74786 WP_003415168.1.74809 WP_003415168.1.74820 WP_003415168.1.74870 WP_003415168.1.74881 WP_003415168.1.74888 WP_003415168.1.74952 WP_003415168.1.7496 WP_003415168.1.74988 WP_003415168.1.75043 WP_003415168.1.75055 WP_003415168.1.75078 WP_003415168.1.75081 WP_003415168.1.75120 WP_003415168.1.75163 WP_003415168.1.75188 WP_003415168.1.75200 WP_003415168.1.75202 WP_003415168.1.75234 WP_003415168.1.75250 WP_003415168.1.75263 WP_003415168.1.75281 WP_003415168.1.75342 WP_003415168.1.7535 WP_003415168.1.75376 WP_003415168.1.75391 WP_003415168.1.75395 WP_003415168.1.75510 WP_003415168.1.75581 WP_003415168.1.75598 WP_003415168.1.75635 WP_003415168.1.75645 WP_003415168.1.75665 WP_003415168.1.75671 WP_003415168.1.75741 WP_003415168.1.75749 WP_003415168.1.75772 WP_003415168.1.75774 WP_003415168.1.75811 WP_003415168.1.75833 WP_003415168.1.7585 WP_003415168.1.75864 WP_003415168.1.75868 WP_003415168.1.75878 WP_003415168.1.75927 WP_003415168.1.75946 WP_003415168.1.75968 WP_003415168.1.75974 WP_003415168.1.76007 WP_003415168.1.76016 WP_003415168.1.76032 WP_003415168.1.7604 WP_003415168.1.76045 WP_003415168.1.76052 WP_003415168.1.76058 WP_003415168.1.76064 WP_003415168.1.76110 WP_003415168.1.76126 WP_003415168.1.76133 WP_003415168.1.76138 WP_003415168.1.76157 WP_003415168.1.76172 WP_003415168.1.76177 WP_003415168.1.76183 WP_003415168.1.76209 WP_003415168.1.76239 WP_003415168.1.76272 WP_003415168.1.76277 WP_003415168.1.76281 WP_003415168.1.76291 WP_003415168.1.76297 WP_003415168.1.76360 WP_003415168.1.76379 WP_003415168.1.76403 WP_003415168.1.76413 WP_003415168.1.76414 WP_003415168.1.76427 WP_003415168.1.76436 WP_003415168.1.76442 WP_003415168.1.76443 WP_003415168.1.76456 WP_003415168.1.76521 WP_003415168.1.76533 WP_003415168.1.76616 WP_003415168.1.76625 WP_003415168.1.76629 WP_003415168.1.76635 WP_003415168.1.76638 WP_003415168.1.76639 WP_003415168.1.76640 WP_003415168.1.76644 WP_003415168.1.76677 WP_003415168.1.76678 WP_003415168.1.76734 WP_003415168.1.76744 WP_003415168.1.76750 WP_003415168.1.76754 WP_003415168.1.76757 WP_003415168.1.76781 WP_003415168.1.76818 WP_003415168.1.76824 WP_003415168.1.76835 WP_003415168.1.76873 WP_003415168.1.76888 WP_003415168.1.76900 WP_003415168.1.7691 WP_003415168.1.76947 WP_003415168.1.76954 WP_003415168.1.76955 WP_003415168.1.76963 WP_003415168.1.76976 WP_003415168.1.770 WP_003415168.1.77000 WP_003415168.1.77008 WP_003415168.1.77021 WP_003415168.1.77056 WP_003415168.1.77065 WP_003415168.1.77075 WP_003415168.1.77093 WP_003415168.1.77107 WP_003415168.1.77115 WP_003415168.1.77118 WP_003415168.1.77125 WP_003415168.1.77141 WP_003415168.1.77142 WP_003415168.1.77166 WP_003415168.1.77250 WP_003415168.1.77252 WP_003415168.1.77260 WP_003415168.1.77266 WP_003415168.1.77280 WP_003415168.1.77285 WP_003415168.1.77312 WP_003415168.1.77348 WP_003415168.1.77351 WP_003415168.1.77352 WP_003415168.1.77361 WP_003415168.1.774 WP_003415168.1.7740 WP_003415168.1.77404 WP_003415168.1.77425 WP_003415168.1.77463 WP_003415168.1.77474 WP_003415168.1.7748 WP_003415168.1.77484 WP_003415168.1.77491 WP_003415168.1.77499 WP_003415168.1.77510 WP_003415168.1.77530 WP_003415168.1.77554 WP_003415168.1.77559 WP_003415168.1.77599 WP_003415168.1.77605 WP_003415168.1.7762 WP_003415168.1.77627 WP_003415168.1.77649 WP_003415168.1.77654 WP_003415168.1.7766 WP_003415168.1.77667 WP_003415168.1.77704 WP_003415168.1.77706 WP_003415168.1.77726 WP_003415168.1.77774 WP_003415168.1.7778 WP_003415168.1.77790 WP_003415168.1.77809 WP_003415168.1.77820 WP_003415168.1.77843 WP_003415168.1.77855 WP_003415168.1.77865 WP_003415168.1.77868 WP_003415168.1.77879 WP_003415168.1.77890 WP_003415168.1.77909 WP_003415168.1.77911 WP_003415168.1.77931 WP_003415168.1.77984 WP_003415168.1.78020 WP_003415168.1.78024 WP_003415168.1.78075 WP_003415168.1.78084 WP_003415168.1.7809 WP_003415168.1.78098 WP_003415168.1.78105 WP_003415168.1.78113 WP_003415168.1.78136 WP_003415168.1.78162 WP_003415168.1.7817 WP_003415168.1.78200 WP_003415168.1.78216 WP_003415168.1.78236 WP_003415168.1.78238 WP_003415168.1.78322 WP_003415168.1.78338 WP_003415168.1.78360 WP_003415168.1.78386 WP_003415168.1.78429 WP_003415168.1.78435 WP_003415168.1.7844 WP_003415168.1.78459 WP_003415168.1.78488 WP_003415168.1.7849 WP_003415168.1.78499 WP_003415168.1.785 WP_003415168.1.78516 WP_003415168.1.78524 WP_003415168.1.78526 WP_003415168.1.78538 WP_003415168.1.78545 WP_003415168.1.78547 WP_003415168.1.78574 WP_003415168.1.78580 WP_003415168.1.7860 WP_003415168.1.78620 WP_003415168.1.78646 WP_003415168.1.78648 WP_003415168.1.78649 WP_003415168.1.78655 WP_003415168.1.78657 WP_003415168.1.78659 WP_003415168.1.7869 WP_003415168.1.78692 WP_003415168.1.78760 WP_003415168.1.78766 WP_003415168.1.78776 WP_003415168.1.78778 WP_003415168.1.78784 WP_003415168.1.78788 WP_003415168.1.78790 WP_003415168.1.78793 WP_003415168.1.78848 WP_003415168.1.78860 WP_003415168.1.7887 WP_003415168.1.78884 WP_003415168.1.78932 WP_003415168.1.78969 WP_003415168.1.78977 WP_003415168.1.78980 WP_003415168.1.79005 WP_003415168.1.79016 WP_003415168.1.79033 WP_003415168.1.79064 WP_003415168.1.79066 WP_003415168.1.79068 WP_003415168.1.79077 WP_003415168.1.79095 WP_003415168.1.79112 WP_003415168.1.79122 WP_003415168.1.79145 WP_003415168.1.79152 WP_003415168.1.79163 WP_003415168.1.79182 WP_003415168.1.79198 WP_003415168.1.79213 WP_003415168.1.79218 WP_003415168.1.79268 WP_003415168.1.79273 WP_003415168.1.79278 WP_003415168.1.79290 WP_003415168.1.79319 WP_003415168.1.79325 WP_003415168.1.79326 WP_003415168.1.7933 WP_003415168.1.79330 WP_003415168.1.79339 WP_003415168.1.79394 WP_003415168.1.79399 WP_003415168.1.79413 WP_003415168.1.79422 WP_003415168.1.79445 WP_003415168.1.79447 WP_003415168.1.79455 WP_003415168.1.79471 WP_003415168.1.79480 WP_003415168.1.79488 WP_003415168.1.79500 WP_003415168.1.79502 WP_003415168.1.79508 WP_003415168.1.79514 WP_003415168.1.79561 WP_003415168.1.79565 WP_003415168.1.79578 WP_003415168.1.79588 WP_003415168.1.79598 WP_003415168.1.79615 WP_003415168.1.79684 WP_003415168.1.79698 WP_003415168.1.797 WP_003415168.1.79744 WP_003415168.1.79784 WP_003415168.1.79806 WP_003415168.1.79819 WP_003415168.1.79826 WP_003415168.1.79828 WP_003415168.1.79851 WP_003415168.1.79853 WP_003415168.1.79863 WP_003415168.1.79881 WP_003415168.1.79885 WP_003415168.1.79898 WP_003415168.1.7990 WP_003415168.1.79900 WP_003415168.1.79913 WP_003415168.1.79918 WP_003415168.1.79947 WP_003415168.1.79948 WP_003415168.1.7995 WP_003415168.1.7997 WP_003415168.1.80004 WP_003415168.1.80015 WP_003415168.1.80022 WP_003415168.1.80030 WP_003415168.1.80054 WP_003415168.1.80084 WP_003415168.1.80099 WP_003415168.1.80129 WP_003415168.1.80177 WP_003415168.1.80234 WP_003415168.1.8026 WP_003415168.1.80275 WP_003415168.1.8029 WP_003415168.1.80299 WP_003415168.1.80300 WP_003415168.1.80304 WP_003415168.1.80326 WP_003415168.1.80351 WP_003415168.1.8037 WP_003415168.1.80370 WP_003415168.1.80399 WP_003415168.1.80451 WP_003415168.1.80458 WP_003415168.1.80461 WP_003415168.1.80490 WP_003415168.1.80503 WP_003415168.1.80507 WP_003415168.1.80552 WP_003415168.1.80576 WP_003415168.1.80588 WP_003415168.1.80599 WP_003415168.1.8060 WP_003415168.1.80624 WP_003415168.1.80636 WP_003415168.1.80673 WP_003415168.1.80711 WP_003415168.1.80714 WP_003415168.1.80743 WP_003415168.1.80784 WP_003415168.1.80815 WP_003415168.1.80853 WP_003415168.1.80918 WP_003415168.1.8093 WP_003415168.1.80967 WP_003415168.1.8097 WP_003415168.1.80988 WP_003415168.1.81007 WP_003415168.1.81013 WP_003415168.1.8105 WP_003415168.1.81059 WP_003415168.1.81066 WP_003415168.1.81075 WP_003415168.1.81091 WP_003415168.1.81125 WP_003415168.1.81136 WP_003415168.1.8114 WP_003415168.1.81192 WP_003415168.1.812 WP_003415168.1.81230 WP_003415168.1.81249 WP_003415168.1.81250 WP_003415168.1.81264 WP_003415168.1.8128 WP_003415168.1.81287 WP_003415168.1.81297 WP_003415168.1.8138 WP_003415168.1.81407 WP_003415168.1.8143 WP_003415168.1.81439 WP_003415168.1.81465 WP_003415168.1.81529 WP_003415168.1.81538 WP_003415168.1.81541 WP_003415168.1.81560 WP_003415168.1.81561 WP_003415168.1.81583 WP_003415168.1.81686 WP_003415168.1.81712 WP_003415168.1.81720 WP_003415168.1.81731 WP_003415168.1.81774 WP_003415168.1.81788 WP_003415168.1.81820 WP_003415168.1.81850 WP_003415168.1.81883 WP_003415168.1.81891 WP_003415168.1.81911 WP_003415168.1.81918 WP_003415168.1.82011 WP_003415168.1.82048 WP_003415168.1.82069 WP_003415168.1.82071 WP_003415168.1.82108 WP_003415168.1.82136 WP_003415168.1.82142 WP_003415168.1.8215 WP_003415168.1.82158 WP_003415168.1.8217 WP_003415168.1.82209 WP_003415168.1.82210 WP_003415168.1.82228 WP_003415168.1.82236 WP_003415168.1.82251 WP_003415168.1.82271 WP_003415168.1.82305 WP_003415168.1.82307 WP_003415168.1.82309 WP_003415168.1.82317 WP_003415168.1.8232 WP_003415168.1.82346 WP_003415168.1.82374 WP_003415168.1.82385 WP_003415168.1.82429 WP_003415168.1.82460 WP_003415168.1.82462 WP_003415168.1.82483 WP_003415168.1.82494 WP_003415168.1.82531 WP_003415168.1.82546 WP_003415168.1.82549 WP_003415168.1.82577 WP_003415168.1.82592 WP_003415168.1.82597 WP_003415168.1.82598 WP_003415168.1.82625 WP_003415168.1.82642 WP_003415168.1.82651 WP_003415168.1.82653 WP_003415168.1.82681 WP_003415168.1.82685 WP_003415168.1.8271 WP_003415168.1.82712 WP_003415168.1.8273 WP_003415168.1.82743 WP_003415168.1.82757 WP_003415168.1.82774 WP_003415168.1.82803 WP_003415168.1.82860 WP_003415168.1.82871 WP_003415168.1.82892 WP_003415168.1.82935 WP_003415168.1.82957 WP_003415168.1.82973 WP_003415168.1.82981 WP_003415168.1.82983 WP_003415168.1.83004 WP_003415168.1.83009 WP_003415168.1.83044 WP_003415168.1.83074 WP_003415168.1.83110 WP_003415168.1.83146 WP_003415168.1.83149 WP_003415168.1.83159 WP_003415168.1.8317 WP_003415168.1.83173 WP_003415168.1.83181 WP_003415168.1.83182 WP_003415168.1.83191 WP_003415168.1.83197 WP_003415168.1.83212 WP_003415168.1.8326 WP_003415168.1.83262 WP_003415168.1.83268 WP_003415168.1.83273 WP_003415168.1.83309 WP_003415168.1.83332 WP_003415168.1.83334 WP_003415168.1.83341 WP_003415168.1.83349 WP_003415168.1.8335 WP_003415168.1.83353 WP_003415168.1.83367 WP_003415168.1.83380 WP_003415168.1.83381 WP_003415168.1.83389 WP_003415168.1.83408 WP_003415168.1.83409 WP_003415168.1.83435 WP_003415168.1.83470 WP_003415168.1.83524 WP_003415168.1.83526 WP_003415168.1.8358 WP_003415168.1.83589 WP_003415168.1.83601 WP_003415168.1.83611 WP_003415168.1.83638 WP_003415168.1.83648 WP_003415168.1.83656 WP_003415168.1.83667 WP_003415168.1.83689 WP_003415168.1.83692 WP_003415168.1.83704 WP_003415168.1.83705 WP_003415168.1.83793 WP_003415168.1.83794 WP_003415168.1.83802 WP_003415168.1.83805 WP_003415168.1.83839 WP_003415168.1.83842 WP_003415168.1.83850 WP_003415168.1.83861 WP_003415168.1.83884 WP_003415168.1.83920 WP_003415168.1.83929 WP_003415168.1.83975 WP_003415168.1.83991 WP_003415168.1.8400 WP_003415168.1.84027 WP_003415168.1.8404 WP_003415168.1.84057 WP_003415168.1.84070 WP_003415168.1.8409 WP_003415168.1.84112 WP_003415168.1.84146 WP_003415168.1.8415 WP_003415168.1.84176 WP_003415168.1.84186 WP_003415168.1.84192 WP_003415168.1.84228 WP_003415168.1.8424 WP_003415168.1.84244 WP_003415168.1.84259 WP_003415168.1.8426 WP_003415168.1.84277 WP_003415168.1.84287 WP_003415168.1.8434 WP_003415168.1.84388 WP_003415168.1.84408 WP_003415168.1.84409 WP_003415168.1.84438 WP_003415168.1.84460 WP_003415168.1.84488 WP_003415168.1.84504 WP_003415168.1.84525 WP_003415168.1.84620 WP_003415168.1.84641 WP_003415168.1.84655 WP_003415168.1.84666 WP_003415168.1.84670 WP_003415168.1.84739 WP_003415168.1.84748 WP_003415168.1.84766 WP_003415168.1.84772 WP_003415168.1.84774 WP_003415168.1.848 WP_003415168.1.84812 WP_003415168.1.84836 WP_003415168.1.84839 WP_003415168.1.84846 WP_003415168.1.84873 WP_003415168.1.84911 WP_003415168.1.84938 WP_003415168.1.84968 WP_003415168.1.84973 WP_003415168.1.84981 WP_003415168.1.84985 WP_003415168.1.8503 WP_003415168.1.85038 WP_003415168.1.85041 WP_003415168.1.85043 WP_003415168.1.8505 WP_003415168.1.85074 WP_003415168.1.8509 WP_003415168.1.8512 WP_003415168.1.85148 WP_003415168.1.8518 WP_003415168.1.85242 WP_003415168.1.85276 WP_003415168.1.85281 WP_003415168.1.85284 WP_003415168.1.85314 WP_003415168.1.85319 WP_003415168.1.85330 WP_003415168.1.85341 WP_003415168.1.85346 WP_003415168.1.8535 WP_003415168.1.85363 WP_003415168.1.85371 WP_003415168.1.85377 WP_003415168.1.85387 WP_003415168.1.85399 WP_003415168.1.85458 WP_003415168.1.8546 WP_003415168.1.85464 WP_003415168.1.85478 WP_003415168.1.85480 WP_003415168.1.85488 WP_003415168.1.85495 WP_003415168.1.85551 WP_003415168.1.85557 WP_003415168.1.85577 WP_003415168.1.85597 WP_003415168.1.85599 WP_003415168.1.85610 WP_003415168.1.8563 WP_003415168.1.85648 WP_003415168.1.85679 WP_003415168.1.85704 WP_003415168.1.85717 WP_003415168.1.85737 WP_003415168.1.85763 WP_003415168.1.85808 WP_003415168.1.85819 WP_003415168.1.85820 WP_003415168.1.85823 WP_003415168.1.85832 WP_003415168.1.8586 WP_003415168.1.85872 WP_003415168.1.85894 WP_003415168.1.85909 WP_003415168.1.85913 WP_003415168.1.85953 WP_003415168.1.85986 WP_003415168.1.86000 WP_003415168.1.86024 WP_003415168.1.86025 WP_003415168.1.86032 WP_003415168.1.86048 WP_003415168.1.86052 WP_003415168.1.86067 WP_003415168.1.86103 WP_003415168.1.86122 WP_003415168.1.86124 WP_003415168.1.86160 WP_003415168.1.86164 WP_003415168.1.86168 WP_003415168.1.86190 WP_003415168.1.86208 WP_003415168.1.86235 WP_003415168.1.86249 WP_003415168.1.86260 WP_003415168.1.86290 WP_003415168.1.863 WP_003415168.1.86327 WP_003415168.1.86334 WP_003415168.1.86337 WP_003415168.1.86368 WP_003415168.1.86377 WP_003415168.1.86425 WP_003415168.1.86459 WP_003415168.1.8649 WP_003415168.1.86499 WP_003415168.1.86520 WP_003415168.1.86561 WP_003415168.1.86568 WP_003415168.1.86575 WP_003415168.1.86584 WP_003415168.1.86605 WP_003415168.1.86626 WP_003415168.1.86648 WP_003415168.1.8666 WP_003415168.1.86684 WP_003415168.1.86696 WP_003415168.1.86705 WP_003415168.1.86718 WP_003415168.1.86725 WP_003415168.1.86766 WP_003415168.1.86801 WP_003415168.1.86820 WP_003415168.1.86825 WP_003415168.1.86834 WP_003415168.1.8685 WP_003415168.1.86851 WP_003415168.1.86855 WP_003415168.1.86867 WP_003415168.1.86877 WP_003415168.1.86883 WP_003415168.1.8689 WP_003415168.1.86892 WP_003415168.1.86933 WP_003415168.1.86941 WP_003415168.1.86950 WP_003415168.1.86962 WP_003415168.1.86963 WP_003415168.1.86979 WP_003415168.1.8700 WP_003415168.1.87001 WP_003415168.1.87002 WP_003415168.1.87031 WP_003415168.1.87116 WP_003415168.1.87117 WP_003415168.1.8714 WP_003415168.1.87162 WP_003415168.1.87178 WP_003415168.1.87191 WP_003415168.1.87201 WP_003415168.1.87209 WP_003415168.1.87266 WP_003415168.1.87273 WP_003415168.1.87275 WP_003415168.1.8733 WP_003415168.1.87345 WP_003415168.1.8737 WP_003415168.1.87401 WP_003415168.1.87404 WP_003415168.1.87406 WP_003415168.1.87409 WP_003415168.1.87444 WP_003415168.1.87446 WP_003415168.1.87459 WP_003415168.1.87472 WP_003415168.1.87489 WP_003415168.1.87494 WP_003415168.1.87496 WP_003415168.1.87582 WP_003415168.1.87588 WP_003415168.1.87617 WP_003415168.1.87619 WP_003415168.1.87620 WP_003415168.1.87634 WP_003415168.1.87643 WP_003415168.1.8765 WP_003415168.1.87650 WP_003415168.1.87654 WP_003415168.1.87658 WP_003415168.1.87665 WP_003415168.1.87676 WP_003415168.1.87677 WP_003415168.1.87684 WP_003415168.1.87692 WP_003415168.1.87707 WP_003415168.1.87732 WP_003415168.1.87784 WP_003415168.1.87796 WP_003415168.1.87809 WP_003415168.1.87817 WP_003415168.1.87827 WP_003415168.1.87831 WP_003415168.1.87835 WP_003415168.1.87837 WP_003415168.1.87866 WP_003415168.1.8789 WP_003415168.1.87911 WP_003415168.1.87924 WP_003415168.1.87951 WP_003415168.1.87955 WP_003415168.1.87956 WP_003415168.1.87991 WP_003415168.1.88 WP_003415168.1.88002 WP_003415168.1.88037 WP_003415168.1.88039 WP_003415168.1.88072 WP_003415168.1.88077 WP_003415168.1.88121 WP_003415168.1.88180 WP_003415168.1.88191 WP_003415168.1.88205 WP_003415168.1.88217 WP_003415168.1.88219 WP_003415168.1.88245 WP_003415168.1.88253 WP_003415168.1.88294 WP_003415168.1.88315 WP_003415168.1.88316 WP_003415168.1.88320 WP_003415168.1.88338 WP_003415168.1.8840 WP_003415168.1.88437 WP_003415168.1.88453 WP_003415168.1.88469 WP_003415168.1.88489 WP_003415168.1.88507 WP_003415168.1.88521 WP_003415168.1.88530 WP_003415168.1.88537 WP_003415168.1.88541 WP_003415168.1.88592 WP_003415168.1.88616 WP_003415168.1.88618 WP_003415168.1.8862 WP_003415168.1.88625 WP_003415168.1.88632 WP_003415168.1.88634 WP_003415168.1.88649 WP_003415168.1.8870 WP_003415168.1.88737 WP_003415168.1.88824 WP_003415168.1.88886 WP_003415168.1.88965 WP_003415168.1.88985 WP_003415168.1.8902 WP_003415168.1.89025 WP_003415168.1.89041 WP_003415168.1.89046 WP_003415168.1.89082 WP_003415168.1.89162 WP_003415168.1.89168 WP_003415168.1.8917 WP_003415168.1.89193 WP_003415168.1.89205 WP_003415168.1.89207 WP_003415168.1.89225 WP_003415168.1.8925 WP_003415168.1.89277 WP_003415168.1.89286 WP_003415168.1.89293 WP_003415168.1.89320 WP_003415168.1.8935 WP_003415168.1.89371 WP_003415168.1.89378 WP_003415168.1.89392 WP_003415168.1.89406 WP_003415168.1.8943 WP_003415168.1.89451 WP_003415168.1.89453 WP_003415168.1.89473 WP_003415168.1.89475 WP_003415168.1.89483 WP_003415168.1.895 WP_003415168.1.89513 WP_003415168.1.89517 WP_003415168.1.8954 WP_003415168.1.89543 WP_003415168.1.89567 WP_003415168.1.8957 WP_003415168.1.89572 WP_003415168.1.89589 WP_003415168.1.89607 WP_003415168.1.89613 WP_003415168.1.89625 WP_003415168.1.89648 WP_003415168.1.8967 WP_003415168.1.89670 WP_003415168.1.89676 WP_003415168.1.89729 WP_003415168.1.89739 WP_003415168.1.89762 WP_003415168.1.8977 WP_003415168.1.89802 WP_003415168.1.89808 WP_003415168.1.8982 WP_003415168.1.89829 WP_003415168.1.89831 WP_003415168.1.89844 WP_003415168.1.89849 WP_003415168.1.8989 WP_003415168.1.89901 WP_003415168.1.89903 WP_003415168.1.89909 WP_003415168.1.89922 WP_003415168.1.89926 WP_003415168.1.89963 WP_003415168.1.89971 WP_003415168.1.89987 WP_003415168.1.900 WP_003415168.1.90048 WP_003415168.1.9007 WP_003415168.1.90080 WP_003415168.1.90130 WP_003415168.1.90134 WP_003415168.1.90137 WP_003415168.1.90157 WP_003415168.1.90184 WP_003415168.1.90199 WP_003415168.1.90231 WP_003415168.1.90308 WP_003415168.1.90322 WP_003415168.1.90328 WP_003415168.1.90372 WP_003415168.1.90439 WP_003415168.1.90481 WP_003415168.1.90499 WP_003415168.1.9050 WP_003415168.1.90527 WP_003415168.1.90550 WP_003415168.1.90560 WP_003415168.1.90612 WP_003415168.1.90640 WP_003415168.1.90672 WP_003415168.1.90691 WP_003415168.1.90711 WP_003415168.1.90722 WP_003415168.1.9075 WP_003415168.1.90756 WP_003415168.1.90767 WP_003415168.1.90771 WP_003415168.1.90785 WP_003415168.1.90788 WP_003415168.1.90800 WP_003415168.1.90810 WP_003415168.1.90816 WP_003415168.1.90819 WP_003415168.1.9082 WP_003415168.1.90831 WP_003415168.1.90884 WP_003415168.1.90899 WP_003415168.1.90906 WP_003415168.1.90958 WP_003415168.1.90976 WP_003415168.1.90977 WP_003415168.1.90987 WP_003415168.1.9102 WP_003415168.1.91026 WP_003415168.1.91032 WP_003415168.1.91043 WP_003415168.1.91053 WP_003415168.1.91082 WP_003415168.1.91106 WP_003415168.1.91112 WP_003415168.1.91144 WP_003415168.1.91151 WP_003415168.1.91157 WP_003415168.1.91167 WP_003415168.1.91169 WP_003415168.1.91192 WP_003415168.1.91201 WP_003415168.1.91207 WP_003415168.1.91208 WP_003415168.1.91211 WP_003415168.1.91214 WP_003415168.1.91230 WP_003415168.1.91244 WP_003415168.1.91251 WP_003415168.1.91260 WP_003415168.1.91265 WP_003415168.1.9128 WP_003415168.1.91294 WP_003415168.1.91303 WP_003415168.1.91322 WP_003415168.1.91352 WP_003415168.1.91386 WP_003415168.1.9139 WP_003415168.1.91398 WP_003415168.1.91411 WP_003415168.1.91430 WP_003415168.1.91436 WP_003415168.1.91483 WP_003415168.1.91496 WP_003415168.1.91507 WP_003415168.1.91508 WP_003415168.1.91576 WP_003415168.1.91589 WP_003415168.1.91694 WP_003415168.1.91695 WP_003415168.1.91713 WP_003415168.1.91716 WP_003415168.1.91717 WP_003415168.1.91728 WP_003415168.1.91759 WP_003415168.1.91784 WP_003415168.1.91785 WP_003415168.1.91786 WP_003415168.1.91802 WP_003415168.1.91822 WP_003415168.1.91828 WP_003415168.1.9189 WP_003415168.1.91896 WP_003415168.1.9190 WP_003415168.1.91915 WP_003415168.1.91931 WP_003415168.1.91944 WP_003415168.1.91953 WP_003415168.1.91957 WP_003415168.1.91976 WP_003415168.1.91978 WP_003415168.1.92021 WP_003415168.1.92083 WP_003415168.1.92127 WP_003415168.1.92144 WP_003415168.1.92150 WP_003415168.1.92153 WP_003415168.1.92190 WP_003415168.1.92192 WP_003415168.1.92200 WP_003415168.1.92220 WP_003415168.1.92221 WP_003415168.1.92222 WP_003415168.1.92289 WP_003415168.1.9229 WP_003415168.1.92294 WP_003415168.1.92300 WP_003415168.1.92317 WP_003415168.1.92334 WP_003415168.1.92338 WP_003415168.1.92345 WP_003415168.1.92356 WP_003415168.1.92364 WP_003415168.1.92380 WP_003415168.1.92428 WP_003415168.1.92447 WP_003415168.1.92456 WP_003415168.1.92467 WP_003415168.1.92471 WP_003415168.1.92490 WP_003415168.1.92508 WP_003415168.1.9251 WP_003415168.1.92511 WP_003415168.1.92523 WP_003415168.1.92527 WP_003415168.1.92536 WP_003415168.1.92592 WP_003415168.1.92603 WP_003415168.1.92606 WP_003415168.1.92610 WP_003415168.1.92613 WP_003415168.1.9263 WP_003415168.1.9265 WP_003415168.1.92650 WP_003415168.1.92660 WP_003415168.1.92677 WP_003415168.1.92685 WP_003415168.1.92689 WP_003415168.1.92690 WP_003415168.1.92714 WP_003415168.1.92736 WP_003415168.1.9274 WP_003415168.1.92752 WP_003415168.1.92760 WP_003415168.1.92777 WP_003415168.1.92803 WP_003415168.1.92833 WP_003415168.1.92856 WP_003415168.1.92881 WP_003415168.1.92892 WP_003415168.1.92907 WP_003415168.1.92908 WP_003415168.1.9291 WP_003415168.1.92917 WP_003415168.1.92996 WP_003415168.1.93006 WP_003415168.1.93008 WP_003415168.1.93009 WP_003415168.1.93015 WP_003415168.1.93043 WP_003415168.1.9307 WP_003415168.1.93083 WP_003415168.1.93137 WP_003415168.1.93192 WP_003415168.1.93203 WP_003415168.1.93212 WP_003415168.1.93234 WP_003415168.1.93245 WP_003415168.1.93257 WP_003415168.1.93265 WP_003415168.1.93297 WP_003415168.1.93320 WP_003415168.1.93328 WP_003415168.1.93337 WP_003415168.1.93343 WP_003415168.1.93349 WP_003415168.1.93363 WP_003415168.1.93377 WP_003415168.1.9338 WP_003415168.1.93407 WP_003415168.1.93419 WP_003415168.1.93426 WP_003415168.1.9344 WP_003415168.1.93443 WP_003415168.1.93447 WP_003415168.1.93470 WP_003415168.1.93483 WP_003415168.1.93487 WP_003415168.1.93495 WP_003415168.1.93499 WP_003415168.1.93516 WP_003415168.1.93544 WP_003415168.1.93560 WP_003415168.1.93564 WP_003415168.1.9357 WP_003415168.1.93573 WP_003415168.1.93576 WP_003415168.1.93588 WP_003415168.1.9363 WP_003415168.1.93645 WP_003415168.1.93649 WP_003415168.1.93659 WP_003415168.1.93677 WP_003415168.1.9368 WP_003415168.1.93689 WP_003415168.1.93693 WP_003415168.1.93698 WP_003415168.1.93706 WP_003415168.1.9371 WP_003415168.1.93792 WP_003415168.1.93823 WP_003415168.1.93871 WP_003415168.1.9388 WP_003415168.1.93894 WP_003415168.1.93903 WP_003415168.1.93907 WP_003415168.1.93913 WP_003415168.1.93946 WP_003415168.1.93950 WP_003415168.1.93953 WP_003415168.1.93954 WP_003415168.1.93988 WP_003415168.1.9407 WP_003415168.1.94143 WP_003415168.1.94154 WP_003415168.1.94204 WP_003415168.1.94205 WP_003415168.1.94226 WP_003415168.1.94231 WP_003415168.1.94256 WP_003415168.1.94261 WP_003415168.1.94281 WP_003415168.1.94292 WP_003415168.1.94297 WP_003415168.1.9431 WP_003415168.1.94326 WP_003415168.1.94339 WP_003415168.1.94392 WP_003415168.1.94416 WP_003415168.1.94421 WP_003415168.1.94456 WP_003415168.1.94470 WP_003415168.1.94480 WP_003415168.1.94495 WP_003415168.1.94511 WP_003415168.1.94512 WP_003415168.1.94525 WP_003415168.1.94528 WP_003415168.1.94564 WP_003415168.1.946 WP_003415168.1.94602 WP_003415168.1.94623 WP_003415168.1.94629 WP_003415168.1.9465 WP_003415168.1.94673 WP_003415168.1.94714 WP_003415168.1.94730 WP_003415168.1.94736 WP_003415168.1.94776 WP_003415168.1.9478 WP_003415168.1.94834 WP_003415168.1.94852 WP_003415168.1.94872 WP_003415168.1.9488 WP_003415168.1.94902 WP_003415168.1.94916 WP_003415168.1.94979 WP_003415168.1.94994 WP_003415168.1.94996 WP_003415168.1.94998 WP_003415168.1.95007 WP_003415168.1.95015 WP_003415168.1.95034 WP_003415168.1.95081 WP_003415168.1.95082 WP_003415168.1.9509 WP_003415168.1.95096 WP_003415168.1.95112 WP_003415168.1.95138 WP_003415168.1.9514 WP_003415168.1.95179 WP_003415168.1.95188 WP_003415168.1.95190 WP_003415168.1.95234 WP_003415168.1.95241 WP_003415168.1.95245 WP_003415168.1.95257 WP_003415168.1.95279 WP_003415168.1.9531 WP_003415168.1.95335 WP_003415168.1.95344 WP_003415168.1.9535 WP_003415168.1.95370 WP_003415168.1.95392 WP_003415168.1.95416 WP_003415168.1.95417 WP_003415168.1.95454 WP_003415168.1.95455 WP_003415168.1.95491 WP_003415168.1.95497 WP_003415168.1.95508 WP_003415168.1.95509 WP_003415168.1.95529 WP_003415168.1.95556 WP_003415168.1.95557 WP_003415168.1.95565 WP_003415168.1.95578 WP_003415168.1.95580 WP_003415168.1.95585 WP_003415168.1.95643 WP_003415168.1.95679 WP_003415168.1.95685 WP_003415168.1.957 WP_003415168.1.95724 WP_003415168.1.95727 WP_003415168.1.95730 WP_003415168.1.95735 WP_003415168.1.95758 WP_003415168.1.95772 WP_003415168.1.95797 WP_003415168.1.95839 WP_003415168.1.9585 WP_003415168.1.9590 WP_003415168.1.95902 WP_003415168.1.95908 WP_003415168.1.95924 WP_003415168.1.95926 WP_003415168.1.95953 WP_003415168.1.95958 WP_003415168.1.95964 WP_003415168.1.95973 WP_003415168.1.96006 WP_003415168.1.9602 WP_003415168.1.96036 WP_003415168.1.96062 WP_003415168.1.96065 WP_003415168.1.96098 WP_003415168.1.96146 WP_003415168.1.96171 WP_003415168.1.96182 WP_003415168.1.96204 WP_003415168.1.96230 WP_003415168.1.96235 WP_003415168.1.96242 WP_003415168.1.96245 WP_003415168.1.96254 WP_003415168.1.96259 WP_003415168.1.96286 WP_003415168.1.96313 WP_003415168.1.96318 WP_003415168.1.96345 WP_003415168.1.96360 WP_003415168.1.96373 WP_003415168.1.96456 WP_003415168.1.96486 WP_003415168.1.96560 WP_003415168.1.96573 WP_003415168.1.96575 WP_003415168.1.96576 WP_003415168.1.96611 WP_003415168.1.96621 WP_003415168.1.9667 WP_003415168.1.96681 WP_003415168.1.96726 WP_003415168.1.96733 WP_003415168.1.96742 WP_003415168.1.96754 WP_003415168.1.9678 WP_003415168.1.96832 WP_003415168.1.9685 WP_003415168.1.97008 WP_003415168.1.97009 WP_003415168.1.97056 WP_003415168.1.97084 WP_003415168.1.97087 WP_003415168.1.97094 WP_003415168.1.97096 WP_003415168.1.97099 WP_003415168.1.97108 WP_003415168.1.97122 WP_003415168.1.97127 WP_003415168.1.97129 WP_003415168.1.97136 WP_003415168.1.9716 WP_003415168.1.97176 WP_003415168.1.97222 WP_003415168.1.97223 WP_003415168.1.97237 WP_003415168.1.97242 WP_003415168.1.97270 WP_003415168.1.97283 WP_003415168.1.97296 WP_003415168.1.97321 WP_003415168.1.97325 WP_003415168.1.97330 WP_003415168.1.97366 WP_003415168.1.97376 WP_003415168.1.97380 WP_003415168.1.9739 WP_003415168.1.97462 WP_003415168.1.97517 WP_003415168.1.97519 WP_003415168.1.97535 WP_003415168.1.97540 WP_003415168.1.97545 WP_003415168.1.97546 WP_003415168.1.97550 WP_003415168.1.97568 WP_003415168.1.97577 WP_003415168.1.97584 WP_003415168.1.9759 WP_003415168.1.97591 WP_003415168.1.97596 WP_003415168.1.97609 WP_003415168.1.97618 WP_003415168.1.9763 WP_003415168.1.97669 WP_003415168.1.97673 WP_003415168.1.97700 WP_003415168.1.97701 WP_003415168.1.9773 WP_003415168.1.97740 WP_003415168.1.97751 WP_003415168.1.97754 WP_003415168.1.97797 WP_003415168.1.9782 WP_003415168.1.9784 WP_003415168.1.97888 WP_003415168.1.9790 WP_003415168.1.9795 WP_003415168.1.97951 WP_003415168.1.97958 WP_003415168.1.97966 WP_003415168.1.97977 WP_003415168.1.97979 WP_003415168.1.97995 WP_003415168.1.98018 WP_003415168.1.98034 WP_003415168.1.98052 WP_003415168.1.98071 WP_003415168.1.98072 WP_003415168.1.98113 WP_003415168.1.98114 WP_003415168.1.98128 WP_003415168.1.98181 WP_003415168.1.98188 WP_003415168.1.98189 WP_003415168.1.98213 WP_003415168.1.98225 WP_003415168.1.98291 WP_003415168.1.98335 WP_003415168.1.98350 WP_003415168.1.98395 WP_003415168.1.98412 WP_003415168.1.98441 WP_003415168.1.98443 WP_003415168.1.98462 WP_003415168.1.9848 WP_003415168.1.98482 WP_003415168.1.98486 WP_003415168.1.98488 WP_003415168.1.98503 WP_003415168.1.98516 WP_003415168.1.98524 WP_003415168.1.98536 WP_003415168.1.98541 WP_003415168.1.98566 WP_003415168.1.98576 WP_003415168.1.98590 WP_003415168.1.98594 WP_003415168.1.98599 WP_003415168.1.98629 WP_003415168.1.98645 WP_003415168.1.98649 WP_003415168.1.98656 WP_003415168.1.9867 WP_003415168.1.98674 WP_003415168.1.98697 WP_003415168.1.98701 WP_003415168.1.98739 WP_003415168.1.98749 WP_003415168.1.98765 WP_003415168.1.98770 WP_003415168.1.98777 WP_003415168.1.98778 WP_003415168.1.98802 WP_003415168.1.98838 WP_003415168.1.98850 WP_003415168.1.98906 WP_003415168.1.98935 WP_003415168.1.98948 WP_003415168.1.98953 WP_003415168.1.98984 WP_003415168.1.99000 WP_003415168.1.99023 WP_003415168.1.99030 WP_003415168.1.99037 WP_003415168.1.99055 WP_003415168.1.99062 WP_003415168.1.99086 WP_003415168.1.99115 WP_003415168.1.99117 WP_003415168.1.99161 WP_003415168.1.99205 WP_003415168.1.99211 WP_003415168.1.99216 WP_003415168.1.99222 WP_003415168.1.99251 WP_003415168.1.99269 WP_003415168.1.99294 WP_003415168.1.99312 WP_003415168.1.99315 WP_003415168.1.99316 WP_003415168.1.99322 WP_003415168.1.99328 WP_003415168.1.99365 WP_003415168.1.99368 WP_003415168.1.99379 WP_003415168.1.99396 WP_003415168.1.99402 WP_003415168.1.99404 WP_003415168.1.99419 WP_003415168.1.99438 WP_003415168.1.99460 WP_003415168.1.99468 WP_003415168.1.99473 WP_003415168.1.99513 WP_003415168.1.99529 WP_003415168.1.99548 WP_003415168.1.99572 WP_003415168.1.99578 WP_003415168.1.99605 WP_003415168.1.99609 WP_003415168.1.99617 WP_003415168.1.99635 WP_003415168.1.99650 WP_003415168.1.99672 WP_003415168.1.99701 WP_003415168.1.99711 WP_003415168.1.99716 WP_003415168.1.99740 WP_003415168.1.99745 WP_003415168.1.99749 WP_003415168.1.9976 WP_003415168.1.99798 WP_003415168.1.99817 WP_003415168.1.99832 WP_003415168.1.99847 WP_003415168.1.99852 WP_003415168.1.99886 WP_003415168.1.99897 WP_003415168.1.99899 WP_003415168.1.99915 WP_003415168.1.9993 WP_003415168.1.99982 WP_003415168.1.99991 YP_177917.1.84033 gi|197738629|ref|YP_002159944.1| gi|479315971|ref|YP_007856023.1| gi|253797902|ref|YP_003030903.1| gi|224991377|ref|YP_002646066.1| gi|392387633|ref|YP_005309262.1| gi|57117044|ref|YP_177917.1| gi|385999791|ref|YP_005918090.1| gi|479056971|ref|YP_007352777.1| gi|57117044|ref|YP_177917.1| gi|494701445|ref|YP_007966927.1| gi|375295174|ref|YP_005099441.1| gi|31794180|ref|NP_856673.1| gi|339633010|ref|YP_004724652.1| gi|378772742|ref|YP_005172475.1| gi|525675497|ref|YP_008227096.1| gi|506927554|ref|YP_008008004.1| gi|506927554|ref|YP_008008004.1| gi|449065089|ref|YP_007432172.1| 233413.Mb3028c 336982.TBFG_13018 410289.BCG_3025c 419947.MRA_3033 478434.TBMG_00967 561275.JTY_3020 83332.Rv3003c gi|383308745|ref|YP_005361556.1| gi|121638885|ref|YP_979109.1| gi|148824193|ref|YP_001288947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]