SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378773251|ref|YP_005172984.1| from Mycobacterium bovis BCG str. Mexico

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378773251|ref|YP_005172984.1|
Domain Number 1 Region: 368-546
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.3e-45
Family Pyruvate oxidase and decarboxylase PP module 0.0028
Further Details:      
 
Domain Number 2 Region: 1-173
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.4e-36
Family Pyruvate oxidase and decarboxylase Pyr module 0.00028
Further Details:      
 
Domain Number 3 Region: 157-338
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.13e-31
Family Pyruvate oxidase and decarboxylase, middle domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378773251|ref|YP_005172984.1|
Sequence length 552
Comment putative acetolactate synthase [Mycobacterium bovis BCG str. Mexico]
Sequence
MTVGDHLVARMRAAGISVVCGLPTSRLDSLLVRLSRDAGFQIVLARHEGGAGYLADGFAR
ASGKSAAVFVAGPGATNVISAVANASVNQVPMLILTGEVAVGEFGLHSQQDTSDDGLGLG
ATFRRFCRCSVSIESIANARSKIDSAFRALASIPRGPVHIALPRDLVDERLPAHQLGTAA
AGLGGLRTLAPCGPDVADEVIGRLDRSRAPMLVLGNGCRLDGIGEQIVAFCEKAGLPFAT
TPNGRGIVAETHPLSLGVLGIFGDGRADEYLFDTPCDLLIAVGVSFGGLVTRSFSPRWRG
LKADVVHVDPDPSAVGRFVATSLGITTSGRAFVNALNCGRPPRFCRRVGVRPPAPAALPG
TPQARGESIHPLELMHELDRELAPNATICADVGTCISWTFRGIPVRRPGRFFATVDFSPM
GCGIAGAIGVALARPEEHVICIAGDGAFLMHGTEISTAVAHGIRVTWAVLNDGQMSASAG
PVSGRMDPSPVARIGANDLAAMARALGAEGIRVDTRCELRAGVQKALAATGPCVLDIAID
PEINKPDIGLGR
Download sequence
Identical sequences A0A0H3LFY1 A0A0H3MI61 A0A243QWQ2 A0A2C5SV83 A5U8E5 O06335
gi|121639390|ref|YP_979614.1| gi|386000259|ref|YP_005918558.1| gi|378773251|ref|YP_005172984.1| gi|15610606|ref|NP_217987.1| gi|506928073|ref|YP_008008523.1| gi|385992700|ref|YP_005910998.1| gi|392433953|ref|YP_006474997.1| gi|148824680|ref|YP_001289434.1| gi|479316466|ref|YP_007856518.1| gi|15610606|ref|NP_217987.1| 336982.TBFG_13507 410289.BCG_3535c 419947.MRA_3510 561275.JTY_3535 83332.Rv3470c gi|471339548|ref|YP_007612261.1| gi|197739070|ref|YP_002160385.1| gi|148663334|ref|YP_001284857.1| NP_217987.1.84033 WP_003900704.1.100000 WP_003900704.1.100021 WP_003900704.1.100069 WP_003900704.1.100087 WP_003900704.1.10015 WP_003900704.1.100208 WP_003900704.1.100216 WP_003900704.1.10022 WP_003900704.1.100255 WP_003900704.1.100260 WP_003900704.1.100270 WP_003900704.1.100279 WP_003900704.1.100286 WP_003900704.1.100308 WP_003900704.1.100309 WP_003900704.1.100318 WP_003900704.1.100337 WP_003900704.1.100338 WP_003900704.1.10037 WP_003900704.1.100383 WP_003900704.1.100396 WP_003900704.1.1004 WP_003900704.1.100401 WP_003900704.1.100459 WP_003900704.1.100460 WP_003900704.1.100552 WP_003900704.1.100581 WP_003900704.1.100600 WP_003900704.1.100625 WP_003900704.1.100666 WP_003900704.1.100671 WP_003900704.1.100677 WP_003900704.1.100682 WP_003900704.1.100697 WP_003900704.1.100703 WP_003900704.1.100716 WP_003900704.1.100722 WP_003900704.1.100754 WP_003900704.1.100757 WP_003900704.1.100772 WP_003900704.1.1008 WP_003900704.1.100812 WP_003900704.1.100845 WP_003900704.1.100866 WP_003900704.1.10088 WP_003900704.1.100889 WP_003900704.1.10090 WP_003900704.1.100910 WP_003900704.1.100915 WP_003900704.1.100918 WP_003900704.1.100935 WP_003900704.1.100984 WP_003900704.1.100992 WP_003900704.1.100998 WP_003900704.1.101 WP_003900704.1.101025 WP_003900704.1.101028 WP_003900704.1.10104 WP_003900704.1.101048 WP_003900704.1.101054 WP_003900704.1.101075 WP_003900704.1.101143 WP_003900704.1.101146 WP_003900704.1.10116 WP_003900704.1.10117 WP_003900704.1.101209 WP_003900704.1.10125 WP_003900704.1.101290 WP_003900704.1.101323 WP_003900704.1.101324 WP_003900704.1.101350 WP_003900704.1.101367 WP_003900704.1.101398 WP_003900704.1.101403 WP_003900704.1.101421 WP_003900704.1.10144 WP_003900704.1.101442 WP_003900704.1.10145 WP_003900704.1.101452 WP_003900704.1.101456 WP_003900704.1.101481 WP_003900704.1.101493 WP_003900704.1.101496 WP_003900704.1.101525 WP_003900704.1.101533 WP_003900704.1.101535 WP_003900704.1.101553 WP_003900704.1.101558 WP_003900704.1.101573 WP_003900704.1.10159 WP_003900704.1.101592 WP_003900704.1.101604 WP_003900704.1.101607 WP_003900704.1.101622 WP_003900704.1.101644 WP_003900704.1.101659 WP_003900704.1.101671 WP_003900704.1.101687 WP_003900704.1.101698 WP_003900704.1.10170 WP_003900704.1.101713 WP_003900704.1.101722 WP_003900704.1.101733 WP_003900704.1.101743 WP_003900704.1.101753 WP_003900704.1.101754 WP_003900704.1.101764 WP_003900704.1.101773 WP_003900704.1.101795 WP_003900704.1.101797 WP_003900704.1.101798 WP_003900704.1.101802 WP_003900704.1.101826 WP_003900704.1.101836 WP_003900704.1.101858 WP_003900704.1.101859 WP_003900704.1.101862 WP_003900704.1.101888 WP_003900704.1.101894 WP_003900704.1.101899 WP_003900704.1.1019 WP_003900704.1.101923 WP_003900704.1.101925 WP_003900704.1.10193 WP_003900704.1.101996 WP_003900704.1.102 WP_003900704.1.102008 WP_003900704.1.102017 WP_003900704.1.102053 WP_003900704.1.102055 WP_003900704.1.102063 WP_003900704.1.102099 WP_003900704.1.1021 WP_003900704.1.10211 WP_003900704.1.102119 WP_003900704.1.102121 WP_003900704.1.102143 WP_003900704.1.10216 WP_003900704.1.10224 WP_003900704.1.10253 WP_003900704.1.10262 WP_003900704.1.10272 WP_003900704.1.10277 WP_003900704.1.1033 WP_003900704.1.10350 WP_003900704.1.10362 WP_003900704.1.10366 WP_003900704.1.10376 WP_003900704.1.10396 WP_003900704.1.10410 WP_003900704.1.10414 WP_003900704.1.10421 WP_003900704.1.10430 WP_003900704.1.1044 WP_003900704.1.10440 WP_003900704.1.10445 WP_003900704.1.10471 WP_003900704.1.10472 WP_003900704.1.10489 WP_003900704.1.105 WP_003900704.1.10518 WP_003900704.1.10523 WP_003900704.1.10545 WP_003900704.1.1057 WP_003900704.1.10594 WP_003900704.1.10603 WP_003900704.1.10606 WP_003900704.1.10615 WP_003900704.1.10623 WP_003900704.1.10635 WP_003900704.1.10643 WP_003900704.1.10648 WP_003900704.1.10662 WP_003900704.1.10709 WP_003900704.1.10735 WP_003900704.1.10740 WP_003900704.1.10756 WP_003900704.1.1078 WP_003900704.1.10791 WP_003900704.1.10799 WP_003900704.1.10825 WP_003900704.1.10848 WP_003900704.1.10863 WP_003900704.1.10879 WP_003900704.1.10912 WP_003900704.1.10916 WP_003900704.1.10923 WP_003900704.1.1095 WP_003900704.1.10956 WP_003900704.1.10958 WP_003900704.1.10962 WP_003900704.1.10980 WP_003900704.1.10981 WP_003900704.1.10993 WP_003900704.1.1100 WP_003900704.1.11040 WP_003900704.1.11061 WP_003900704.1.11141 WP_003900704.1.11175 WP_003900704.1.11176 WP_003900704.1.11222 WP_003900704.1.11236 WP_003900704.1.11329 WP_003900704.1.1133 WP_003900704.1.11342 WP_003900704.1.11373 WP_003900704.1.11376 WP_003900704.1.11390 WP_003900704.1.11402 WP_003900704.1.11481 WP_003900704.1.11487 WP_003900704.1.11489 WP_003900704.1.11491 WP_003900704.1.11514 WP_003900704.1.11587 WP_003900704.1.11589 WP_003900704.1.11596 WP_003900704.1.11604 WP_003900704.1.11610 WP_003900704.1.11697 WP_003900704.1.11707 WP_003900704.1.11752 WP_003900704.1.11758 WP_003900704.1.11761 WP_003900704.1.11775 WP_003900704.1.11822 WP_003900704.1.11826 WP_003900704.1.11856 WP_003900704.1.11898 WP_003900704.1.11906 WP_003900704.1.11939 WP_003900704.1.11960 WP_003900704.1.11961 WP_003900704.1.11972 WP_003900704.1.11984 WP_003900704.1.120 WP_003900704.1.12001 WP_003900704.1.12049 WP_003900704.1.12100 WP_003900704.1.12116 WP_003900704.1.12130 WP_003900704.1.12161 WP_003900704.1.12165 WP_003900704.1.12184 WP_003900704.1.12187 WP_003900704.1.12190 WP_003900704.1.12216 WP_003900704.1.12265 WP_003900704.1.12275 WP_003900704.1.12293 WP_003900704.1.12294 WP_003900704.1.123 WP_003900704.1.1231 WP_003900704.1.12314 WP_003900704.1.12327 WP_003900704.1.12338 WP_003900704.1.1236 WP_003900704.1.12371 WP_003900704.1.12372 WP_003900704.1.12389 WP_003900704.1.12406 WP_003900704.1.1241 WP_003900704.1.12421 WP_003900704.1.12424 WP_003900704.1.12446 WP_003900704.1.12464 WP_003900704.1.12479 WP_003900704.1.12519 WP_003900704.1.12523 WP_003900704.1.12526 WP_003900704.1.1255 WP_003900704.1.12550 WP_003900704.1.12551 WP_003900704.1.12563 WP_003900704.1.12611 WP_003900704.1.12669 WP_003900704.1.1267 WP_003900704.1.12672 WP_003900704.1.12692 WP_003900704.1.1271 WP_003900704.1.12768 WP_003900704.1.1279 WP_003900704.1.12794 WP_003900704.1.12801 WP_003900704.1.12804 WP_003900704.1.12821 WP_003900704.1.12841 WP_003900704.1.12854 WP_003900704.1.12871 WP_003900704.1.12901 WP_003900704.1.12941 WP_003900704.1.12947 WP_003900704.1.12957 WP_003900704.1.12972 WP_003900704.1.13028 WP_003900704.1.13043 WP_003900704.1.13086 WP_003900704.1.13087 WP_003900704.1.13090 WP_003900704.1.13096 WP_003900704.1.13163 WP_003900704.1.13175 WP_003900704.1.13183 WP_003900704.1.132 WP_003900704.1.13249 WP_003900704.1.13282 WP_003900704.1.13284 WP_003900704.1.13296 WP_003900704.1.13298 WP_003900704.1.13302 WP_003900704.1.13306 WP_003900704.1.13312 WP_003900704.1.13313 WP_003900704.1.13321 WP_003900704.1.13345 WP_003900704.1.13370 WP_003900704.1.1338 WP_003900704.1.13420 WP_003900704.1.13433 WP_003900704.1.13435 WP_003900704.1.13438 WP_003900704.1.13461 WP_003900704.1.13466 WP_003900704.1.13489 WP_003900704.1.13526 WP_003900704.1.13551 WP_003900704.1.13564 WP_003900704.1.13579 WP_003900704.1.13697 WP_003900704.1.13719 WP_003900704.1.13763 WP_003900704.1.1377 WP_003900704.1.13774 WP_003900704.1.13786 WP_003900704.1.13793 WP_003900704.1.13794 WP_003900704.1.13817 WP_003900704.1.13834 WP_003900704.1.13866 WP_003900704.1.13880 WP_003900704.1.13899 WP_003900704.1.13909 WP_003900704.1.13910 WP_003900704.1.13919 WP_003900704.1.13920 WP_003900704.1.13952 WP_003900704.1.13953 WP_003900704.1.13962 WP_003900704.1.1398 WP_003900704.1.13988 WP_003900704.1.14027 WP_003900704.1.14046 WP_003900704.1.14115 WP_003900704.1.1415 WP_003900704.1.14152 WP_003900704.1.14158 WP_003900704.1.14162 WP_003900704.1.14175 WP_003900704.1.14178 WP_003900704.1.14194 WP_003900704.1.14195 WP_003900704.1.14208 WP_003900704.1.14238 WP_003900704.1.14266 WP_003900704.1.14273 WP_003900704.1.14303 WP_003900704.1.14306 WP_003900704.1.14307 WP_003900704.1.14310 WP_003900704.1.14341 WP_003900704.1.14382 WP_003900704.1.14428 WP_003900704.1.14441 WP_003900704.1.14469 WP_003900704.1.14477 WP_003900704.1.14504 WP_003900704.1.14514 WP_003900704.1.1452 WP_003900704.1.14527 WP_003900704.1.1454 WP_003900704.1.14544 WP_003900704.1.14548 WP_003900704.1.14551 WP_003900704.1.14561 WP_003900704.1.14573 WP_003900704.1.1462 WP_003900704.1.14667 WP_003900704.1.14668 WP_003900704.1.14675 WP_003900704.1.14694 WP_003900704.1.14695 WP_003900704.1.14709 WP_003900704.1.14766 WP_003900704.1.14783 WP_003900704.1.14865 WP_003900704.1.14872 WP_003900704.1.14905 WP_003900704.1.14926 WP_003900704.1.14951 WP_003900704.1.14955 WP_003900704.1.15003 WP_003900704.1.15009 WP_003900704.1.15028 WP_003900704.1.15040 WP_003900704.1.15052 WP_003900704.1.15065 WP_003900704.1.15072 WP_003900704.1.15089 WP_003900704.1.1509 WP_003900704.1.15126 WP_003900704.1.15131 WP_003900704.1.15168 WP_003900704.1.15172 WP_003900704.1.15174 WP_003900704.1.15187 WP_003900704.1.15196 WP_003900704.1.15210 WP_003900704.1.15216 WP_003900704.1.15217 WP_003900704.1.15232 WP_003900704.1.15238 WP_003900704.1.15240 WP_003900704.1.15253 WP_003900704.1.15267 WP_003900704.1.1527 WP_003900704.1.15292 WP_003900704.1.15299 WP_003900704.1.15302 WP_003900704.1.15322 WP_003900704.1.1534 WP_003900704.1.15345 WP_003900704.1.15365 WP_003900704.1.15386 WP_003900704.1.15387 WP_003900704.1.15442 WP_003900704.1.15447 WP_003900704.1.15449 WP_003900704.1.15477 WP_003900704.1.15481 WP_003900704.1.15492 WP_003900704.1.15511 WP_003900704.1.15512 WP_003900704.1.15558 WP_003900704.1.15559 WP_003900704.1.15566 WP_003900704.1.15599 WP_003900704.1.1560 WP_003900704.1.15611 WP_003900704.1.1563 WP_003900704.1.15633 WP_003900704.1.15643 WP_003900704.1.15688 WP_003900704.1.15755 WP_003900704.1.15763 WP_003900704.1.15774 WP_003900704.1.1578 WP_003900704.1.15780 WP_003900704.1.15827 WP_003900704.1.15834 WP_003900704.1.15842 WP_003900704.1.15853 WP_003900704.1.15870 WP_003900704.1.15877 WP_003900704.1.15893 WP_003900704.1.15926 WP_003900704.1.15933 WP_003900704.1.15946 WP_003900704.1.15958 WP_003900704.1.15973 WP_003900704.1.15987 WP_003900704.1.15993 WP_003900704.1.16009 WP_003900704.1.16025 WP_003900704.1.16043 WP_003900704.1.16066 WP_003900704.1.16069 WP_003900704.1.16077 WP_003900704.1.16106 WP_003900704.1.16108 WP_003900704.1.16110 WP_003900704.1.16130 WP_003900704.1.16136 WP_003900704.1.16139 WP_003900704.1.16141 WP_003900704.1.16143 WP_003900704.1.1630 WP_003900704.1.16318 WP_003900704.1.1632 WP_003900704.1.16327 WP_003900704.1.16334 WP_003900704.1.16341 WP_003900704.1.16345 WP_003900704.1.16374 WP_003900704.1.16384 WP_003900704.1.16386 WP_003900704.1.164 WP_003900704.1.1642 WP_003900704.1.16424 WP_003900704.1.16426 WP_003900704.1.16431 WP_003900704.1.1644 WP_003900704.1.16442 WP_003900704.1.16448 WP_003900704.1.16451 WP_003900704.1.16476 WP_003900704.1.16480 WP_003900704.1.16494 WP_003900704.1.1652 WP_003900704.1.16549 WP_003900704.1.16560 WP_003900704.1.16598 WP_003900704.1.16609 WP_003900704.1.16619 WP_003900704.1.16620 WP_003900704.1.16622 WP_003900704.1.16637 WP_003900704.1.1669 WP_003900704.1.16707 WP_003900704.1.16724 WP_003900704.1.16731 WP_003900704.1.16743 WP_003900704.1.1683 WP_003900704.1.16837 WP_003900704.1.16852 WP_003900704.1.16937 WP_003900704.1.16940 WP_003900704.1.16950 WP_003900704.1.16959 WP_003900704.1.16968 WP_003900704.1.1697 WP_003900704.1.16973 WP_003900704.1.16977 WP_003900704.1.16987 WP_003900704.1.17005 WP_003900704.1.17006 WP_003900704.1.17010 WP_003900704.1.17015 WP_003900704.1.17019 WP_003900704.1.17039 WP_003900704.1.17041 WP_003900704.1.17052 WP_003900704.1.17057 WP_003900704.1.17062 WP_003900704.1.1707 WP_003900704.1.17094 WP_003900704.1.17130 WP_003900704.1.17138 WP_003900704.1.17147 WP_003900704.1.17167 WP_003900704.1.17224 WP_003900704.1.17251 WP_003900704.1.17288 WP_003900704.1.17304 WP_003900704.1.17314 WP_003900704.1.17345 WP_003900704.1.17381 WP_003900704.1.17391 WP_003900704.1.17412 WP_003900704.1.1743 WP_003900704.1.17440 WP_003900704.1.17466 WP_003900704.1.17477 WP_003900704.1.17483 WP_003900704.1.17505 WP_003900704.1.17527 WP_003900704.1.17535 WP_003900704.1.17540 WP_003900704.1.17553 WP_003900704.1.17558 WP_003900704.1.17599 WP_003900704.1.17635 WP_003900704.1.17655 WP_003900704.1.17679 WP_003900704.1.1768 WP_003900704.1.17687 WP_003900704.1.17700 WP_003900704.1.17710 WP_003900704.1.17713 WP_003900704.1.17722 WP_003900704.1.17746 WP_003900704.1.17788 WP_003900704.1.17798 WP_003900704.1.17803 WP_003900704.1.17816 WP_003900704.1.17821 WP_003900704.1.17830 WP_003900704.1.17868 WP_003900704.1.17878 WP_003900704.1.1792 WP_003900704.1.1795 WP_003900704.1.17955 WP_003900704.1.17973 WP_003900704.1.18009 WP_003900704.1.18013 WP_003900704.1.18033 WP_003900704.1.18057 WP_003900704.1.18065 WP_003900704.1.18070 WP_003900704.1.18116 WP_003900704.1.18120 WP_003900704.1.18126 WP_003900704.1.1817 WP_003900704.1.18170 WP_003900704.1.18206 WP_003900704.1.18216 WP_003900704.1.18240 WP_003900704.1.18257 WP_003900704.1.18297 WP_003900704.1.18306 WP_003900704.1.18364 WP_003900704.1.18399 WP_003900704.1.18411 WP_003900704.1.18444 WP_003900704.1.18448 WP_003900704.1.18467 WP_003900704.1.18476 WP_003900704.1.18522 WP_003900704.1.18580 WP_003900704.1.18582 WP_003900704.1.18587 WP_003900704.1.186 WP_003900704.1.18601 WP_003900704.1.18639 WP_003900704.1.18646 WP_003900704.1.18647 WP_003900704.1.1868 WP_003900704.1.18694 WP_003900704.1.18710 WP_003900704.1.18751 WP_003900704.1.18781 WP_003900704.1.18793 WP_003900704.1.18804 WP_003900704.1.18816 WP_003900704.1.18823 WP_003900704.1.18827 WP_003900704.1.18838 WP_003900704.1.18849 WP_003900704.1.18856 WP_003900704.1.18945 WP_003900704.1.1898 WP_003900704.1.19005 WP_003900704.1.19056 WP_003900704.1.19063 WP_003900704.1.19066 WP_003900704.1.19071 WP_003900704.1.19085 WP_003900704.1.19094 WP_003900704.1.19144 WP_003900704.1.19159 WP_003900704.1.19193 WP_003900704.1.19231 WP_003900704.1.19243 WP_003900704.1.19264 WP_003900704.1.19295 WP_003900704.1.19307 WP_003900704.1.19326 WP_003900704.1.1933 WP_003900704.1.19364 WP_003900704.1.19382 WP_003900704.1.19400 WP_003900704.1.19426 WP_003900704.1.19429 WP_003900704.1.19464 WP_003900704.1.19480 WP_003900704.1.19512 WP_003900704.1.19553 WP_003900704.1.19562 WP_003900704.1.19564 WP_003900704.1.19568 WP_003900704.1.19572 WP_003900704.1.19595 WP_003900704.1.19596 WP_003900704.1.19600 WP_003900704.1.19630 WP_003900704.1.1967 WP_003900704.1.19694 WP_003900704.1.1970 WP_003900704.1.19707 WP_003900704.1.19742 WP_003900704.1.19785 WP_003900704.1.19820 WP_003900704.1.19868 WP_003900704.1.19874 WP_003900704.1.19890 WP_003900704.1.19900 WP_003900704.1.19922 WP_003900704.1.19936 WP_003900704.1.19946 WP_003900704.1.19949 WP_003900704.1.19960 WP_003900704.1.19964 WP_003900704.1.20007 WP_003900704.1.20016 WP_003900704.1.20028 WP_003900704.1.20037 WP_003900704.1.20039 WP_003900704.1.20082 WP_003900704.1.20085 WP_003900704.1.20097 WP_003900704.1.20116 WP_003900704.1.20130 WP_003900704.1.20140 WP_003900704.1.20141 WP_003900704.1.20142 WP_003900704.1.20158 WP_003900704.1.20239 WP_003900704.1.20259 WP_003900704.1.20262 WP_003900704.1.20268 WP_003900704.1.20272 WP_003900704.1.20273 WP_003900704.1.20280 WP_003900704.1.20294 WP_003900704.1.20300 WP_003900704.1.20309 WP_003900704.1.20322 WP_003900704.1.20372 WP_003900704.1.20381 WP_003900704.1.204 WP_003900704.1.20427 WP_003900704.1.20457 WP_003900704.1.20459 WP_003900704.1.20460 WP_003900704.1.20542 WP_003900704.1.20578 WP_003900704.1.20608 WP_003900704.1.20624 WP_003900704.1.20628 WP_003900704.1.2066 WP_003900704.1.20707 WP_003900704.1.20722 WP_003900704.1.20729 WP_003900704.1.20742 WP_003900704.1.20751 WP_003900704.1.20776 WP_003900704.1.20843 WP_003900704.1.20850 WP_003900704.1.2086 WP_003900704.1.20868 WP_003900704.1.20876 WP_003900704.1.20897 WP_003900704.1.2090 WP_003900704.1.20911 WP_003900704.1.20916 WP_003900704.1.20921 WP_003900704.1.20926 WP_003900704.1.20927 WP_003900704.1.20951 WP_003900704.1.20970 WP_003900704.1.2104 WP_003900704.1.21127 WP_003900704.1.21135 WP_003900704.1.21173 WP_003900704.1.21187 WP_003900704.1.212 WP_003900704.1.2120 WP_003900704.1.21218 WP_003900704.1.21219 WP_003900704.1.2123 WP_003900704.1.21231 WP_003900704.1.21234 WP_003900704.1.2126 WP_003900704.1.21292 WP_003900704.1.21307 WP_003900704.1.2131 WP_003900704.1.21311 WP_003900704.1.21321 WP_003900704.1.21365 WP_003900704.1.2137 WP_003900704.1.21397 WP_003900704.1.21415 WP_003900704.1.21418 WP_003900704.1.21430 WP_003900704.1.21434 WP_003900704.1.21444 WP_003900704.1.21468 WP_003900704.1.21498 WP_003900704.1.21509 WP_003900704.1.21513 WP_003900704.1.21560 WP_003900704.1.21565 WP_003900704.1.21586 WP_003900704.1.21591 WP_003900704.1.21594 WP_003900704.1.21602 WP_003900704.1.21615 WP_003900704.1.21638 WP_003900704.1.21639 WP_003900704.1.21655 WP_003900704.1.21658 WP_003900704.1.2168 WP_003900704.1.2174 WP_003900704.1.21741 WP_003900704.1.21777 WP_003900704.1.21786 WP_003900704.1.21795 WP_003900704.1.218 WP_003900704.1.21826 WP_003900704.1.21829 WP_003900704.1.21840 WP_003900704.1.21843 WP_003900704.1.21872 WP_003900704.1.21873 WP_003900704.1.2188 WP_003900704.1.21882 WP_003900704.1.21906 WP_003900704.1.21912 WP_003900704.1.2194 WP_003900704.1.21941 WP_003900704.1.21956 WP_003900704.1.21958 WP_003900704.1.21960 WP_003900704.1.21971 WP_003900704.1.21973 WP_003900704.1.21983 WP_003900704.1.22003 WP_003900704.1.22013 WP_003900704.1.22025 WP_003900704.1.22036 WP_003900704.1.22075 WP_003900704.1.2212 WP_003900704.1.22127 WP_003900704.1.22140 WP_003900704.1.22233 WP_003900704.1.22277 WP_003900704.1.22305 WP_003900704.1.22348 WP_003900704.1.22356 WP_003900704.1.22366 WP_003900704.1.2238 WP_003900704.1.22380 WP_003900704.1.22437 WP_003900704.1.22438 WP_003900704.1.22445 WP_003900704.1.22490 WP_003900704.1.22511 WP_003900704.1.22524 WP_003900704.1.2253 WP_003900704.1.22585 WP_003900704.1.22589 WP_003900704.1.22606 WP_003900704.1.22608 WP_003900704.1.22609 WP_003900704.1.22618 WP_003900704.1.2262 WP_003900704.1.22624 WP_003900704.1.22629 WP_003900704.1.22647 WP_003900704.1.22665 WP_003900704.1.22670 WP_003900704.1.22674 WP_003900704.1.22725 WP_003900704.1.22728 WP_003900704.1.22733 WP_003900704.1.22737 WP_003900704.1.2275 WP_003900704.1.22754 WP_003900704.1.22804 WP_003900704.1.22829 WP_003900704.1.22840 WP_003900704.1.22844 WP_003900704.1.22963 WP_003900704.1.22970 WP_003900704.1.22996 WP_003900704.1.22997 WP_003900704.1.22999 WP_003900704.1.23015 WP_003900704.1.23032 WP_003900704.1.231 WP_003900704.1.23101 WP_003900704.1.2312 WP_003900704.1.23153 WP_003900704.1.23171 WP_003900704.1.23199 WP_003900704.1.2320 WP_003900704.1.23204 WP_003900704.1.23216 WP_003900704.1.23229 WP_003900704.1.23233 WP_003900704.1.2326 WP_003900704.1.23261 WP_003900704.1.23272 WP_003900704.1.23289 WP_003900704.1.2329 WP_003900704.1.23308 WP_003900704.1.23316 WP_003900704.1.23321 WP_003900704.1.23325 WP_003900704.1.2339 WP_003900704.1.23406 WP_003900704.1.23438 WP_003900704.1.23445 WP_003900704.1.23447 WP_003900704.1.23452 WP_003900704.1.23461 WP_003900704.1.2349 WP_003900704.1.23496 WP_003900704.1.23506 WP_003900704.1.23530 WP_003900704.1.23539 WP_003900704.1.23546 WP_003900704.1.23551 WP_003900704.1.23573 WP_003900704.1.23583 WP_003900704.1.23588 WP_003900704.1.23628 WP_003900704.1.23677 WP_003900704.1.23683 WP_003900704.1.23692 WP_003900704.1.23694 WP_003900704.1.23699 WP_003900704.1.2371 WP_003900704.1.23807 WP_003900704.1.23825 WP_003900704.1.23832 WP_003900704.1.2384 WP_003900704.1.23843 WP_003900704.1.23863 WP_003900704.1.23894 WP_003900704.1.23993 WP_003900704.1.2400 WP_003900704.1.24007 WP_003900704.1.24008 WP_003900704.1.24046 WP_003900704.1.24057 WP_003900704.1.24062 WP_003900704.1.24113 WP_003900704.1.24119 WP_003900704.1.24128 WP_003900704.1.24140 WP_003900704.1.24176 WP_003900704.1.24190 WP_003900704.1.24202 WP_003900704.1.24261 WP_003900704.1.24284 WP_003900704.1.24294 WP_003900704.1.24357 WP_003900704.1.24396 WP_003900704.1.24414 WP_003900704.1.24423 WP_003900704.1.2443 WP_003900704.1.24446 WP_003900704.1.24461 WP_003900704.1.24500 WP_003900704.1.24507 WP_003900704.1.24509 WP_003900704.1.24529 WP_003900704.1.24553 WP_003900704.1.24599 WP_003900704.1.24629 WP_003900704.1.24638 WP_003900704.1.24648 WP_003900704.1.2466 WP_003900704.1.24824 WP_003900704.1.24831 WP_003900704.1.24840 WP_003900704.1.24848 WP_003900704.1.24857 WP_003900704.1.2487 WP_003900704.1.24893 WP_003900704.1.24907 WP_003900704.1.24933 WP_003900704.1.24956 WP_003900704.1.24958 WP_003900704.1.24985 WP_003900704.1.2499 WP_003900704.1.2505 WP_003900704.1.25051 WP_003900704.1.2507 WP_003900704.1.25096 WP_003900704.1.25103 WP_003900704.1.25129 WP_003900704.1.25171 WP_003900704.1.25184 WP_003900704.1.25247 WP_003900704.1.25252 WP_003900704.1.25278 WP_003900704.1.25283 WP_003900704.1.25309 WP_003900704.1.25313 WP_003900704.1.25338 WP_003900704.1.25342 WP_003900704.1.25343 WP_003900704.1.25367 WP_003900704.1.25393 WP_003900704.1.25406 WP_003900704.1.25435 WP_003900704.1.25437 WP_003900704.1.25445 WP_003900704.1.25455 WP_003900704.1.25473 WP_003900704.1.25504 WP_003900704.1.25513 WP_003900704.1.25542 WP_003900704.1.25579 WP_003900704.1.25594 WP_003900704.1.25606 WP_003900704.1.25645 WP_003900704.1.2566 WP_003900704.1.25673 WP_003900704.1.25674 WP_003900704.1.25693 WP_003900704.1.25727 WP_003900704.1.25736 WP_003900704.1.25738 WP_003900704.1.25756 WP_003900704.1.25759 WP_003900704.1.2580 WP_003900704.1.25813 WP_003900704.1.25853 WP_003900704.1.25854 WP_003900704.1.25874 WP_003900704.1.25885 WP_003900704.1.25914 WP_003900704.1.25916 WP_003900704.1.2594 WP_003900704.1.25954 WP_003900704.1.25965 WP_003900704.1.25972 WP_003900704.1.26017 WP_003900704.1.26032 WP_003900704.1.26038 WP_003900704.1.26072 WP_003900704.1.26089 WP_003900704.1.26097 WP_003900704.1.26098 WP_003900704.1.26118 WP_003900704.1.26126 WP_003900704.1.2614 WP_003900704.1.26168 WP_003900704.1.26182 WP_003900704.1.26190 WP_003900704.1.2620 WP_003900704.1.26234 WP_003900704.1.26243 WP_003900704.1.26265 WP_003900704.1.26267 WP_003900704.1.26292 WP_003900704.1.26310 WP_003900704.1.26328 WP_003900704.1.26349 WP_003900704.1.26366 WP_003900704.1.26374 WP_003900704.1.26407 WP_003900704.1.26454 WP_003900704.1.26464 WP_003900704.1.2653 WP_003900704.1.26560 WP_003900704.1.26571 WP_003900704.1.2659 WP_003900704.1.26597 WP_003900704.1.26603 WP_003900704.1.26629 WP_003900704.1.26651 WP_003900704.1.26702 WP_003900704.1.26707 WP_003900704.1.26710 WP_003900704.1.26737 WP_003900704.1.26738 WP_003900704.1.26745 WP_003900704.1.26756 WP_003900704.1.2676 WP_003900704.1.26779 WP_003900704.1.26780 WP_003900704.1.26854 WP_003900704.1.26868 WP_003900704.1.26876 WP_003900704.1.26888 WP_003900704.1.26914 WP_003900704.1.26945 WP_003900704.1.26959 WP_003900704.1.26969 WP_003900704.1.26984 WP_003900704.1.26992 WP_003900704.1.27004 WP_003900704.1.27017 WP_003900704.1.27045 WP_003900704.1.27075 WP_003900704.1.27128 WP_003900704.1.27130 WP_003900704.1.27139 WP_003900704.1.27152 WP_003900704.1.27162 WP_003900704.1.27164 WP_003900704.1.27193 WP_003900704.1.27235 WP_003900704.1.27254 WP_003900704.1.27278 WP_003900704.1.27343 WP_003900704.1.27352 WP_003900704.1.27369 WP_003900704.1.27391 WP_003900704.1.27398 WP_003900704.1.27402 WP_003900704.1.27410 WP_003900704.1.27411 WP_003900704.1.27449 WP_003900704.1.27460 WP_003900704.1.27463 WP_003900704.1.2749 WP_003900704.1.27492 WP_003900704.1.27528 WP_003900704.1.27541 WP_003900704.1.27576 WP_003900704.1.27582 WP_003900704.1.27596 WP_003900704.1.27607 WP_003900704.1.2766 WP_003900704.1.277 WP_003900704.1.27724 WP_003900704.1.27730 WP_003900704.1.27736 WP_003900704.1.27743 WP_003900704.1.27750 WP_003900704.1.27771 WP_003900704.1.27779 WP_003900704.1.27795 WP_003900704.1.27803 WP_003900704.1.27819 WP_003900704.1.27915 WP_003900704.1.27935 WP_003900704.1.27962 WP_003900704.1.28053 WP_003900704.1.28092 WP_003900704.1.28106 WP_003900704.1.28131 WP_003900704.1.28142 WP_003900704.1.28159 WP_003900704.1.2816 WP_003900704.1.28161 WP_003900704.1.28192 WP_003900704.1.28202 WP_003900704.1.28241 WP_003900704.1.28242 WP_003900704.1.28251 WP_003900704.1.28269 WP_003900704.1.28293 WP_003900704.1.28331 WP_003900704.1.28367 WP_003900704.1.28378 WP_003900704.1.2842 WP_003900704.1.28448 WP_003900704.1.2847 WP_003900704.1.28471 WP_003900704.1.28473 WP_003900704.1.28493 WP_003900704.1.28497 WP_003900704.1.28530 WP_003900704.1.28545 WP_003900704.1.28561 WP_003900704.1.28567 WP_003900704.1.28585 WP_003900704.1.286 WP_003900704.1.28610 WP_003900704.1.28617 WP_003900704.1.28634 WP_003900704.1.28642 WP_003900704.1.28671 WP_003900704.1.28682 WP_003900704.1.28698 WP_003900704.1.28703 WP_003900704.1.28739 WP_003900704.1.28758 WP_003900704.1.28781 WP_003900704.1.28787 WP_003900704.1.28827 WP_003900704.1.28839 WP_003900704.1.28847 WP_003900704.1.28850 WP_003900704.1.28851 WP_003900704.1.28865 WP_003900704.1.28897 WP_003900704.1.28914 WP_003900704.1.28935 WP_003900704.1.28936 WP_003900704.1.28939 WP_003900704.1.28943 WP_003900704.1.28952 WP_003900704.1.28975 WP_003900704.1.28993 WP_003900704.1.29000 WP_003900704.1.2901 WP_003900704.1.29028 WP_003900704.1.29033 WP_003900704.1.29058 WP_003900704.1.29078 WP_003900704.1.29102 WP_003900704.1.29115 WP_003900704.1.2916 WP_003900704.1.29217 WP_003900704.1.29223 WP_003900704.1.29234 WP_003900704.1.29264 WP_003900704.1.29275 WP_003900704.1.29306 WP_003900704.1.29339 WP_003900704.1.29348 WP_003900704.1.29364 WP_003900704.1.29367 WP_003900704.1.2938 WP_003900704.1.29426 WP_003900704.1.2944 WP_003900704.1.29449 WP_003900704.1.29450 WP_003900704.1.29452 WP_003900704.1.2949 WP_003900704.1.29510 WP_003900704.1.29515 WP_003900704.1.29525 WP_003900704.1.2953 WP_003900704.1.29559 WP_003900704.1.29587 WP_003900704.1.2959 WP_003900704.1.29592 WP_003900704.1.29599 WP_003900704.1.29611 WP_003900704.1.29632 WP_003900704.1.29649 WP_003900704.1.2965 WP_003900704.1.29659 WP_003900704.1.2969 WP_003900704.1.29696 WP_003900704.1.29698 WP_003900704.1.29718 WP_003900704.1.29742 WP_003900704.1.29745 WP_003900704.1.29747 WP_003900704.1.29769 WP_003900704.1.29825 WP_003900704.1.29830 WP_003900704.1.29847 WP_003900704.1.29861 WP_003900704.1.29869 WP_003900704.1.29883 WP_003900704.1.29890 WP_003900704.1.299 WP_003900704.1.29931 WP_003900704.1.29960 WP_003900704.1.30014 WP_003900704.1.3004 WP_003900704.1.30040 WP_003900704.1.30043 WP_003900704.1.30074 WP_003900704.1.30097 WP_003900704.1.30101 WP_003900704.1.30106 WP_003900704.1.30114 WP_003900704.1.30126 WP_003900704.1.30131 WP_003900704.1.30138 WP_003900704.1.30139 WP_003900704.1.30145 WP_003900704.1.30224 WP_003900704.1.30235 WP_003900704.1.30237 WP_003900704.1.3027 WP_003900704.1.30279 WP_003900704.1.30282 WP_003900704.1.30283 WP_003900704.1.30288 WP_003900704.1.30291 WP_003900704.1.30363 WP_003900704.1.30374 WP_003900704.1.30404 WP_003900704.1.3043 WP_003900704.1.30433 WP_003900704.1.30438 WP_003900704.1.30462 WP_003900704.1.30464 WP_003900704.1.30468 WP_003900704.1.30500 WP_003900704.1.3057 WP_003900704.1.30574 WP_003900704.1.30628 WP_003900704.1.30641 WP_003900704.1.30642 WP_003900704.1.30661 WP_003900704.1.30669 WP_003900704.1.30683 WP_003900704.1.30699 WP_003900704.1.30709 WP_003900704.1.30713 WP_003900704.1.30716 WP_003900704.1.30719 WP_003900704.1.30730 WP_003900704.1.30732 WP_003900704.1.30736 WP_003900704.1.30745 WP_003900704.1.30760 WP_003900704.1.30791 WP_003900704.1.308 WP_003900704.1.30807 WP_003900704.1.30818 WP_003900704.1.30824 WP_003900704.1.30848 WP_003900704.1.30877 WP_003900704.1.30888 WP_003900704.1.30901 WP_003900704.1.30903 WP_003900704.1.30912 WP_003900704.1.30913 WP_003900704.1.30914 WP_003900704.1.30919 WP_003900704.1.30977 WP_003900704.1.3100 WP_003900704.1.31002 WP_003900704.1.3101 WP_003900704.1.31034 WP_003900704.1.31047 WP_003900704.1.31074 WP_003900704.1.31102 WP_003900704.1.31127 WP_003900704.1.31184 WP_003900704.1.31199 WP_003900704.1.31226 WP_003900704.1.31230 WP_003900704.1.31233 WP_003900704.1.31263 WP_003900704.1.31264 WP_003900704.1.31270 WP_003900704.1.31287 WP_003900704.1.31290 WP_003900704.1.31304 WP_003900704.1.31346 WP_003900704.1.31348 WP_003900704.1.31354 WP_003900704.1.31390 WP_003900704.1.31414 WP_003900704.1.31417 WP_003900704.1.31428 WP_003900704.1.3143 WP_003900704.1.31458 WP_003900704.1.31483 WP_003900704.1.3149 WP_003900704.1.31498 WP_003900704.1.31507 WP_003900704.1.31569 WP_003900704.1.31573 WP_003900704.1.316 WP_003900704.1.31629 WP_003900704.1.31666 WP_003900704.1.31693 WP_003900704.1.31703 WP_003900704.1.31744 WP_003900704.1.31770 WP_003900704.1.31776 WP_003900704.1.318 WP_003900704.1.3184 WP_003900704.1.31840 WP_003900704.1.31880 WP_003900704.1.31911 WP_003900704.1.31930 WP_003900704.1.31932 WP_003900704.1.31955 WP_003900704.1.31985 WP_003900704.1.31991 WP_003900704.1.31995 WP_003900704.1.32004 WP_003900704.1.32039 WP_003900704.1.3204 WP_003900704.1.32045 WP_003900704.1.32071 WP_003900704.1.32098 WP_003900704.1.32132 WP_003900704.1.32157 WP_003900704.1.32164 WP_003900704.1.32179 WP_003900704.1.32198 WP_003900704.1.32297 WP_003900704.1.32317 WP_003900704.1.32383 WP_003900704.1.32400 WP_003900704.1.32403 WP_003900704.1.32416 WP_003900704.1.32421 WP_003900704.1.32433 WP_003900704.1.32461 WP_003900704.1.32482 WP_003900704.1.32503 WP_003900704.1.32556 WP_003900704.1.32562 WP_003900704.1.32569 WP_003900704.1.32620 WP_003900704.1.32647 WP_003900704.1.32653 WP_003900704.1.32654 WP_003900704.1.32695 WP_003900704.1.32706 WP_003900704.1.32716 WP_003900704.1.32738 WP_003900704.1.32752 WP_003900704.1.32780 WP_003900704.1.32781 WP_003900704.1.32793 WP_003900704.1.32799 WP_003900704.1.32822 WP_003900704.1.32833 WP_003900704.1.32862 WP_003900704.1.32880 WP_003900704.1.32897 WP_003900704.1.32909 WP_003900704.1.32935 WP_003900704.1.32974 WP_003900704.1.33007 WP_003900704.1.3302 WP_003900704.1.33028 WP_003900704.1.33035 WP_003900704.1.33044 WP_003900704.1.33054 WP_003900704.1.33082 WP_003900704.1.33141 WP_003900704.1.33148 WP_003900704.1.33155 WP_003900704.1.33168 WP_003900704.1.33215 WP_003900704.1.3325 WP_003900704.1.3327 WP_003900704.1.33278 WP_003900704.1.33288 WP_003900704.1.33305 WP_003900704.1.3331 WP_003900704.1.33319 WP_003900704.1.3333 WP_003900704.1.33393 WP_003900704.1.33403 WP_003900704.1.33452 WP_003900704.1.33467 WP_003900704.1.33477 WP_003900704.1.33519 WP_003900704.1.33542 WP_003900704.1.33601 WP_003900704.1.33602 WP_003900704.1.33633 WP_003900704.1.33646 WP_003900704.1.33673 WP_003900704.1.33705 WP_003900704.1.33762 WP_003900704.1.33783 WP_003900704.1.33789 WP_003900704.1.3383 WP_003900704.1.33832 WP_003900704.1.33839 WP_003900704.1.33848 WP_003900704.1.3387 WP_003900704.1.33886 WP_003900704.1.33895 WP_003900704.1.33906 WP_003900704.1.33912 WP_003900704.1.33954 WP_003900704.1.34042 WP_003900704.1.3405 WP_003900704.1.34055 WP_003900704.1.34056 WP_003900704.1.34065 WP_003900704.1.3408 WP_003900704.1.34090 WP_003900704.1.34109 WP_003900704.1.34111 WP_003900704.1.34131 WP_003900704.1.34152 WP_003900704.1.34153 WP_003900704.1.34181 WP_003900704.1.34197 WP_003900704.1.34198 WP_003900704.1.34215 WP_003900704.1.34219 WP_003900704.1.34255 WP_003900704.1.34260 WP_003900704.1.34275 WP_003900704.1.343 WP_003900704.1.34347 WP_003900704.1.34358 WP_003900704.1.34392 WP_003900704.1.344 WP_003900704.1.34428 WP_003900704.1.3443 WP_003900704.1.34435 WP_003900704.1.34446 WP_003900704.1.34499 WP_003900704.1.34505 WP_003900704.1.34516 WP_003900704.1.34529 WP_003900704.1.34551 WP_003900704.1.34563 WP_003900704.1.34576 WP_003900704.1.34581 WP_003900704.1.34588 WP_003900704.1.34596 WP_003900704.1.34599 WP_003900704.1.34639 WP_003900704.1.34673 WP_003900704.1.34724 WP_003900704.1.34740 WP_003900704.1.34755 WP_003900704.1.34777 WP_003900704.1.34841 WP_003900704.1.34908 WP_003900704.1.34919 WP_003900704.1.3492 WP_003900704.1.34933 WP_003900704.1.34945 WP_003900704.1.34946 WP_003900704.1.34954 WP_003900704.1.34960 WP_003900704.1.34961 WP_003900704.1.34963 WP_003900704.1.34965 WP_003900704.1.34968 WP_003900704.1.35023 WP_003900704.1.35069 WP_003900704.1.35072 WP_003900704.1.35078 WP_003900704.1.35146 WP_003900704.1.35156 WP_003900704.1.35160 WP_003900704.1.35162 WP_003900704.1.35176 WP_003900704.1.3520 WP_003900704.1.35221 WP_003900704.1.35246 WP_003900704.1.35278 WP_003900704.1.35301 WP_003900704.1.35311 WP_003900704.1.35312 WP_003900704.1.35317 WP_003900704.1.35319 WP_003900704.1.35347 WP_003900704.1.35363 WP_003900704.1.35382 WP_003900704.1.35385 WP_003900704.1.35396 WP_003900704.1.35397 WP_003900704.1.35426 WP_003900704.1.35439 WP_003900704.1.35455 WP_003900704.1.3548 WP_003900704.1.35484 WP_003900704.1.35492 WP_003900704.1.3553 WP_003900704.1.35553 WP_003900704.1.35555 WP_003900704.1.35561 WP_003900704.1.35602 WP_003900704.1.35610 WP_003900704.1.35635 WP_003900704.1.35657 WP_003900704.1.35680 WP_003900704.1.35687 WP_003900704.1.35689 WP_003900704.1.35707 WP_003900704.1.35732 WP_003900704.1.35754 WP_003900704.1.35767 WP_003900704.1.35770 WP_003900704.1.35771 WP_003900704.1.35780 WP_003900704.1.35805 WP_003900704.1.35811 WP_003900704.1.35821 WP_003900704.1.3584 WP_003900704.1.35848 WP_003900704.1.35864 WP_003900704.1.35874 WP_003900704.1.35876 WP_003900704.1.35897 WP_003900704.1.35899 WP_003900704.1.35923 WP_003900704.1.3593 WP_003900704.1.35954 WP_003900704.1.36005 WP_003900704.1.36014 WP_003900704.1.36023 WP_003900704.1.36051 WP_003900704.1.36053 WP_003900704.1.36075 WP_003900704.1.36089 WP_003900704.1.36097 WP_003900704.1.36098 WP_003900704.1.36116 WP_003900704.1.36145 WP_003900704.1.36156 WP_003900704.1.36205 WP_003900704.1.36228 WP_003900704.1.36252 WP_003900704.1.36260 WP_003900704.1.36270 WP_003900704.1.36271 WP_003900704.1.36303 WP_003900704.1.36309 WP_003900704.1.36315 WP_003900704.1.36319 WP_003900704.1.36321 WP_003900704.1.36326 WP_003900704.1.3634 WP_003900704.1.36356 WP_003900704.1.36357 WP_003900704.1.3636 WP_003900704.1.36385 WP_003900704.1.36399 WP_003900704.1.36436 WP_003900704.1.36465 WP_003900704.1.36469 WP_003900704.1.36473 WP_003900704.1.36485 WP_003900704.1.36508 WP_003900704.1.36540 WP_003900704.1.36561 WP_003900704.1.36571 WP_003900704.1.36573 WP_003900704.1.36578 WP_003900704.1.36585 WP_003900704.1.36597 WP_003900704.1.36614 WP_003900704.1.36657 WP_003900704.1.36674 WP_003900704.1.36720 WP_003900704.1.36727 WP_003900704.1.36733 WP_003900704.1.36785 WP_003900704.1.36810 WP_003900704.1.36844 WP_003900704.1.36851 WP_003900704.1.36862 WP_003900704.1.36893 WP_003900704.1.36901 WP_003900704.1.36921 WP_003900704.1.36935 WP_003900704.1.36941 WP_003900704.1.3695 WP_003900704.1.36951 WP_003900704.1.36968 WP_003900704.1.3700 WP_003900704.1.37004 WP_003900704.1.37012 WP_003900704.1.37071 WP_003900704.1.37088 WP_003900704.1.37131 WP_003900704.1.37157 WP_003900704.1.37175 WP_003900704.1.37188 WP_003900704.1.37229 WP_003900704.1.3724 WP_003900704.1.37277 WP_003900704.1.37305 WP_003900704.1.37330 WP_003900704.1.37389 WP_003900704.1.37400 WP_003900704.1.37440 WP_003900704.1.37459 WP_003900704.1.37468 WP_003900704.1.37475 WP_003900704.1.37484 WP_003900704.1.37601 WP_003900704.1.37612 WP_003900704.1.37632 WP_003900704.1.37643 WP_003900704.1.37655 WP_003900704.1.37660 WP_003900704.1.37674 WP_003900704.1.37700 WP_003900704.1.37701 WP_003900704.1.37709 WP_003900704.1.37711 WP_003900704.1.37721 WP_003900704.1.37722 WP_003900704.1.37747 WP_003900704.1.37765 WP_003900704.1.37772 WP_003900704.1.37804 WP_003900704.1.37809 WP_003900704.1.37859 WP_003900704.1.37877 WP_003900704.1.37912 WP_003900704.1.37913 WP_003900704.1.37943 WP_003900704.1.37950 WP_003900704.1.37973 WP_003900704.1.37975 WP_003900704.1.37983 WP_003900704.1.38 WP_003900704.1.38002 WP_003900704.1.3802 WP_003900704.1.38039 WP_003900704.1.38040 WP_003900704.1.38067 WP_003900704.1.38068 WP_003900704.1.38135 WP_003900704.1.38138 WP_003900704.1.38144 WP_003900704.1.38158 WP_003900704.1.38159 WP_003900704.1.38210 WP_003900704.1.38233 WP_003900704.1.38240 WP_003900704.1.38299 WP_003900704.1.38332 WP_003900704.1.38347 WP_003900704.1.38354 WP_003900704.1.38380 WP_003900704.1.38384 WP_003900704.1.38389 WP_003900704.1.38398 WP_003900704.1.38402 WP_003900704.1.38418 WP_003900704.1.38421 WP_003900704.1.38466 WP_003900704.1.38477 WP_003900704.1.38483 WP_003900704.1.3849 WP_003900704.1.385 WP_003900704.1.38530 WP_003900704.1.38535 WP_003900704.1.38539 WP_003900704.1.38594 WP_003900704.1.38601 WP_003900704.1.38611 WP_003900704.1.38638 WP_003900704.1.38639 WP_003900704.1.38646 WP_003900704.1.38648 WP_003900704.1.38654 WP_003900704.1.38659 WP_003900704.1.38660 WP_003900704.1.38666 WP_003900704.1.38671 WP_003900704.1.38672 WP_003900704.1.38750 WP_003900704.1.38772 WP_003900704.1.38812 WP_003900704.1.38821 WP_003900704.1.38844 WP_003900704.1.38863 WP_003900704.1.38865 WP_003900704.1.38873 WP_003900704.1.38894 WP_003900704.1.38909 WP_003900704.1.38939 WP_003900704.1.38974 WP_003900704.1.38975 WP_003900704.1.38991 WP_003900704.1.39025 WP_003900704.1.39070 WP_003900704.1.39072 WP_003900704.1.39095 WP_003900704.1.39106 WP_003900704.1.39165 WP_003900704.1.39174 WP_003900704.1.39176 WP_003900704.1.39178 WP_003900704.1.39190 WP_003900704.1.39201 WP_003900704.1.39207 WP_003900704.1.39211 WP_003900704.1.39236 WP_003900704.1.39239 WP_003900704.1.39252 WP_003900704.1.39288 WP_003900704.1.39306 WP_003900704.1.39400 WP_003900704.1.39447 WP_003900704.1.3945 WP_003900704.1.39450 WP_003900704.1.39455 WP_003900704.1.3949 WP_003900704.1.39521 WP_003900704.1.39560 WP_003900704.1.39592 WP_003900704.1.39593 WP_003900704.1.396 WP_003900704.1.3960 WP_003900704.1.39616 WP_003900704.1.39654 WP_003900704.1.39657 WP_003900704.1.39674 WP_003900704.1.39678 WP_003900704.1.3968 WP_003900704.1.39694 WP_003900704.1.3971 WP_003900704.1.39718 WP_003900704.1.39728 WP_003900704.1.39739 WP_003900704.1.39748 WP_003900704.1.39751 WP_003900704.1.39759 WP_003900704.1.39801 WP_003900704.1.39804 WP_003900704.1.39848 WP_003900704.1.39877 WP_003900704.1.39925 WP_003900704.1.3994 WP_003900704.1.39959 WP_003900704.1.3996 WP_003900704.1.39960 WP_003900704.1.3997 WP_003900704.1.39980 WP_003900704.1.40000 WP_003900704.1.40028 WP_003900704.1.40029 WP_003900704.1.4003 WP_003900704.1.40094 WP_003900704.1.40096 WP_003900704.1.40150 WP_003900704.1.40156 WP_003900704.1.40174 WP_003900704.1.40186 WP_003900704.1.40276 WP_003900704.1.40277 WP_003900704.1.40323 WP_003900704.1.40336 WP_003900704.1.40353 WP_003900704.1.4036 WP_003900704.1.40372 WP_003900704.1.40402 WP_003900704.1.40413 WP_003900704.1.40440 WP_003900704.1.40446 WP_003900704.1.40451 WP_003900704.1.40455 WP_003900704.1.40523 WP_003900704.1.40641 WP_003900704.1.40646 WP_003900704.1.40651 WP_003900704.1.40653 WP_003900704.1.4067 WP_003900704.1.40705 WP_003900704.1.40723 WP_003900704.1.40731 WP_003900704.1.40735 WP_003900704.1.40799 WP_003900704.1.40852 WP_003900704.1.40876 WP_003900704.1.40881 WP_003900704.1.40922 WP_003900704.1.40948 WP_003900704.1.4095 WP_003900704.1.40956 WP_003900704.1.40957 WP_003900704.1.4097 WP_003900704.1.410 WP_003900704.1.41000 WP_003900704.1.41055 WP_003900704.1.41108 WP_003900704.1.41177 WP_003900704.1.41202 WP_003900704.1.41219 WP_003900704.1.41231 WP_003900704.1.41249 WP_003900704.1.4127 WP_003900704.1.41296 WP_003900704.1.41355 WP_003900704.1.41376 WP_003900704.1.41430 WP_003900704.1.41447 WP_003900704.1.41469 WP_003900704.1.41504 WP_003900704.1.41553 WP_003900704.1.41564 WP_003900704.1.41583 WP_003900704.1.41616 WP_003900704.1.41635 WP_003900704.1.41648 WP_003900704.1.41660 WP_003900704.1.41685 WP_003900704.1.41695 WP_003900704.1.41704 WP_003900704.1.4171 WP_003900704.1.41719 WP_003900704.1.41733 WP_003900704.1.41744 WP_003900704.1.41774 WP_003900704.1.41791 WP_003900704.1.41803 WP_003900704.1.41820 WP_003900704.1.41828 WP_003900704.1.41829 WP_003900704.1.41860 WP_003900704.1.41912 WP_003900704.1.41921 WP_003900704.1.41933 WP_003900704.1.41944 WP_003900704.1.42043 WP_003900704.1.42075 WP_003900704.1.42078 WP_003900704.1.42094 WP_003900704.1.42112 WP_003900704.1.4212 WP_003900704.1.42122 WP_003900704.1.42134 WP_003900704.1.42183 WP_003900704.1.42188 WP_003900704.1.42208 WP_003900704.1.42247 WP_003900704.1.42255 WP_003900704.1.42273 WP_003900704.1.42278 WP_003900704.1.42304 WP_003900704.1.42309 WP_003900704.1.42370 WP_003900704.1.42385 WP_003900704.1.42400 WP_003900704.1.42409 WP_003900704.1.42414 WP_003900704.1.42417 WP_003900704.1.42430 WP_003900704.1.42461 WP_003900704.1.42465 WP_003900704.1.42467 WP_003900704.1.42473 WP_003900704.1.42494 WP_003900704.1.42519 WP_003900704.1.42524 WP_003900704.1.42534 WP_003900704.1.4255 WP_003900704.1.42562 WP_003900704.1.42568 WP_003900704.1.42570 WP_003900704.1.42618 WP_003900704.1.42660 WP_003900704.1.42695 WP_003900704.1.42704 WP_003900704.1.42705 WP_003900704.1.42722 WP_003900704.1.42777 WP_003900704.1.42782 WP_003900704.1.42835 WP_003900704.1.42839 WP_003900704.1.42842 WP_003900704.1.42905 WP_003900704.1.42916 WP_003900704.1.42930 WP_003900704.1.42971 WP_003900704.1.43005 WP_003900704.1.43009 WP_003900704.1.43053 WP_003900704.1.43082 WP_003900704.1.43087 WP_003900704.1.43098 WP_003900704.1.43208 WP_003900704.1.43236 WP_003900704.1.43246 WP_003900704.1.43255 WP_003900704.1.43266 WP_003900704.1.43269 WP_003900704.1.43273 WP_003900704.1.43296 WP_003900704.1.43306 WP_003900704.1.4335 WP_003900704.1.43368 WP_003900704.1.43395 WP_003900704.1.43457 WP_003900704.1.43462 WP_003900704.1.43475 WP_003900704.1.43478 WP_003900704.1.43484 WP_003900704.1.43578 WP_003900704.1.43588 WP_003900704.1.43664 WP_003900704.1.43684 WP_003900704.1.43686 WP_003900704.1.43706 WP_003900704.1.43716 WP_003900704.1.4377 WP_003900704.1.43781 WP_003900704.1.43794 WP_003900704.1.43815 WP_003900704.1.43846 WP_003900704.1.43861 WP_003900704.1.43863 WP_003900704.1.43866 WP_003900704.1.43872 WP_003900704.1.43885 WP_003900704.1.43897 WP_003900704.1.4390 WP_003900704.1.43902 WP_003900704.1.43921 WP_003900704.1.43936 WP_003900704.1.43937 WP_003900704.1.43960 WP_003900704.1.43965 WP_003900704.1.4399 WP_003900704.1.43993 WP_003900704.1.43996 WP_003900704.1.44 WP_003900704.1.44001 WP_003900704.1.44008 WP_003900704.1.44016 WP_003900704.1.44033 WP_003900704.1.44037 WP_003900704.1.44041 WP_003900704.1.44070 WP_003900704.1.44071 WP_003900704.1.44076 WP_003900704.1.44104 WP_003900704.1.44111 WP_003900704.1.44124 WP_003900704.1.44169 WP_003900704.1.44219 WP_003900704.1.44237 WP_003900704.1.44277 WP_003900704.1.44279 WP_003900704.1.44336 WP_003900704.1.44355 WP_003900704.1.44358 WP_003900704.1.4438 WP_003900704.1.44390 WP_003900704.1.44392 WP_003900704.1.4441 WP_003900704.1.44415 WP_003900704.1.44464 WP_003900704.1.44466 WP_003900704.1.44489 WP_003900704.1.44492 WP_003900704.1.44494 WP_003900704.1.44500 WP_003900704.1.44519 WP_003900704.1.44526 WP_003900704.1.44532 WP_003900704.1.44534 WP_003900704.1.44562 WP_003900704.1.44589 WP_003900704.1.44597 WP_003900704.1.44600 WP_003900704.1.44602 WP_003900704.1.44615 WP_003900704.1.4464 WP_003900704.1.44651 WP_003900704.1.44659 WP_003900704.1.44665 WP_003900704.1.44694 WP_003900704.1.44700 WP_003900704.1.44713 WP_003900704.1.44735 WP_003900704.1.44740 WP_003900704.1.44757 WP_003900704.1.4476 WP_003900704.1.44761 WP_003900704.1.44767 WP_003900704.1.44776 WP_003900704.1.44786 WP_003900704.1.44808 WP_003900704.1.44864 WP_003900704.1.44901 WP_003900704.1.44908 WP_003900704.1.44913 WP_003900704.1.4492 WP_003900704.1.44939 WP_003900704.1.44979 WP_003900704.1.44981 WP_003900704.1.45002 WP_003900704.1.45011 WP_003900704.1.4504 WP_003900704.1.45066 WP_003900704.1.45081 WP_003900704.1.45113 WP_003900704.1.45129 WP_003900704.1.45135 WP_003900704.1.45147 WP_003900704.1.45168 WP_003900704.1.4517 WP_003900704.1.45181 WP_003900704.1.45185 WP_003900704.1.45192 WP_003900704.1.45200 WP_003900704.1.45205 WP_003900704.1.45211 WP_003900704.1.45249 WP_003900704.1.4526 WP_003900704.1.45286 WP_003900704.1.45326 WP_003900704.1.45347 WP_003900704.1.45374 WP_003900704.1.45390 WP_003900704.1.454 WP_003900704.1.45407 WP_003900704.1.45451 WP_003900704.1.45453 WP_003900704.1.45460 WP_003900704.1.45463 WP_003900704.1.45470 WP_003900704.1.45474 WP_003900704.1.45491 WP_003900704.1.45510 WP_003900704.1.45563 WP_003900704.1.45584 WP_003900704.1.45590 WP_003900704.1.45626 WP_003900704.1.45631 WP_003900704.1.45666 WP_003900704.1.45697 WP_003900704.1.4571 WP_003900704.1.45731 WP_003900704.1.45743 WP_003900704.1.45765 WP_003900704.1.45776 WP_003900704.1.45783 WP_003900704.1.45805 WP_003900704.1.45815 WP_003900704.1.45849 WP_003900704.1.45867 WP_003900704.1.45884 WP_003900704.1.4590 WP_003900704.1.45923 WP_003900704.1.45926 WP_003900704.1.45963 WP_003900704.1.45992 WP_003900704.1.46025 WP_003900704.1.46083 WP_003900704.1.46090 WP_003900704.1.46092 WP_003900704.1.46100 WP_003900704.1.46101 WP_003900704.1.46103 WP_003900704.1.46107 WP_003900704.1.46127 WP_003900704.1.46128 WP_003900704.1.46129 WP_003900704.1.46141 WP_003900704.1.46150 WP_003900704.1.46201 WP_003900704.1.46226 WP_003900704.1.4624 WP_003900704.1.46253 WP_003900704.1.46268 WP_003900704.1.46285 WP_003900704.1.46300 WP_003900704.1.46336 WP_003900704.1.46365 WP_003900704.1.46370 WP_003900704.1.46381 WP_003900704.1.46402 WP_003900704.1.46411 WP_003900704.1.4644 WP_003900704.1.46442 WP_003900704.1.46453 WP_003900704.1.46463 WP_003900704.1.46478 WP_003900704.1.46492 WP_003900704.1.46521 WP_003900704.1.4653 WP_003900704.1.46532 WP_003900704.1.46539 WP_003900704.1.46568 WP_003900704.1.46585 WP_003900704.1.46609 WP_003900704.1.46613 WP_003900704.1.46625 WP_003900704.1.46642 WP_003900704.1.46647 WP_003900704.1.46674 WP_003900704.1.46724 WP_003900704.1.46758 WP_003900704.1.46773 WP_003900704.1.46777 WP_003900704.1.46786 WP_003900704.1.46792 WP_003900704.1.46847 WP_003900704.1.46851 WP_003900704.1.4687 WP_003900704.1.46897 WP_003900704.1.46936 WP_003900704.1.46980 WP_003900704.1.47011 WP_003900704.1.47012 WP_003900704.1.47066 WP_003900704.1.47077 WP_003900704.1.47083 WP_003900704.1.47106 WP_003900704.1.47142 WP_003900704.1.47147 WP_003900704.1.47166 WP_003900704.1.47179 WP_003900704.1.47194 WP_003900704.1.47207 WP_003900704.1.47210 WP_003900704.1.47261 WP_003900704.1.47262 WP_003900704.1.47402 WP_003900704.1.47423 WP_003900704.1.47467 WP_003900704.1.47502 WP_003900704.1.4751 WP_003900704.1.47511 WP_003900704.1.47537 WP_003900704.1.47540 WP_003900704.1.47568 WP_003900704.1.47572 WP_003900704.1.47588 WP_003900704.1.47636 WP_003900704.1.4764 WP_003900704.1.47653 WP_003900704.1.47679 WP_003900704.1.47681 WP_003900704.1.47690 WP_003900704.1.4771 WP_003900704.1.47717 WP_003900704.1.47743 WP_003900704.1.47754 WP_003900704.1.47773 WP_003900704.1.47776 WP_003900704.1.47780 WP_003900704.1.47805 WP_003900704.1.47832 WP_003900704.1.47847 WP_003900704.1.47858 WP_003900704.1.47861 WP_003900704.1.47868 WP_003900704.1.47893 WP_003900704.1.47899 WP_003900704.1.479 WP_003900704.1.47912 WP_003900704.1.47913 WP_003900704.1.47926 WP_003900704.1.4794 WP_003900704.1.47943 WP_003900704.1.47944 WP_003900704.1.47959 WP_003900704.1.47974 WP_003900704.1.47993 WP_003900704.1.48039 WP_003900704.1.48050 WP_003900704.1.48084 WP_003900704.1.48097 WP_003900704.1.48101 WP_003900704.1.4813 WP_003900704.1.48130 WP_003900704.1.48135 WP_003900704.1.48143 WP_003900704.1.48152 WP_003900704.1.48155 WP_003900704.1.48170 WP_003900704.1.48173 WP_003900704.1.48177 WP_003900704.1.48185 WP_003900704.1.48204 WP_003900704.1.48219 WP_003900704.1.4823 WP_003900704.1.48240 WP_003900704.1.48256 WP_003900704.1.48264 WP_003900704.1.48287 WP_003900704.1.48330 WP_003900704.1.48333 WP_003900704.1.48348 WP_003900704.1.48354 WP_003900704.1.48372 WP_003900704.1.48383 WP_003900704.1.48388 WP_003900704.1.48419 WP_003900704.1.48423 WP_003900704.1.48443 WP_003900704.1.48450 WP_003900704.1.48462 WP_003900704.1.48543 WP_003900704.1.48550 WP_003900704.1.48605 WP_003900704.1.48618 WP_003900704.1.4863 WP_003900704.1.48648 WP_003900704.1.48658 WP_003900704.1.48666 WP_003900704.1.48687 WP_003900704.1.48779 WP_003900704.1.4878 WP_003900704.1.48798 WP_003900704.1.48802 WP_003900704.1.48826 WP_003900704.1.48831 WP_003900704.1.48843 WP_003900704.1.48857 WP_003900704.1.4890 WP_003900704.1.48946 WP_003900704.1.48979 WP_003900704.1.49017 WP_003900704.1.49048 WP_003900704.1.49059 WP_003900704.1.4906 WP_003900704.1.4907 WP_003900704.1.49103 WP_003900704.1.49110 WP_003900704.1.49111 WP_003900704.1.4919 WP_003900704.1.49251 WP_003900704.1.49263 WP_003900704.1.49291 WP_003900704.1.49296 WP_003900704.1.49335 WP_003900704.1.49337 WP_003900704.1.49419 WP_003900704.1.49426 WP_003900704.1.49437 WP_003900704.1.49439 WP_003900704.1.49474 WP_003900704.1.49506 WP_003900704.1.49516 WP_003900704.1.49523 WP_003900704.1.49526 WP_003900704.1.49532 WP_003900704.1.49588 WP_003900704.1.4959 WP_003900704.1.49678 WP_003900704.1.49687 WP_003900704.1.49699 WP_003900704.1.49709 WP_003900704.1.4971 WP_003900704.1.4972 WP_003900704.1.49736 WP_003900704.1.49746 WP_003900704.1.49764 WP_003900704.1.49773 WP_003900704.1.49796 WP_003900704.1.49814 WP_003900704.1.49815 WP_003900704.1.49816 WP_003900704.1.49839 WP_003900704.1.49857 WP_003900704.1.49878 WP_003900704.1.49880 WP_003900704.1.49944 WP_003900704.1.4999 WP_003900704.1.49990 WP_003900704.1.50068 WP_003900704.1.50077 WP_003900704.1.5008 WP_003900704.1.50081 WP_003900704.1.50122 WP_003900704.1.50126 WP_003900704.1.50149 WP_003900704.1.50162 WP_003900704.1.5018 WP_003900704.1.50194 WP_003900704.1.50218 WP_003900704.1.50235 WP_003900704.1.50249 WP_003900704.1.50265 WP_003900704.1.50271 WP_003900704.1.50324 WP_003900704.1.50347 WP_003900704.1.50372 WP_003900704.1.50398 WP_003900704.1.50407 WP_003900704.1.50444 WP_003900704.1.50466 WP_003900704.1.50472 WP_003900704.1.5048 WP_003900704.1.50498 WP_003900704.1.5050 WP_003900704.1.50540 WP_003900704.1.50554 WP_003900704.1.50557 WP_003900704.1.50601 WP_003900704.1.50610 WP_003900704.1.50632 WP_003900704.1.50633 WP_003900704.1.50642 WP_003900704.1.50655 WP_003900704.1.50659 WP_003900704.1.50683 WP_003900704.1.50689 WP_003900704.1.50692 WP_003900704.1.50714 WP_003900704.1.50729 WP_003900704.1.50756 WP_003900704.1.50784 WP_003900704.1.50794 WP_003900704.1.50841 WP_003900704.1.50860 WP_003900704.1.50868 WP_003900704.1.50877 WP_003900704.1.5096 WP_003900704.1.50981 WP_003900704.1.50987 WP_003900704.1.51003 WP_003900704.1.51009 WP_003900704.1.51037 WP_003900704.1.51074 WP_003900704.1.51082 WP_003900704.1.51101 WP_003900704.1.51116 WP_003900704.1.51149 WP_003900704.1.51156 WP_003900704.1.51157 WP_003900704.1.51213 WP_003900704.1.51232 WP_003900704.1.51239 WP_003900704.1.51247 WP_003900704.1.51266 WP_003900704.1.51279 WP_003900704.1.51291 WP_003900704.1.51294 WP_003900704.1.51301 WP_003900704.1.51329 WP_003900704.1.51391 WP_003900704.1.51422 WP_003900704.1.51445 WP_003900704.1.51455 WP_003900704.1.51466 WP_003900704.1.51468 WP_003900704.1.51478 WP_003900704.1.51520 WP_003900704.1.51593 WP_003900704.1.51628 WP_003900704.1.5164 WP_003900704.1.51647 WP_003900704.1.51660 WP_003900704.1.51696 WP_003900704.1.51721 WP_003900704.1.51788 WP_003900704.1.51795 WP_003900704.1.51801 WP_003900704.1.51817 WP_003900704.1.51819 WP_003900704.1.51854 WP_003900704.1.51923 WP_003900704.1.51942 WP_003900704.1.51948 WP_003900704.1.51963 WP_003900704.1.51969 WP_003900704.1.52000 WP_003900704.1.52001 WP_003900704.1.52003 WP_003900704.1.52006 WP_003900704.1.52036 WP_003900704.1.52038 WP_003900704.1.52046 WP_003900704.1.52059 WP_003900704.1.52069 WP_003900704.1.52082 WP_003900704.1.52102 WP_003900704.1.52106 WP_003900704.1.52166 WP_003900704.1.52168 WP_003900704.1.52173 WP_003900704.1.52178 WP_003900704.1.52206 WP_003900704.1.52216 WP_003900704.1.52238 WP_003900704.1.52241 WP_003900704.1.52280 WP_003900704.1.52314 WP_003900704.1.52385 WP_003900704.1.52390 WP_003900704.1.524 WP_003900704.1.52460 WP_003900704.1.52485 WP_003900704.1.52486 WP_003900704.1.52495 WP_003900704.1.52504 WP_003900704.1.52522 WP_003900704.1.52531 WP_003900704.1.52533 WP_003900704.1.52545 WP_003900704.1.52553 WP_003900704.1.52563 WP_003900704.1.52564 WP_003900704.1.52574 WP_003900704.1.52641 WP_003900704.1.52673 WP_003900704.1.52674 WP_003900704.1.52708 WP_003900704.1.52713 WP_003900704.1.52761 WP_003900704.1.52791 WP_003900704.1.52797 WP_003900704.1.52818 WP_003900704.1.52872 WP_003900704.1.52873 WP_003900704.1.52891 WP_003900704.1.52892 WP_003900704.1.52909 WP_003900704.1.52970 WP_003900704.1.52998 WP_003900704.1.53053 WP_003900704.1.53056 WP_003900704.1.5306 WP_003900704.1.53088 WP_003900704.1.5309 WP_003900704.1.531 WP_003900704.1.53117 WP_003900704.1.53118 WP_003900704.1.53142 WP_003900704.1.53143 WP_003900704.1.53157 WP_003900704.1.53167 WP_003900704.1.53200 WP_003900704.1.53204 WP_003900704.1.53213 WP_003900704.1.53217 WP_003900704.1.53226 WP_003900704.1.53229 WP_003900704.1.53230 WP_003900704.1.53237 WP_003900704.1.53254 WP_003900704.1.53257 WP_003900704.1.53276 WP_003900704.1.53302 WP_003900704.1.53306 WP_003900704.1.5334 WP_003900704.1.5335 WP_003900704.1.53353 WP_003900704.1.53381 WP_003900704.1.53413 WP_003900704.1.53458 WP_003900704.1.53460 WP_003900704.1.53480 WP_003900704.1.53517 WP_003900704.1.53522 WP_003900704.1.53525 WP_003900704.1.53526 WP_003900704.1.53553 WP_003900704.1.53606 WP_003900704.1.53628 WP_003900704.1.53643 WP_003900704.1.53667 WP_003900704.1.53679 WP_003900704.1.53715 WP_003900704.1.53730 WP_003900704.1.53742 WP_003900704.1.53743 WP_003900704.1.53754 WP_003900704.1.53775 WP_003900704.1.53787 WP_003900704.1.53803 WP_003900704.1.53818 WP_003900704.1.53822 WP_003900704.1.53853 WP_003900704.1.53865 WP_003900704.1.53888 WP_003900704.1.53900 WP_003900704.1.53912 WP_003900704.1.53914 WP_003900704.1.5398 WP_003900704.1.5408 WP_003900704.1.54089 WP_003900704.1.54093 WP_003900704.1.54099 WP_003900704.1.54112 WP_003900704.1.54125 WP_003900704.1.54141 WP_003900704.1.54162 WP_003900704.1.54179 WP_003900704.1.54206 WP_003900704.1.54218 WP_003900704.1.54225 WP_003900704.1.54227 WP_003900704.1.54232 WP_003900704.1.54241 WP_003900704.1.54245 WP_003900704.1.54247 WP_003900704.1.54260 WP_003900704.1.54275 WP_003900704.1.54280 WP_003900704.1.5429 WP_003900704.1.54294 WP_003900704.1.54314 WP_003900704.1.54347 WP_003900704.1.54351 WP_003900704.1.54370 WP_003900704.1.54428 WP_003900704.1.54449 WP_003900704.1.54494 WP_003900704.1.54502 WP_003900704.1.54514 WP_003900704.1.54519 WP_003900704.1.5452 WP_003900704.1.54531 WP_003900704.1.54537 WP_003900704.1.54553 WP_003900704.1.54555 WP_003900704.1.54575 WP_003900704.1.54633 WP_003900704.1.54686 WP_003900704.1.54687 WP_003900704.1.54705 WP_003900704.1.54730 WP_003900704.1.54732 WP_003900704.1.5475 WP_003900704.1.54797 WP_003900704.1.54807 WP_003900704.1.54836 WP_003900704.1.54838 WP_003900704.1.54860 WP_003900704.1.54888 WP_003900704.1.54905 WP_003900704.1.54909 WP_003900704.1.54937 WP_003900704.1.54939 WP_003900704.1.54944 WP_003900704.1.54945 WP_003900704.1.54953 WP_003900704.1.54964 WP_003900704.1.55015 WP_003900704.1.55022 WP_003900704.1.55023 WP_003900704.1.55051 WP_003900704.1.55072 WP_003900704.1.55088 WP_003900704.1.55106 WP_003900704.1.55126 WP_003900704.1.55128 WP_003900704.1.55140 WP_003900704.1.55150 WP_003900704.1.55210 WP_003900704.1.55227 WP_003900704.1.55248 WP_003900704.1.55257 WP_003900704.1.55258 WP_003900704.1.55267 WP_003900704.1.55279 WP_003900704.1.55307 WP_003900704.1.55326 WP_003900704.1.55328 WP_003900704.1.5533 WP_003900704.1.55345 WP_003900704.1.55396 WP_003900704.1.55398 WP_003900704.1.55441 WP_003900704.1.55459 WP_003900704.1.55501 WP_003900704.1.55504 WP_003900704.1.55578 WP_003900704.1.55626 WP_003900704.1.55641 WP_003900704.1.5569 WP_003900704.1.55723 WP_003900704.1.55735 WP_003900704.1.5574 WP_003900704.1.55772 WP_003900704.1.55802 WP_003900704.1.55807 WP_003900704.1.55819 WP_003900704.1.55821 WP_003900704.1.5583 WP_003900704.1.55849 WP_003900704.1.55856 WP_003900704.1.55860 WP_003900704.1.55882 WP_003900704.1.55883 WP_003900704.1.55894 WP_003900704.1.55902 WP_003900704.1.55908 WP_003900704.1.55909 WP_003900704.1.5591 WP_003900704.1.55961 WP_003900704.1.55977 WP_003900704.1.55983 WP_003900704.1.56028 WP_003900704.1.56057 WP_003900704.1.56060 WP_003900704.1.56107 WP_003900704.1.56132 WP_003900704.1.56163 WP_003900704.1.56167 WP_003900704.1.56178 WP_003900704.1.56287 WP_003900704.1.56292 WP_003900704.1.56327 WP_003900704.1.56341 WP_003900704.1.56359 WP_003900704.1.56365 WP_003900704.1.56394 WP_003900704.1.56443 WP_003900704.1.56473 WP_003900704.1.56478 WP_003900704.1.56500 WP_003900704.1.56517 WP_003900704.1.56534 WP_003900704.1.5656 WP_003900704.1.56577 WP_003900704.1.56593 WP_003900704.1.56625 WP_003900704.1.56637 WP_003900704.1.56670 WP_003900704.1.56697 WP_003900704.1.567 WP_003900704.1.56701 WP_003900704.1.56709 WP_003900704.1.56729 WP_003900704.1.56743 WP_003900704.1.56755 WP_003900704.1.56764 WP_003900704.1.56769 WP_003900704.1.56770 WP_003900704.1.56795 WP_003900704.1.5681 WP_003900704.1.56839 WP_003900704.1.56863 WP_003900704.1.56868 WP_003900704.1.56869 WP_003900704.1.56915 WP_003900704.1.56926 WP_003900704.1.56961 WP_003900704.1.56971 WP_003900704.1.56972 WP_003900704.1.57023 WP_003900704.1.57035 WP_003900704.1.57077 WP_003900704.1.57087 WP_003900704.1.57094 WP_003900704.1.57134 WP_003900704.1.57151 WP_003900704.1.57169 WP_003900704.1.57208 WP_003900704.1.57212 WP_003900704.1.57230 WP_003900704.1.5724 WP_003900704.1.5725 WP_003900704.1.5727 WP_003900704.1.57273 WP_003900704.1.573 WP_003900704.1.57314 WP_003900704.1.57326 WP_003900704.1.57328 WP_003900704.1.57331 WP_003900704.1.57340 WP_003900704.1.57351 WP_003900704.1.57352 WP_003900704.1.57380 WP_003900704.1.57430 WP_003900704.1.5744 WP_003900704.1.57440 WP_003900704.1.5745 WP_003900704.1.57461 WP_003900704.1.57469 WP_003900704.1.57489 WP_003900704.1.575 WP_003900704.1.57509 WP_003900704.1.57519 WP_003900704.1.57525 WP_003900704.1.57551 WP_003900704.1.5758 WP_003900704.1.57596 WP_003900704.1.57604 WP_003900704.1.57616 WP_003900704.1.57617 WP_003900704.1.57619 WP_003900704.1.57627 WP_003900704.1.57642 WP_003900704.1.57658 WP_003900704.1.57675 WP_003900704.1.57689 WP_003900704.1.57708 WP_003900704.1.57794 WP_003900704.1.57825 WP_003900704.1.57843 WP_003900704.1.57906 WP_003900704.1.57926 WP_003900704.1.57930 WP_003900704.1.57957 WP_003900704.1.57960 WP_003900704.1.57964 WP_003900704.1.57991 WP_003900704.1.58000 WP_003900704.1.58086 WP_003900704.1.58101 WP_003900704.1.58103 WP_003900704.1.58108 WP_003900704.1.5811 WP_003900704.1.58121 WP_003900704.1.58145 WP_003900704.1.58164 WP_003900704.1.58174 WP_003900704.1.582 WP_003900704.1.58202 WP_003900704.1.58209 WP_003900704.1.58215 WP_003900704.1.5824 WP_003900704.1.58250 WP_003900704.1.58259 WP_003900704.1.58283 WP_003900704.1.58288 WP_003900704.1.5830 WP_003900704.1.58303 WP_003900704.1.58311 WP_003900704.1.58359 WP_003900704.1.58386 WP_003900704.1.58393 WP_003900704.1.58431 WP_003900704.1.5844 WP_003900704.1.58457 WP_003900704.1.58488 WP_003900704.1.58518 WP_003900704.1.58534 WP_003900704.1.58559 WP_003900704.1.58567 WP_003900704.1.58573 WP_003900704.1.58602 WP_003900704.1.58612 WP_003900704.1.58619 WP_003900704.1.58630 WP_003900704.1.5865 WP_003900704.1.58671 WP_003900704.1.58690 WP_003900704.1.58702 WP_003900704.1.58743 WP_003900704.1.58754 WP_003900704.1.5879 WP_003900704.1.5881 WP_003900704.1.58824 WP_003900704.1.58848 WP_003900704.1.58857 WP_003900704.1.58891 WP_003900704.1.58892 WP_003900704.1.5890 WP_003900704.1.58921 WP_003900704.1.58930 WP_003900704.1.58939 WP_003900704.1.58941 WP_003900704.1.58953 WP_003900704.1.5898 WP_003900704.1.59025 WP_003900704.1.59029 WP_003900704.1.59037 WP_003900704.1.59044 WP_003900704.1.59088 WP_003900704.1.59112 WP_003900704.1.59130 WP_003900704.1.5914 WP_003900704.1.59147 WP_003900704.1.59166 WP_003900704.1.59205 WP_003900704.1.59209 WP_003900704.1.59237 WP_003900704.1.59240 WP_003900704.1.59253 WP_003900704.1.59254 WP_003900704.1.59262 WP_003900704.1.59270 WP_003900704.1.5928 WP_003900704.1.59304 WP_003900704.1.59305 WP_003900704.1.59309 WP_003900704.1.59316 WP_003900704.1.59326 WP_003900704.1.59328 WP_003900704.1.59333 WP_003900704.1.59338 WP_003900704.1.59388 WP_003900704.1.59428 WP_003900704.1.59487 WP_003900704.1.59537 WP_003900704.1.59561 WP_003900704.1.59677 WP_003900704.1.59722 WP_003900704.1.59727 WP_003900704.1.59732 WP_003900704.1.59738 WP_003900704.1.59750 WP_003900704.1.59757 WP_003900704.1.59808 WP_003900704.1.59850 WP_003900704.1.59856 WP_003900704.1.59860 WP_003900704.1.59861 WP_003900704.1.5987 WP_003900704.1.59878 WP_003900704.1.59888 WP_003900704.1.59952 WP_003900704.1.5996 WP_003900704.1.59961 WP_003900704.1.59974 WP_003900704.1.6000 WP_003900704.1.60007 WP_003900704.1.60016 WP_003900704.1.6003 WP_003900704.1.60047 WP_003900704.1.6007 WP_003900704.1.60121 WP_003900704.1.60125 WP_003900704.1.60135 WP_003900704.1.60152 WP_003900704.1.60171 WP_003900704.1.60197 WP_003900704.1.6020 WP_003900704.1.60205 WP_003900704.1.60207 WP_003900704.1.60215 WP_003900704.1.60267 WP_003900704.1.60288 WP_003900704.1.60291 WP_003900704.1.60301 WP_003900704.1.60305 WP_003900704.1.60312 WP_003900704.1.60313 WP_003900704.1.60314 WP_003900704.1.60367 WP_003900704.1.60376 WP_003900704.1.60403 WP_003900704.1.60413 WP_003900704.1.60421 WP_003900704.1.60451 WP_003900704.1.60460 WP_003900704.1.60479 WP_003900704.1.60487 WP_003900704.1.60512 WP_003900704.1.60573 WP_003900704.1.60583 WP_003900704.1.60632 WP_003900704.1.60657 WP_003900704.1.60687 WP_003900704.1.60689 WP_003900704.1.60727 WP_003900704.1.60738 WP_003900704.1.60763 WP_003900704.1.6077 WP_003900704.1.60791 WP_003900704.1.60834 WP_003900704.1.60870 WP_003900704.1.60878 WP_003900704.1.60879 WP_003900704.1.60913 WP_003900704.1.60978 WP_003900704.1.61000 WP_003900704.1.61001 WP_003900704.1.61012 WP_003900704.1.61014 WP_003900704.1.61015 WP_003900704.1.61037 WP_003900704.1.61052 WP_003900704.1.61065 WP_003900704.1.61100 WP_003900704.1.61101 WP_003900704.1.61138 WP_003900704.1.61142 WP_003900704.1.61198 WP_003900704.1.612 WP_003900704.1.61234 WP_003900704.1.61256 WP_003900704.1.61281 WP_003900704.1.61314 WP_003900704.1.61321 WP_003900704.1.61326 WP_003900704.1.61328 WP_003900704.1.61368 WP_003900704.1.61391 WP_003900704.1.61406 WP_003900704.1.61422 WP_003900704.1.61425 WP_003900704.1.61428 WP_003900704.1.61469 WP_003900704.1.61494 WP_003900704.1.61522 WP_003900704.1.61552 WP_003900704.1.61557 WP_003900704.1.61567 WP_003900704.1.61571 WP_003900704.1.61573 WP_003900704.1.61584 WP_003900704.1.61586 WP_003900704.1.6159 WP_003900704.1.61592 WP_003900704.1.6160 WP_003900704.1.61614 WP_003900704.1.6163 WP_003900704.1.61655 WP_003900704.1.61665 WP_003900704.1.61669 WP_003900704.1.61682 WP_003900704.1.61692 WP_003900704.1.61719 WP_003900704.1.61728 WP_003900704.1.61750 WP_003900704.1.61754 WP_003900704.1.61755 WP_003900704.1.61757 WP_003900704.1.61778 WP_003900704.1.6179 WP_003900704.1.61816 WP_003900704.1.61842 WP_003900704.1.61862 WP_003900704.1.61865 WP_003900704.1.61868 WP_003900704.1.61911 WP_003900704.1.61941 WP_003900704.1.61953 WP_003900704.1.61979 WP_003900704.1.61986 WP_003900704.1.61987 WP_003900704.1.61998 WP_003900704.1.62021 WP_003900704.1.62087 WP_003900704.1.62089 WP_003900704.1.62101 WP_003900704.1.62104 WP_003900704.1.6211 WP_003900704.1.62132 WP_003900704.1.62162 WP_003900704.1.62225 WP_003900704.1.62230 WP_003900704.1.62238 WP_003900704.1.62249 WP_003900704.1.62270 WP_003900704.1.62281 WP_003900704.1.62307 WP_003900704.1.6231 WP_003900704.1.62359 WP_003900704.1.62360 WP_003900704.1.62371 WP_003900704.1.62379 WP_003900704.1.62395 WP_003900704.1.62408 WP_003900704.1.62449 WP_003900704.1.62468 WP_003900704.1.6248 WP_003900704.1.62508 WP_003900704.1.62565 WP_003900704.1.62606 WP_003900704.1.62616 WP_003900704.1.62666 WP_003900704.1.62687 WP_003900704.1.62715 WP_003900704.1.62730 WP_003900704.1.62738 WP_003900704.1.62761 WP_003900704.1.62766 WP_003900704.1.62786 WP_003900704.1.62813 WP_003900704.1.62839 WP_003900704.1.62909 WP_003900704.1.62936 WP_003900704.1.6294 WP_003900704.1.6295 WP_003900704.1.62962 WP_003900704.1.63007 WP_003900704.1.63019 WP_003900704.1.63032 WP_003900704.1.63037 WP_003900704.1.63064 WP_003900704.1.63066 WP_003900704.1.63072 WP_003900704.1.6308 WP_003900704.1.63081 WP_003900704.1.63096 WP_003900704.1.63106 WP_003900704.1.6314 WP_003900704.1.63144 WP_003900704.1.63154 WP_003900704.1.63160 WP_003900704.1.63161 WP_003900704.1.63175 WP_003900704.1.63194 WP_003900704.1.6322 WP_003900704.1.63222 WP_003900704.1.63247 WP_003900704.1.6328 WP_003900704.1.63291 WP_003900704.1.63312 WP_003900704.1.63317 WP_003900704.1.63331 WP_003900704.1.63373 WP_003900704.1.63384 WP_003900704.1.63403 WP_003900704.1.63424 WP_003900704.1.63428 WP_003900704.1.6345 WP_003900704.1.63464 WP_003900704.1.63483 WP_003900704.1.63502 WP_003900704.1.63504 WP_003900704.1.63522 WP_003900704.1.63530 WP_003900704.1.63564 WP_003900704.1.63567 WP_003900704.1.63596 WP_003900704.1.63600 WP_003900704.1.63623 WP_003900704.1.63624 WP_003900704.1.63625 WP_003900704.1.63627 WP_003900704.1.63654 WP_003900704.1.63662 WP_003900704.1.63711 WP_003900704.1.63734 WP_003900704.1.63807 WP_003900704.1.63819 WP_003900704.1.63844 WP_003900704.1.63888 WP_003900704.1.63913 WP_003900704.1.63915 WP_003900704.1.63918 WP_003900704.1.63970 WP_003900704.1.64000 WP_003900704.1.64027 WP_003900704.1.64058 WP_003900704.1.64065 WP_003900704.1.6407 WP_003900704.1.64082 WP_003900704.1.64091 WP_003900704.1.64102 WP_003900704.1.64104 WP_003900704.1.64119 WP_003900704.1.64169 WP_003900704.1.64219 WP_003900704.1.6422 WP_003900704.1.64222 WP_003900704.1.64223 WP_003900704.1.64228 WP_003900704.1.64235 WP_003900704.1.64249 WP_003900704.1.6427 WP_003900704.1.64278 WP_003900704.1.64287 WP_003900704.1.64419 WP_003900704.1.6443 WP_003900704.1.64463 WP_003900704.1.64480 WP_003900704.1.64497 WP_003900704.1.64506 WP_003900704.1.64511 WP_003900704.1.64513 WP_003900704.1.64514 WP_003900704.1.64515 WP_003900704.1.64522 WP_003900704.1.64526 WP_003900704.1.64543 WP_003900704.1.6456 WP_003900704.1.64567 WP_003900704.1.64588 WP_003900704.1.64589 WP_003900704.1.64594 WP_003900704.1.64595 WP_003900704.1.64608 WP_003900704.1.64619 WP_003900704.1.64629 WP_003900704.1.6464 WP_003900704.1.64664 WP_003900704.1.64669 WP_003900704.1.64672 WP_003900704.1.64680 WP_003900704.1.64682 WP_003900704.1.64727 WP_003900704.1.64729 WP_003900704.1.64776 WP_003900704.1.64802 WP_003900704.1.64832 WP_003900704.1.6486 WP_003900704.1.64870 WP_003900704.1.64898 WP_003900704.1.64922 WP_003900704.1.6493 WP_003900704.1.64937 WP_003900704.1.64941 WP_003900704.1.64966 WP_003900704.1.64973 WP_003900704.1.65001 WP_003900704.1.65026 WP_003900704.1.65053 WP_003900704.1.65070 WP_003900704.1.65079 WP_003900704.1.65102 WP_003900704.1.65157 WP_003900704.1.65181 WP_003900704.1.65212 WP_003900704.1.65229 WP_003900704.1.6523 WP_003900704.1.65253 WP_003900704.1.65291 WP_003900704.1.65315 WP_003900704.1.65329 WP_003900704.1.6536 WP_003900704.1.65374 WP_003900704.1.65386 WP_003900704.1.65414 WP_003900704.1.65416 WP_003900704.1.65433 WP_003900704.1.65455 WP_003900704.1.65467 WP_003900704.1.65488 WP_003900704.1.65529 WP_003900704.1.65539 WP_003900704.1.65583 WP_003900704.1.65612 WP_003900704.1.65623 WP_003900704.1.65635 WP_003900704.1.65637 WP_003900704.1.65648 WP_003900704.1.65683 WP_003900704.1.65686 WP_003900704.1.65688 WP_003900704.1.65707 WP_003900704.1.65733 WP_003900704.1.65746 WP_003900704.1.65747 WP_003900704.1.65759 WP_003900704.1.65816 WP_003900704.1.65830 WP_003900704.1.65858 WP_003900704.1.65862 WP_003900704.1.65869 WP_003900704.1.65893 WP_003900704.1.65929 WP_003900704.1.65932 WP_003900704.1.65958 WP_003900704.1.65974 WP_003900704.1.66004 WP_003900704.1.66013 WP_003900704.1.6606 WP_003900704.1.66089 WP_003900704.1.66149 WP_003900704.1.66151 WP_003900704.1.66229 WP_003900704.1.66276 WP_003900704.1.66293 WP_003900704.1.66297 WP_003900704.1.66323 WP_003900704.1.66325 WP_003900704.1.66334 WP_003900704.1.66355 WP_003900704.1.66367 WP_003900704.1.66394 WP_003900704.1.66396 WP_003900704.1.66451 WP_003900704.1.66455 WP_003900704.1.66457 WP_003900704.1.66464 WP_003900704.1.66466 WP_003900704.1.66487 WP_003900704.1.66504 WP_003900704.1.66544 WP_003900704.1.66580 WP_003900704.1.66582 WP_003900704.1.66612 WP_003900704.1.66615 WP_003900704.1.66617 WP_003900704.1.66635 WP_003900704.1.66656 WP_003900704.1.66663 WP_003900704.1.66675 WP_003900704.1.66715 WP_003900704.1.66718 WP_003900704.1.66762 WP_003900704.1.66776 WP_003900704.1.66808 WP_003900704.1.66817 WP_003900704.1.66819 WP_003900704.1.66826 WP_003900704.1.66830 WP_003900704.1.66842 WP_003900704.1.66878 WP_003900704.1.66880 WP_003900704.1.66893 WP_003900704.1.66961 WP_003900704.1.67005 WP_003900704.1.6704 WP_003900704.1.67044 WP_003900704.1.67061 WP_003900704.1.67098 WP_003900704.1.67146 WP_003900704.1.67170 WP_003900704.1.67197 WP_003900704.1.67198 WP_003900704.1.6720 WP_003900704.1.67207 WP_003900704.1.67218 WP_003900704.1.67220 WP_003900704.1.67225 WP_003900704.1.67231 WP_003900704.1.6724 WP_003900704.1.67257 WP_003900704.1.67298 WP_003900704.1.67307 WP_003900704.1.67324 WP_003900704.1.67332 WP_003900704.1.67346 WP_003900704.1.67354 WP_003900704.1.67360 WP_003900704.1.67381 WP_003900704.1.67396 WP_003900704.1.67417 WP_003900704.1.67422 WP_003900704.1.67453 WP_003900704.1.67459 WP_003900704.1.6746 WP_003900704.1.67473 WP_003900704.1.67481 WP_003900704.1.67482 WP_003900704.1.67496 WP_003900704.1.67499 WP_003900704.1.67516 WP_003900704.1.67523 WP_003900704.1.67536 WP_003900704.1.67575 WP_003900704.1.67598 WP_003900704.1.67600 WP_003900704.1.67602 WP_003900704.1.67630 WP_003900704.1.67679 WP_003900704.1.67692 WP_003900704.1.67744 WP_003900704.1.6775 WP_003900704.1.67750 WP_003900704.1.6777 WP_003900704.1.67816 WP_003900704.1.67844 WP_003900704.1.67848 WP_003900704.1.67870 WP_003900704.1.67888 WP_003900704.1.67915 WP_003900704.1.67945 WP_003900704.1.67949 WP_003900704.1.67980 WP_003900704.1.67982 WP_003900704.1.68029 WP_003900704.1.68037 WP_003900704.1.68038 WP_003900704.1.68045 WP_003900704.1.68057 WP_003900704.1.68083 WP_003900704.1.68088 WP_003900704.1.68106 WP_003900704.1.68110 WP_003900704.1.68153 WP_003900704.1.68164 WP_003900704.1.68169 WP_003900704.1.68193 WP_003900704.1.68212 WP_003900704.1.68227 WP_003900704.1.68243 WP_003900704.1.6825 WP_003900704.1.68297 WP_003900704.1.68309 WP_003900704.1.68325 WP_003900704.1.68329 WP_003900704.1.68340 WP_003900704.1.68384 WP_003900704.1.68388 WP_003900704.1.68429 WP_003900704.1.6843 WP_003900704.1.68433 WP_003900704.1.68444 WP_003900704.1.68465 WP_003900704.1.68484 WP_003900704.1.68518 WP_003900704.1.68569 WP_003900704.1.68576 WP_003900704.1.68580 WP_003900704.1.68586 WP_003900704.1.68623 WP_003900704.1.68624 WP_003900704.1.68637 WP_003900704.1.68646 WP_003900704.1.68667 WP_003900704.1.68672 WP_003900704.1.68684 WP_003900704.1.68704 WP_003900704.1.68708 WP_003900704.1.6872 WP_003900704.1.68730 WP_003900704.1.68734 WP_003900704.1.68748 WP_003900704.1.68754 WP_003900704.1.6876 WP_003900704.1.68761 WP_003900704.1.68763 WP_003900704.1.68766 WP_003900704.1.68774 WP_003900704.1.68796 WP_003900704.1.68824 WP_003900704.1.68832 WP_003900704.1.68833 WP_003900704.1.68841 WP_003900704.1.68859 WP_003900704.1.68876 WP_003900704.1.68906 WP_003900704.1.68916 WP_003900704.1.68923 WP_003900704.1.68945 WP_003900704.1.6896 WP_003900704.1.68981 WP_003900704.1.68984 WP_003900704.1.68997 WP_003900704.1.69008 WP_003900704.1.69076 WP_003900704.1.69079 WP_003900704.1.6908 WP_003900704.1.69082 WP_003900704.1.69178 WP_003900704.1.69181 WP_003900704.1.69208 WP_003900704.1.69231 WP_003900704.1.69256 WP_003900704.1.69311 WP_003900704.1.69315 WP_003900704.1.69322 WP_003900704.1.69342 WP_003900704.1.6935 WP_003900704.1.6936 WP_003900704.1.69369 WP_003900704.1.69374 WP_003900704.1.69398 WP_003900704.1.69401 WP_003900704.1.69426 WP_003900704.1.69427 WP_003900704.1.69429 WP_003900704.1.6949 WP_003900704.1.6951 WP_003900704.1.69511 WP_003900704.1.69526 WP_003900704.1.69528 WP_003900704.1.69547 WP_003900704.1.69573 WP_003900704.1.69581 WP_003900704.1.6960 WP_003900704.1.69617 WP_003900704.1.69634 WP_003900704.1.69647 WP_003900704.1.69659 WP_003900704.1.69673 WP_003900704.1.69682 WP_003900704.1.69684 WP_003900704.1.69686 WP_003900704.1.69707 WP_003900704.1.69709 WP_003900704.1.69723 WP_003900704.1.69736 WP_003900704.1.69778 WP_003900704.1.69800 WP_003900704.1.69802 WP_003900704.1.69845 WP_003900704.1.69870 WP_003900704.1.69873 WP_003900704.1.69898 WP_003900704.1.69913 WP_003900704.1.69925 WP_003900704.1.69931 WP_003900704.1.69938 WP_003900704.1.69955 WP_003900704.1.69957 WP_003900704.1.69981 WP_003900704.1.69990 WP_003900704.1.70 WP_003900704.1.70000 WP_003900704.1.70017 WP_003900704.1.70032 WP_003900704.1.70055 WP_003900704.1.70062 WP_003900704.1.70072 WP_003900704.1.70131 WP_003900704.1.70132 WP_003900704.1.7022 WP_003900704.1.70227 WP_003900704.1.70255 WP_003900704.1.70271 WP_003900704.1.70274 WP_003900704.1.7029 WP_003900704.1.70325 WP_003900704.1.70356 WP_003900704.1.70364 WP_003900704.1.70368 WP_003900704.1.70369 WP_003900704.1.70418 WP_003900704.1.70422 WP_003900704.1.70435 WP_003900704.1.70444 WP_003900704.1.70463 WP_003900704.1.70471 WP_003900704.1.70480 WP_003900704.1.70494 WP_003900704.1.70498 WP_003900704.1.70505 WP_003900704.1.70525 WP_003900704.1.70573 WP_003900704.1.70577 WP_003900704.1.70610 WP_003900704.1.70615 WP_003900704.1.70618 WP_003900704.1.70622 WP_003900704.1.70626 WP_003900704.1.70668 WP_003900704.1.70699 WP_003900704.1.70704 WP_003900704.1.70729 WP_003900704.1.70757 WP_003900704.1.70782 WP_003900704.1.70834 WP_003900704.1.7084 WP_003900704.1.70840 WP_003900704.1.70864 WP_003900704.1.70871 WP_003900704.1.70915 WP_003900704.1.70955 WP_003900704.1.70958 WP_003900704.1.70964 WP_003900704.1.70976 WP_003900704.1.71015 WP_003900704.1.71026 WP_003900704.1.71063 WP_003900704.1.71076 WP_003900704.1.71083 WP_003900704.1.7111 WP_003900704.1.7113 WP_003900704.1.71187 WP_003900704.1.71191 WP_003900704.1.71255 WP_003900704.1.71258 WP_003900704.1.71259 WP_003900704.1.71289 WP_003900704.1.71326 WP_003900704.1.71329 WP_003900704.1.71331 WP_003900704.1.71344 WP_003900704.1.71390 WP_003900704.1.71414 WP_003900704.1.71440 WP_003900704.1.71457 WP_003900704.1.71464 WP_003900704.1.71490 WP_003900704.1.71492 WP_003900704.1.71509 WP_003900704.1.71516 WP_003900704.1.71517 WP_003900704.1.71527 WP_003900704.1.71532 WP_003900704.1.71546 WP_003900704.1.71569 WP_003900704.1.71604 WP_003900704.1.71621 WP_003900704.1.71630 WP_003900704.1.71638 WP_003900704.1.71654 WP_003900704.1.71664 WP_003900704.1.71665 WP_003900704.1.71683 WP_003900704.1.71701 WP_003900704.1.71718 WP_003900704.1.71731 WP_003900704.1.71778 WP_003900704.1.71781 WP_003900704.1.71820 WP_003900704.1.71847 WP_003900704.1.7185 WP_003900704.1.71851 WP_003900704.1.71871 WP_003900704.1.71909 WP_003900704.1.71957 WP_003900704.1.71970 WP_003900704.1.72047 WP_003900704.1.72061 WP_003900704.1.72072 WP_003900704.1.72111 WP_003900704.1.72122 WP_003900704.1.72128 WP_003900704.1.72143 WP_003900704.1.7216 WP_003900704.1.72168 WP_003900704.1.72179 WP_003900704.1.72209 WP_003900704.1.72218 WP_003900704.1.72227 WP_003900704.1.7224 WP_003900704.1.72268 WP_003900704.1.72332 WP_003900704.1.72380 WP_003900704.1.72401 WP_003900704.1.72405 WP_003900704.1.72420 WP_003900704.1.72441 WP_003900704.1.72451 WP_003900704.1.72457 WP_003900704.1.72459 WP_003900704.1.72460 WP_003900704.1.72466 WP_003900704.1.72487 WP_003900704.1.72488 WP_003900704.1.72492 WP_003900704.1.72506 WP_003900704.1.72543 WP_003900704.1.7256 WP_003900704.1.72576 WP_003900704.1.72578 WP_003900704.1.72585 WP_003900704.1.72591 WP_003900704.1.72592 WP_003900704.1.72640 WP_003900704.1.7266 WP_003900704.1.72661 WP_003900704.1.72684 WP_003900704.1.72739 WP_003900704.1.72744 WP_003900704.1.72755 WP_003900704.1.72759 WP_003900704.1.72784 WP_003900704.1.72792 WP_003900704.1.72826 WP_003900704.1.72831 WP_003900704.1.72852 WP_003900704.1.72853 WP_003900704.1.72879 WP_003900704.1.72880 WP_003900704.1.72938 WP_003900704.1.72954 WP_003900704.1.72957 WP_003900704.1.72959 WP_003900704.1.72973 WP_003900704.1.7298 WP_003900704.1.72982 WP_003900704.1.72993 WP_003900704.1.73006 WP_003900704.1.73013 WP_003900704.1.73025 WP_003900704.1.73028 WP_003900704.1.73042 WP_003900704.1.73045 WP_003900704.1.73092 WP_003900704.1.7312 WP_003900704.1.73127 WP_003900704.1.73134 WP_003900704.1.73150 WP_003900704.1.73154 WP_003900704.1.73163 WP_003900704.1.73182 WP_003900704.1.73205 WP_003900704.1.7321 WP_003900704.1.73310 WP_003900704.1.73365 WP_003900704.1.73391 WP_003900704.1.73404 WP_003900704.1.73424 WP_003900704.1.73436 WP_003900704.1.73445 WP_003900704.1.73453 WP_003900704.1.73465 WP_003900704.1.73470 WP_003900704.1.73471 WP_003900704.1.73478 WP_003900704.1.73482 WP_003900704.1.73532 WP_003900704.1.73550 WP_003900704.1.73564 WP_003900704.1.73623 WP_003900704.1.73629 WP_003900704.1.73644 WP_003900704.1.7366 WP_003900704.1.73661 WP_003900704.1.7368 WP_003900704.1.73688 WP_003900704.1.73723 WP_003900704.1.73744 WP_003900704.1.73750 WP_003900704.1.73760 WP_003900704.1.73774 WP_003900704.1.73813 WP_003900704.1.73840 WP_003900704.1.73876 WP_003900704.1.7389 WP_003900704.1.74016 WP_003900704.1.74039 WP_003900704.1.74101 WP_003900704.1.74107 WP_003900704.1.74120 WP_003900704.1.74129 WP_003900704.1.74144 WP_003900704.1.7417 WP_003900704.1.74190 WP_003900704.1.74210 WP_003900704.1.7423 WP_003900704.1.74259 WP_003900704.1.74262 WP_003900704.1.74269 WP_003900704.1.74282 WP_003900704.1.74291 WP_003900704.1.74296 WP_003900704.1.74304 WP_003900704.1.7432 WP_003900704.1.74347 WP_003900704.1.7436 WP_003900704.1.74378 WP_003900704.1.74395 WP_003900704.1.74400 WP_003900704.1.74401 WP_003900704.1.74432 WP_003900704.1.74442 WP_003900704.1.74477 WP_003900704.1.74487 WP_003900704.1.74499 WP_003900704.1.74504 WP_003900704.1.74511 WP_003900704.1.74523 WP_003900704.1.74525 WP_003900704.1.74551 WP_003900704.1.74555 WP_003900704.1.74628 WP_003900704.1.74641 WP_003900704.1.74653 WP_003900704.1.74660 WP_003900704.1.74683 WP_003900704.1.7469 WP_003900704.1.74725 WP_003900704.1.74760 WP_003900704.1.74786 WP_003900704.1.74809 WP_003900704.1.74820 WP_003900704.1.74870 WP_003900704.1.74881 WP_003900704.1.74888 WP_003900704.1.74952 WP_003900704.1.7496 WP_003900704.1.74988 WP_003900704.1.75043 WP_003900704.1.75055 WP_003900704.1.75078 WP_003900704.1.75081 WP_003900704.1.75120 WP_003900704.1.75163 WP_003900704.1.75188 WP_003900704.1.75200 WP_003900704.1.75202 WP_003900704.1.75234 WP_003900704.1.75239 WP_003900704.1.75250 WP_003900704.1.75263 WP_003900704.1.75281 WP_003900704.1.75342 WP_003900704.1.7535 WP_003900704.1.75376 WP_003900704.1.75391 WP_003900704.1.75395 WP_003900704.1.75441 WP_003900704.1.75510 WP_003900704.1.75581 WP_003900704.1.75598 WP_003900704.1.75635 WP_003900704.1.75645 WP_003900704.1.75665 WP_003900704.1.75671 WP_003900704.1.75749 WP_003900704.1.75772 WP_003900704.1.75774 WP_003900704.1.75811 WP_003900704.1.75833 WP_003900704.1.7585 WP_003900704.1.75864 WP_003900704.1.75868 WP_003900704.1.75878 WP_003900704.1.75927 WP_003900704.1.75946 WP_003900704.1.75968 WP_003900704.1.75974 WP_003900704.1.76007 WP_003900704.1.76016 WP_003900704.1.76032 WP_003900704.1.76037 WP_003900704.1.7604 WP_003900704.1.76045 WP_003900704.1.76052 WP_003900704.1.76058 WP_003900704.1.76064 WP_003900704.1.76110 WP_003900704.1.76126 WP_003900704.1.76133 WP_003900704.1.76138 WP_003900704.1.76157 WP_003900704.1.76172 WP_003900704.1.76177 WP_003900704.1.76183 WP_003900704.1.76209 WP_003900704.1.76239 WP_003900704.1.76272 WP_003900704.1.76277 WP_003900704.1.76280 WP_003900704.1.76281 WP_003900704.1.76291 WP_003900704.1.76297 WP_003900704.1.76403 WP_003900704.1.76413 WP_003900704.1.76414 WP_003900704.1.76427 WP_003900704.1.76436 WP_003900704.1.76442 WP_003900704.1.76443 WP_003900704.1.76456 WP_003900704.1.76521 WP_003900704.1.76533 WP_003900704.1.76616 WP_003900704.1.76625 WP_003900704.1.76629 WP_003900704.1.76635 WP_003900704.1.76638 WP_003900704.1.76639 WP_003900704.1.76640 WP_003900704.1.76644 WP_003900704.1.76677 WP_003900704.1.76678 WP_003900704.1.76679 WP_003900704.1.76734 WP_003900704.1.76744 WP_003900704.1.76750 WP_003900704.1.76754 WP_003900704.1.76757 WP_003900704.1.76781 WP_003900704.1.76818 WP_003900704.1.76824 WP_003900704.1.76835 WP_003900704.1.76873 WP_003900704.1.76881 WP_003900704.1.76888 WP_003900704.1.76900 WP_003900704.1.7691 WP_003900704.1.76947 WP_003900704.1.76954 WP_003900704.1.76955 WP_003900704.1.76963 WP_003900704.1.76976 WP_003900704.1.770 WP_003900704.1.77000 WP_003900704.1.77008 WP_003900704.1.77021 WP_003900704.1.77056 WP_003900704.1.77065 WP_003900704.1.77093 WP_003900704.1.77107 WP_003900704.1.77115 WP_003900704.1.77118 WP_003900704.1.77125 WP_003900704.1.77141 WP_003900704.1.77142 WP_003900704.1.77250 WP_003900704.1.77252 WP_003900704.1.77260 WP_003900704.1.77266 WP_003900704.1.77280 WP_003900704.1.77285 WP_003900704.1.77312 WP_003900704.1.77348 WP_003900704.1.77351 WP_003900704.1.77352 WP_003900704.1.77361 WP_003900704.1.774 WP_003900704.1.7740 WP_003900704.1.77404 WP_003900704.1.77425 WP_003900704.1.77463 WP_003900704.1.77474 WP_003900704.1.7748 WP_003900704.1.77484 WP_003900704.1.77499 WP_003900704.1.77510 WP_003900704.1.77530 WP_003900704.1.77554 WP_003900704.1.77559 WP_003900704.1.77599 WP_003900704.1.77605 WP_003900704.1.7762 WP_003900704.1.77627 WP_003900704.1.77649 WP_003900704.1.77654 WP_003900704.1.7766 WP_003900704.1.77667 WP_003900704.1.77704 WP_003900704.1.77706 WP_003900704.1.77726 WP_003900704.1.77774 WP_003900704.1.7778 WP_003900704.1.77790 WP_003900704.1.77809 WP_003900704.1.77820 WP_003900704.1.77843 WP_003900704.1.77855 WP_003900704.1.77865 WP_003900704.1.77868 WP_003900704.1.77879 WP_003900704.1.77890 WP_003900704.1.77909 WP_003900704.1.77911 WP_003900704.1.77931 WP_003900704.1.77984 WP_003900704.1.78024 WP_003900704.1.78075 WP_003900704.1.78084 WP_003900704.1.78086 WP_003900704.1.7809 WP_003900704.1.78098 WP_003900704.1.78105 WP_003900704.1.78113 WP_003900704.1.78136 WP_003900704.1.78162 WP_003900704.1.7817 WP_003900704.1.78200 WP_003900704.1.78216 WP_003900704.1.78236 WP_003900704.1.78238 WP_003900704.1.78322 WP_003900704.1.78338 WP_003900704.1.7836 WP_003900704.1.78360 WP_003900704.1.78386 WP_003900704.1.78429 WP_003900704.1.78435 WP_003900704.1.7844 WP_003900704.1.78459 WP_003900704.1.78488 WP_003900704.1.7849 WP_003900704.1.78499 WP_003900704.1.785 WP_003900704.1.78516 WP_003900704.1.78524 WP_003900704.1.78526 WP_003900704.1.78538 WP_003900704.1.78544 WP_003900704.1.78545 WP_003900704.1.78547 WP_003900704.1.78574 WP_003900704.1.78580 WP_003900704.1.7860 WP_003900704.1.78620 WP_003900704.1.78646 WP_003900704.1.78648 WP_003900704.1.78649 WP_003900704.1.78655 WP_003900704.1.78659 WP_003900704.1.7869 WP_003900704.1.78692 WP_003900704.1.78760 WP_003900704.1.78766 WP_003900704.1.78776 WP_003900704.1.78778 WP_003900704.1.78784 WP_003900704.1.78790 WP_003900704.1.78793 WP_003900704.1.78848 WP_003900704.1.78860 WP_003900704.1.7887 WP_003900704.1.78884 WP_003900704.1.78932 WP_003900704.1.78969 WP_003900704.1.78977 WP_003900704.1.78980 WP_003900704.1.79005 WP_003900704.1.79016 WP_003900704.1.79033 WP_003900704.1.79064 WP_003900704.1.79066 WP_003900704.1.79068 WP_003900704.1.79077 WP_003900704.1.79095 WP_003900704.1.79112 WP_003900704.1.79122 WP_003900704.1.79145 WP_003900704.1.79152 WP_003900704.1.79163 WP_003900704.1.79182 WP_003900704.1.79198 WP_003900704.1.79213 WP_003900704.1.79218 WP_003900704.1.79268 WP_003900704.1.79273 WP_003900704.1.79278 WP_003900704.1.79290 WP_003900704.1.79319 WP_003900704.1.79326 WP_003900704.1.7933 WP_003900704.1.79330 WP_003900704.1.79339 WP_003900704.1.79394 WP_003900704.1.79399 WP_003900704.1.79413 WP_003900704.1.79422 WP_003900704.1.79445 WP_003900704.1.79455 WP_003900704.1.79471 WP_003900704.1.79480 WP_003900704.1.79482 WP_003900704.1.79488 WP_003900704.1.79500 WP_003900704.1.79502 WP_003900704.1.79508 WP_003900704.1.79514 WP_003900704.1.79561 WP_003900704.1.79565 WP_003900704.1.79578 WP_003900704.1.79588 WP_003900704.1.79598 WP_003900704.1.79615 WP_003900704.1.79684 WP_003900704.1.79698 WP_003900704.1.797 WP_003900704.1.79744 WP_003900704.1.79784 WP_003900704.1.79802 WP_003900704.1.79806 WP_003900704.1.79819 WP_003900704.1.79826 WP_003900704.1.79828 WP_003900704.1.79851 WP_003900704.1.79853 WP_003900704.1.79863 WP_003900704.1.79881 WP_003900704.1.79885 WP_003900704.1.79898 WP_003900704.1.7990 WP_003900704.1.79900 WP_003900704.1.79913 WP_003900704.1.79918 WP_003900704.1.79947 WP_003900704.1.79948 WP_003900704.1.7995 WP_003900704.1.7997 WP_003900704.1.80004 WP_003900704.1.80015 WP_003900704.1.80022 WP_003900704.1.80030 WP_003900704.1.80054 WP_003900704.1.80084 WP_003900704.1.80099 WP_003900704.1.80129 WP_003900704.1.80177 WP_003900704.1.80234 WP_003900704.1.8026 WP_003900704.1.80275 WP_003900704.1.8029 WP_003900704.1.80299 WP_003900704.1.80300 WP_003900704.1.80304 WP_003900704.1.80326 WP_003900704.1.80351 WP_003900704.1.80370 WP_003900704.1.80399 WP_003900704.1.8044 WP_003900704.1.80451 WP_003900704.1.80458 WP_003900704.1.80461 WP_003900704.1.80490 WP_003900704.1.80503 WP_003900704.1.80507 WP_003900704.1.80552 WP_003900704.1.80576 WP_003900704.1.80588 WP_003900704.1.80599 WP_003900704.1.8060 WP_003900704.1.80636 WP_003900704.1.80711 WP_003900704.1.80714 WP_003900704.1.80743 WP_003900704.1.80784 WP_003900704.1.80815 WP_003900704.1.80853 WP_003900704.1.80918 WP_003900704.1.8093 WP_003900704.1.80967 WP_003900704.1.8097 WP_003900704.1.80988 WP_003900704.1.81007 WP_003900704.1.81013 WP_003900704.1.8105 WP_003900704.1.81059 WP_003900704.1.81063 WP_003900704.1.81066 WP_003900704.1.81075 WP_003900704.1.81091 WP_003900704.1.81119 WP_003900704.1.81125 WP_003900704.1.81136 WP_003900704.1.8114 WP_003900704.1.81189 WP_003900704.1.81192 WP_003900704.1.812 WP_003900704.1.81230 WP_003900704.1.81249 WP_003900704.1.81250 WP_003900704.1.8128 WP_003900704.1.81287 WP_003900704.1.81297 WP_003900704.1.8138 WP_003900704.1.81407 WP_003900704.1.8143 WP_003900704.1.81465 WP_003900704.1.81529 WP_003900704.1.81538 WP_003900704.1.81541 WP_003900704.1.81560 WP_003900704.1.81561 WP_003900704.1.81567 WP_003900704.1.81583 WP_003900704.1.81686 WP_003900704.1.81712 WP_003900704.1.81720 WP_003900704.1.81731 WP_003900704.1.81774 WP_003900704.1.81788 WP_003900704.1.81809 WP_003900704.1.81820 WP_003900704.1.81850 WP_003900704.1.81883 WP_003900704.1.81891 WP_003900704.1.81911 WP_003900704.1.81918 WP_003900704.1.82011 WP_003900704.1.82048 WP_003900704.1.82069 WP_003900704.1.82071 WP_003900704.1.82108 WP_003900704.1.82136 WP_003900704.1.82142 WP_003900704.1.8215 WP_003900704.1.82158 WP_003900704.1.8217 WP_003900704.1.82209 WP_003900704.1.82210 WP_003900704.1.82228 WP_003900704.1.82236 WP_003900704.1.82251 WP_003900704.1.82271 WP_003900704.1.82305 WP_003900704.1.82307 WP_003900704.1.82317 WP_003900704.1.8232 WP_003900704.1.82346 WP_003900704.1.82374 WP_003900704.1.82385 WP_003900704.1.82429 WP_003900704.1.82460 WP_003900704.1.82462 WP_003900704.1.82483 WP_003900704.1.82494 WP_003900704.1.82531 WP_003900704.1.82546 WP_003900704.1.82549 WP_003900704.1.82577 WP_003900704.1.82592 WP_003900704.1.82597 WP_003900704.1.82625 WP_003900704.1.82642 WP_003900704.1.82651 WP_003900704.1.82653 WP_003900704.1.82681 WP_003900704.1.82685 WP_003900704.1.8271 WP_003900704.1.82712 WP_003900704.1.8273 WP_003900704.1.82743 WP_003900704.1.82757 WP_003900704.1.82774 WP_003900704.1.82803 WP_003900704.1.82860 WP_003900704.1.82871 WP_003900704.1.82892 WP_003900704.1.82935 WP_003900704.1.82957 WP_003900704.1.82973 WP_003900704.1.82981 WP_003900704.1.82983 WP_003900704.1.83004 WP_003900704.1.83009 WP_003900704.1.83044 WP_003900704.1.83074 WP_003900704.1.83110 WP_003900704.1.83146 WP_003900704.1.83149 WP_003900704.1.83159 WP_003900704.1.8317 WP_003900704.1.83173 WP_003900704.1.83181 WP_003900704.1.83182 WP_003900704.1.83191 WP_003900704.1.83197 WP_003900704.1.83212 WP_003900704.1.8326 WP_003900704.1.83262 WP_003900704.1.83268 WP_003900704.1.83273 WP_003900704.1.83309 WP_003900704.1.83332 WP_003900704.1.83334 WP_003900704.1.83341 WP_003900704.1.83349 WP_003900704.1.8335 WP_003900704.1.83353 WP_003900704.1.83367 WP_003900704.1.83380 WP_003900704.1.83381 WP_003900704.1.83389 WP_003900704.1.83408 WP_003900704.1.83409 WP_003900704.1.83435 WP_003900704.1.83470 WP_003900704.1.83524 WP_003900704.1.83526 WP_003900704.1.8358 WP_003900704.1.83589 WP_003900704.1.83601 WP_003900704.1.83611 WP_003900704.1.83638 WP_003900704.1.83648 WP_003900704.1.83656 WP_003900704.1.83667 WP_003900704.1.83689 WP_003900704.1.83692 WP_003900704.1.83704 WP_003900704.1.83766 WP_003900704.1.83793 WP_003900704.1.83794 WP_003900704.1.83802 WP_003900704.1.83805 WP_003900704.1.83839 WP_003900704.1.83842 WP_003900704.1.83850 WP_003900704.1.83861 WP_003900704.1.83884 WP_003900704.1.83920 WP_003900704.1.83929 WP_003900704.1.83930 WP_003900704.1.83975 WP_003900704.1.83991 WP_003900704.1.8400 WP_003900704.1.84027 WP_003900704.1.8404 WP_003900704.1.84057 WP_003900704.1.84070 WP_003900704.1.8409 WP_003900704.1.84112 WP_003900704.1.84146 WP_003900704.1.8415 WP_003900704.1.84176 WP_003900704.1.84186 WP_003900704.1.84192 WP_003900704.1.84228 WP_003900704.1.8424 WP_003900704.1.84244 WP_003900704.1.84259 WP_003900704.1.8426 WP_003900704.1.84277 WP_003900704.1.84287 WP_003900704.1.8434 WP_003900704.1.84388 WP_003900704.1.84408 WP_003900704.1.84409 WP_003900704.1.84438 WP_003900704.1.84460 WP_003900704.1.84488 WP_003900704.1.84504 WP_003900704.1.84525 WP_003900704.1.84620 WP_003900704.1.84623 WP_003900704.1.84641 WP_003900704.1.84655 WP_003900704.1.84666 WP_003900704.1.84670 WP_003900704.1.84739 WP_003900704.1.84748 WP_003900704.1.84766 WP_003900704.1.84772 WP_003900704.1.84774 WP_003900704.1.848 WP_003900704.1.84836 WP_003900704.1.84839 WP_003900704.1.84846 WP_003900704.1.84873 WP_003900704.1.84938 WP_003900704.1.84968 WP_003900704.1.84973 WP_003900704.1.84981 WP_003900704.1.8503 WP_003900704.1.85038 WP_003900704.1.85041 WP_003900704.1.85043 WP_003900704.1.8505 WP_003900704.1.85074 WP_003900704.1.8509 WP_003900704.1.8512 WP_003900704.1.85148 WP_003900704.1.8518 WP_003900704.1.8522 WP_003900704.1.85242 WP_003900704.1.85276 WP_003900704.1.85281 WP_003900704.1.85284 WP_003900704.1.85314 WP_003900704.1.85319 WP_003900704.1.85330 WP_003900704.1.85341 WP_003900704.1.85346 WP_003900704.1.8535 WP_003900704.1.85363 WP_003900704.1.85371 WP_003900704.1.85377 WP_003900704.1.85387 WP_003900704.1.85399 WP_003900704.1.85458 WP_003900704.1.8546 WP_003900704.1.85464 WP_003900704.1.85478 WP_003900704.1.85480 WP_003900704.1.85488 WP_003900704.1.85495 WP_003900704.1.85551 WP_003900704.1.85557 WP_003900704.1.85577 WP_003900704.1.85597 WP_003900704.1.85599 WP_003900704.1.85610 WP_003900704.1.8563 WP_003900704.1.85648 WP_003900704.1.85679 WP_003900704.1.85704 WP_003900704.1.85727 WP_003900704.1.85737 WP_003900704.1.85763 WP_003900704.1.85808 WP_003900704.1.85819 WP_003900704.1.85820 WP_003900704.1.85823 WP_003900704.1.85832 WP_003900704.1.8586 WP_003900704.1.85872 WP_003900704.1.85894 WP_003900704.1.85913 WP_003900704.1.85953 WP_003900704.1.85986 WP_003900704.1.86000 WP_003900704.1.86024 WP_003900704.1.86025 WP_003900704.1.86032 WP_003900704.1.86048 WP_003900704.1.86052 WP_003900704.1.86067 WP_003900704.1.86103 WP_003900704.1.86122 WP_003900704.1.86124 WP_003900704.1.86160 WP_003900704.1.86164 WP_003900704.1.86168 WP_003900704.1.86190 WP_003900704.1.86204 WP_003900704.1.86208 WP_003900704.1.86235 WP_003900704.1.86249 WP_003900704.1.86260 WP_003900704.1.86290 WP_003900704.1.863 WP_003900704.1.86327 WP_003900704.1.86334 WP_003900704.1.86337 WP_003900704.1.86368 WP_003900704.1.86377 WP_003900704.1.86425 WP_003900704.1.86459 WP_003900704.1.8649 WP_003900704.1.86499 WP_003900704.1.86520 WP_003900704.1.86561 WP_003900704.1.86568 WP_003900704.1.86575 WP_003900704.1.86584 WP_003900704.1.86605 WP_003900704.1.86626 WP_003900704.1.86648 WP_003900704.1.8666 WP_003900704.1.86684 WP_003900704.1.86696 WP_003900704.1.86705 WP_003900704.1.86718 WP_003900704.1.86725 WP_003900704.1.86757 WP_003900704.1.86766 WP_003900704.1.86801 WP_003900704.1.86814 WP_003900704.1.86820 WP_003900704.1.86825 WP_003900704.1.86834 WP_003900704.1.8685 WP_003900704.1.86851 WP_003900704.1.86855 WP_003900704.1.86867 WP_003900704.1.86877 WP_003900704.1.86883 WP_003900704.1.8689 WP_003900704.1.86892 WP_003900704.1.86933 WP_003900704.1.86941 WP_003900704.1.86950 WP_003900704.1.86962 WP_003900704.1.86963 WP_003900704.1.86979 WP_003900704.1.8700 WP_003900704.1.87001 WP_003900704.1.87002 WP_003900704.1.87031 WP_003900704.1.87116 WP_003900704.1.87117 WP_003900704.1.8714 WP_003900704.1.87178 WP_003900704.1.87191 WP_003900704.1.87201 WP_003900704.1.87209 WP_003900704.1.87240 WP_003900704.1.87266 WP_003900704.1.87273 WP_003900704.1.87275 WP_003900704.1.8733 WP_003900704.1.87345 WP_003900704.1.8737 WP_003900704.1.87401 WP_003900704.1.87404 WP_003900704.1.87406 WP_003900704.1.87409 WP_003900704.1.87444 WP_003900704.1.87446 WP_003900704.1.87459 WP_003900704.1.87472 WP_003900704.1.87489 WP_003900704.1.87494 WP_003900704.1.87496 WP_003900704.1.87582 WP_003900704.1.87588 WP_003900704.1.87617 WP_003900704.1.87619 WP_003900704.1.87620 WP_003900704.1.87634 WP_003900704.1.87643 WP_003900704.1.8765 WP_003900704.1.87650 WP_003900704.1.87654 WP_003900704.1.87658 WP_003900704.1.87665 WP_003900704.1.87676 WP_003900704.1.87677 WP_003900704.1.87684 WP_003900704.1.87692 WP_003900704.1.87707 WP_003900704.1.87732 WP_003900704.1.87784 WP_003900704.1.87796 WP_003900704.1.87809 WP_003900704.1.87817 WP_003900704.1.87827 WP_003900704.1.87831 WP_003900704.1.87835 WP_003900704.1.87837 WP_003900704.1.87866 WP_003900704.1.8789 WP_003900704.1.87911 WP_003900704.1.87924 WP_003900704.1.87951 WP_003900704.1.87956 WP_003900704.1.87991 WP_003900704.1.88 WP_003900704.1.88002 WP_003900704.1.88037 WP_003900704.1.88039 WP_003900704.1.88072 WP_003900704.1.88077 WP_003900704.1.88121 WP_003900704.1.88180 WP_003900704.1.88191 WP_003900704.1.88205 WP_003900704.1.88217 WP_003900704.1.88219 WP_003900704.1.88245 WP_003900704.1.88253 WP_003900704.1.88294 WP_003900704.1.88315 WP_003900704.1.88316 WP_003900704.1.88320 WP_003900704.1.88338 WP_003900704.1.8840 WP_003900704.1.88437 WP_003900704.1.88453 WP_003900704.1.88469 WP_003900704.1.88489 WP_003900704.1.88521 WP_003900704.1.88530 WP_003900704.1.88537 WP_003900704.1.88541 WP_003900704.1.88592 WP_003900704.1.88616 WP_003900704.1.88618 WP_003900704.1.8862 WP_003900704.1.88625 WP_003900704.1.88632 WP_003900704.1.88634 WP_003900704.1.88649 WP_003900704.1.8870 WP_003900704.1.88737 WP_003900704.1.88756 WP_003900704.1.888 WP_003900704.1.88824 WP_003900704.1.88886 WP_003900704.1.88965 WP_003900704.1.88985 WP_003900704.1.8902 WP_003900704.1.89025 WP_003900704.1.89041 WP_003900704.1.89046 WP_003900704.1.89082 WP_003900704.1.89162 WP_003900704.1.89168 WP_003900704.1.8917 WP_003900704.1.89193 WP_003900704.1.89205 WP_003900704.1.89207 WP_003900704.1.89225 WP_003900704.1.8925 WP_003900704.1.89277 WP_003900704.1.89286 WP_003900704.1.89293 WP_003900704.1.89320 WP_003900704.1.89371 WP_003900704.1.89378 WP_003900704.1.89392 WP_003900704.1.89406 WP_003900704.1.8943 WP_003900704.1.89451 WP_003900704.1.89453 WP_003900704.1.89473 WP_003900704.1.89475 WP_003900704.1.89483 WP_003900704.1.895 WP_003900704.1.89513 WP_003900704.1.89517 WP_003900704.1.89522 WP_003900704.1.8954 WP_003900704.1.89543 WP_003900704.1.89567 WP_003900704.1.8957 WP_003900704.1.89572 WP_003900704.1.89589 WP_003900704.1.89607 WP_003900704.1.89613 WP_003900704.1.89625 WP_003900704.1.89648 WP_003900704.1.8967 WP_003900704.1.89670 WP_003900704.1.89676 WP_003900704.1.89729 WP_003900704.1.89739 WP_003900704.1.89762 WP_003900704.1.8977 WP_003900704.1.89808 WP_003900704.1.89829 WP_003900704.1.89831 WP_003900704.1.89844 WP_003900704.1.89849 WP_003900704.1.8989 WP_003900704.1.89901 WP_003900704.1.89903 WP_003900704.1.89909 WP_003900704.1.89922 WP_003900704.1.89926 WP_003900704.1.89963 WP_003900704.1.89971 WP_003900704.1.8998 WP_003900704.1.900 WP_003900704.1.90048 WP_003900704.1.9007 WP_003900704.1.90080 WP_003900704.1.90130 WP_003900704.1.90134 WP_003900704.1.90137 WP_003900704.1.90157 WP_003900704.1.90184 WP_003900704.1.90199 WP_003900704.1.90231 WP_003900704.1.90245 WP_003900704.1.90308 WP_003900704.1.90322 WP_003900704.1.90328 WP_003900704.1.90372 WP_003900704.1.90439 WP_003900704.1.90481 WP_003900704.1.90499 WP_003900704.1.9050 WP_003900704.1.90527 WP_003900704.1.90550 WP_003900704.1.90560 WP_003900704.1.90640 WP_003900704.1.90672 WP_003900704.1.90691 WP_003900704.1.90711 WP_003900704.1.90722 WP_003900704.1.9075 WP_003900704.1.90756 WP_003900704.1.90767 WP_003900704.1.90771 WP_003900704.1.90785 WP_003900704.1.90788 WP_003900704.1.90800 WP_003900704.1.90810 WP_003900704.1.90816 WP_003900704.1.90819 WP_003900704.1.9082 WP_003900704.1.90884 WP_003900704.1.90899 WP_003900704.1.90906 WP_003900704.1.90958 WP_003900704.1.90976 WP_003900704.1.90977 WP_003900704.1.9102 WP_003900704.1.91026 WP_003900704.1.91032 WP_003900704.1.91043 WP_003900704.1.91053 WP_003900704.1.91082 WP_003900704.1.91106 WP_003900704.1.91112 WP_003900704.1.91144 WP_003900704.1.91151 WP_003900704.1.91157 WP_003900704.1.91167 WP_003900704.1.91169 WP_003900704.1.91192 WP_003900704.1.91201 WP_003900704.1.91207 WP_003900704.1.91208 WP_003900704.1.91211 WP_003900704.1.91214 WP_003900704.1.91230 WP_003900704.1.91244 WP_003900704.1.91251 WP_003900704.1.91260 WP_003900704.1.91265 WP_003900704.1.9128 WP_003900704.1.91284 WP_003900704.1.91294 WP_003900704.1.91303 WP_003900704.1.91322 WP_003900704.1.91352 WP_003900704.1.91386 WP_003900704.1.9139 WP_003900704.1.91398 WP_003900704.1.91411 WP_003900704.1.91430 WP_003900704.1.91436 WP_003900704.1.91483 WP_003900704.1.91496 WP_003900704.1.91507 WP_003900704.1.91508 WP_003900704.1.91576 WP_003900704.1.91589 WP_003900704.1.91694 WP_003900704.1.91713 WP_003900704.1.91716 WP_003900704.1.91717 WP_003900704.1.91728 WP_003900704.1.91759 WP_003900704.1.91784 WP_003900704.1.91785 WP_003900704.1.91786 WP_003900704.1.91802 WP_003900704.1.91822 WP_003900704.1.91828 WP_003900704.1.9189 WP_003900704.1.91896 WP_003900704.1.9190 WP_003900704.1.91915 WP_003900704.1.91931 WP_003900704.1.91937 WP_003900704.1.91944 WP_003900704.1.91953 WP_003900704.1.91957 WP_003900704.1.91976 WP_003900704.1.91978 WP_003900704.1.92021 WP_003900704.1.92083 WP_003900704.1.92127 WP_003900704.1.92144 WP_003900704.1.92150 WP_003900704.1.92153 WP_003900704.1.92190 WP_003900704.1.92192 WP_003900704.1.92200 WP_003900704.1.92220 WP_003900704.1.92221 WP_003900704.1.92222 WP_003900704.1.92273 WP_003900704.1.92289 WP_003900704.1.9229 WP_003900704.1.92294 WP_003900704.1.92300 WP_003900704.1.92317 WP_003900704.1.92334 WP_003900704.1.92338 WP_003900704.1.92345 WP_003900704.1.92356 WP_003900704.1.92364 WP_003900704.1.92380 WP_003900704.1.92428 WP_003900704.1.92447 WP_003900704.1.92456 WP_003900704.1.92467 WP_003900704.1.92471 WP_003900704.1.92490 WP_003900704.1.92508 WP_003900704.1.9251 WP_003900704.1.92511 WP_003900704.1.92523 WP_003900704.1.92527 WP_003900704.1.92536 WP_003900704.1.92592 WP_003900704.1.92603 WP_003900704.1.92606 WP_003900704.1.92610 WP_003900704.1.92613 WP_003900704.1.9263 WP_003900704.1.9265 WP_003900704.1.92650 WP_003900704.1.92660 WP_003900704.1.92677 WP_003900704.1.92685 WP_003900704.1.92689 WP_003900704.1.92690 WP_003900704.1.92714 WP_003900704.1.92736 WP_003900704.1.9274 WP_003900704.1.92752 WP_003900704.1.92760 WP_003900704.1.92777 WP_003900704.1.92803 WP_003900704.1.92833 WP_003900704.1.92856 WP_003900704.1.92881 WP_003900704.1.92892 WP_003900704.1.92907 WP_003900704.1.92908 WP_003900704.1.9291 WP_003900704.1.92917 WP_003900704.1.92996 WP_003900704.1.93006 WP_003900704.1.93008 WP_003900704.1.93015 WP_003900704.1.93043 WP_003900704.1.9307 WP_003900704.1.93083 WP_003900704.1.93137 WP_003900704.1.93192 WP_003900704.1.93199 WP_003900704.1.93203 WP_003900704.1.93212 WP_003900704.1.93234 WP_003900704.1.93245 WP_003900704.1.93265 WP_003900704.1.93297 WP_003900704.1.93320 WP_003900704.1.93328 WP_003900704.1.93337 WP_003900704.1.93343 WP_003900704.1.93349 WP_003900704.1.93363 WP_003900704.1.93377 WP_003900704.1.9338 WP_003900704.1.93407 WP_003900704.1.93417 WP_003900704.1.93419 WP_003900704.1.93426 WP_003900704.1.9344 WP_003900704.1.93443 WP_003900704.1.93447 WP_003900704.1.93470 WP_003900704.1.93483 WP_003900704.1.93487 WP_003900704.1.93495 WP_003900704.1.93499 WP_003900704.1.93516 WP_003900704.1.93536 WP_003900704.1.93544 WP_003900704.1.93555 WP_003900704.1.93560 WP_003900704.1.93564 WP_003900704.1.9357 WP_003900704.1.93573 WP_003900704.1.93576 WP_003900704.1.93588 WP_003900704.1.9363 WP_003900704.1.93645 WP_003900704.1.93649 WP_003900704.1.93659 WP_003900704.1.93677 WP_003900704.1.9368 WP_003900704.1.93689 WP_003900704.1.93693 WP_003900704.1.93698 WP_003900704.1.93706 WP_003900704.1.9371 WP_003900704.1.93792 WP_003900704.1.93823 WP_003900704.1.93871 WP_003900704.1.9388 WP_003900704.1.93894 WP_003900704.1.93903 WP_003900704.1.93907 WP_003900704.1.93913 WP_003900704.1.93946 WP_003900704.1.93950 WP_003900704.1.93953 WP_003900704.1.93954 WP_003900704.1.93988 WP_003900704.1.9407 WP_003900704.1.94143 WP_003900704.1.94154 WP_003900704.1.94204 WP_003900704.1.94205 WP_003900704.1.94226 WP_003900704.1.94231 WP_003900704.1.94256 WP_003900704.1.94261 WP_003900704.1.94281 WP_003900704.1.94292 WP_003900704.1.94297 WP_003900704.1.9431 WP_003900704.1.94326 WP_003900704.1.94339 WP_003900704.1.94392 WP_003900704.1.94416 WP_003900704.1.94421 WP_003900704.1.94456 WP_003900704.1.94480 WP_003900704.1.94495 WP_003900704.1.94511 WP_003900704.1.94512 WP_003900704.1.94525 WP_003900704.1.94528 WP_003900704.1.94564 WP_003900704.1.946 WP_003900704.1.94602 WP_003900704.1.94623 WP_003900704.1.94629 WP_003900704.1.9465 WP_003900704.1.94673 WP_003900704.1.94714 WP_003900704.1.94730 WP_003900704.1.94736 WP_003900704.1.94776 WP_003900704.1.9478 WP_003900704.1.94834 WP_003900704.1.94852 WP_003900704.1.94872 WP_003900704.1.9488 WP_003900704.1.94902 WP_003900704.1.94916 WP_003900704.1.94979 WP_003900704.1.94994 WP_003900704.1.94996 WP_003900704.1.94998 WP_003900704.1.95007 WP_003900704.1.95015 WP_003900704.1.95034 WP_003900704.1.95068 WP_003900704.1.95081 WP_003900704.1.95082 WP_003900704.1.95096 WP_003900704.1.95112 WP_003900704.1.95138 WP_003900704.1.95179 WP_003900704.1.95188 WP_003900704.1.95190 WP_003900704.1.95234 WP_003900704.1.95241 WP_003900704.1.95245 WP_003900704.1.95257 WP_003900704.1.95279 WP_003900704.1.9531 WP_003900704.1.95335 WP_003900704.1.9535 WP_003900704.1.95370 WP_003900704.1.95392 WP_003900704.1.95416 WP_003900704.1.95417 WP_003900704.1.95454 WP_003900704.1.95455 WP_003900704.1.95491 WP_003900704.1.95497 WP_003900704.1.95508 WP_003900704.1.95509 WP_003900704.1.95529 WP_003900704.1.95556 WP_003900704.1.95557 WP_003900704.1.95565 WP_003900704.1.95578 WP_003900704.1.95580 WP_003900704.1.95585 WP_003900704.1.95679 WP_003900704.1.95685 WP_003900704.1.957 WP_003900704.1.95724 WP_003900704.1.95727 WP_003900704.1.95730 WP_003900704.1.95735 WP_003900704.1.95758 WP_003900704.1.95772 WP_003900704.1.95839 WP_003900704.1.9585 WP_003900704.1.9590 WP_003900704.1.95902 WP_003900704.1.95908 WP_003900704.1.95924 WP_003900704.1.95926 WP_003900704.1.95953 WP_003900704.1.95958 WP_003900704.1.95964 WP_003900704.1.95973 WP_003900704.1.96006 WP_003900704.1.9602 WP_003900704.1.96036 WP_003900704.1.96062 WP_003900704.1.96065 WP_003900704.1.96098 WP_003900704.1.96146 WP_003900704.1.96171 WP_003900704.1.96204 WP_003900704.1.96230 WP_003900704.1.96235 WP_003900704.1.96242 WP_003900704.1.96245 WP_003900704.1.96254 WP_003900704.1.96259 WP_003900704.1.96286 WP_003900704.1.96313 WP_003900704.1.96318 WP_003900704.1.96345 WP_003900704.1.96360 WP_003900704.1.96373 WP_003900704.1.96456 WP_003900704.1.96486 WP_003900704.1.96560 WP_003900704.1.96569 WP_003900704.1.96573 WP_003900704.1.96575 WP_003900704.1.96576 WP_003900704.1.96611 WP_003900704.1.96621 WP_003900704.1.96726 WP_003900704.1.96733 WP_003900704.1.96742 WP_003900704.1.96754 WP_003900704.1.9678 WP_003900704.1.96832 WP_003900704.1.9685 WP_003900704.1.97008 WP_003900704.1.97009 WP_003900704.1.97056 WP_003900704.1.97084 WP_003900704.1.97087 WP_003900704.1.97094 WP_003900704.1.97096 WP_003900704.1.97099 WP_003900704.1.97108 WP_003900704.1.97113 WP_003900704.1.97122 WP_003900704.1.97127 WP_003900704.1.97129 WP_003900704.1.97136 WP_003900704.1.9716 WP_003900704.1.97176 WP_003900704.1.97222 WP_003900704.1.97223 WP_003900704.1.97237 WP_003900704.1.97242 WP_003900704.1.97270 WP_003900704.1.97283 WP_003900704.1.97296 WP_003900704.1.97321 WP_003900704.1.97330 WP_003900704.1.97366 WP_003900704.1.97376 WP_003900704.1.97380 WP_003900704.1.9739 WP_003900704.1.97462 WP_003900704.1.97517 WP_003900704.1.97535 WP_003900704.1.97540 WP_003900704.1.97545 WP_003900704.1.97546 WP_003900704.1.97550 WP_003900704.1.97577 WP_003900704.1.97584 WP_003900704.1.9759 WP_003900704.1.97591 WP_003900704.1.97596 WP_003900704.1.97609 WP_003900704.1.97618 WP_003900704.1.9763 WP_003900704.1.97669 WP_003900704.1.97673 WP_003900704.1.97700 WP_003900704.1.97701 WP_003900704.1.9773 WP_003900704.1.97730 WP_003900704.1.97740 WP_003900704.1.97751 WP_003900704.1.97754 WP_003900704.1.97797 WP_003900704.1.9782 WP_003900704.1.9784 WP_003900704.1.97888 WP_003900704.1.9795 WP_003900704.1.97951 WP_003900704.1.97958 WP_003900704.1.97977 WP_003900704.1.97979 WP_003900704.1.97995 WP_003900704.1.98018 WP_003900704.1.98034 WP_003900704.1.98052 WP_003900704.1.98071 WP_003900704.1.98072 WP_003900704.1.98113 WP_003900704.1.98114 WP_003900704.1.98128 WP_003900704.1.98181 WP_003900704.1.98188 WP_003900704.1.98189 WP_003900704.1.98213 WP_003900704.1.98225 WP_003900704.1.98291 WP_003900704.1.98335 WP_003900704.1.98350 WP_003900704.1.98395 WP_003900704.1.98412 WP_003900704.1.98441 WP_003900704.1.98443 WP_003900704.1.98462 WP_003900704.1.9848 WP_003900704.1.98482 WP_003900704.1.98486 WP_003900704.1.98488 WP_003900704.1.98503 WP_003900704.1.98516 WP_003900704.1.98524 WP_003900704.1.98536 WP_003900704.1.98541 WP_003900704.1.98566 WP_003900704.1.98576 WP_003900704.1.98590 WP_003900704.1.98594 WP_003900704.1.98599 WP_003900704.1.98629 WP_003900704.1.98646 WP_003900704.1.98649 WP_003900704.1.98656 WP_003900704.1.9867 WP_003900704.1.98674 WP_003900704.1.98697 WP_003900704.1.98701 WP_003900704.1.98739 WP_003900704.1.98749 WP_003900704.1.98770 WP_003900704.1.98777 WP_003900704.1.98778 WP_003900704.1.98838 WP_003900704.1.98850 WP_003900704.1.98906 WP_003900704.1.98935 WP_003900704.1.98948 WP_003900704.1.98953 WP_003900704.1.98984 WP_003900704.1.99000 WP_003900704.1.99030 WP_003900704.1.99037 WP_003900704.1.99055 WP_003900704.1.99062 WP_003900704.1.99086 WP_003900704.1.99115 WP_003900704.1.99117 WP_003900704.1.99161 WP_003900704.1.99176 WP_003900704.1.99205 WP_003900704.1.99211 WP_003900704.1.99216 WP_003900704.1.99222 WP_003900704.1.99251 WP_003900704.1.99269 WP_003900704.1.99294 WP_003900704.1.99312 WP_003900704.1.99315 WP_003900704.1.99316 WP_003900704.1.99322 WP_003900704.1.99328 WP_003900704.1.99365 WP_003900704.1.99368 WP_003900704.1.99396 WP_003900704.1.99402 WP_003900704.1.99404 WP_003900704.1.99419 WP_003900704.1.99438 WP_003900704.1.99468 WP_003900704.1.99473 WP_003900704.1.99513 WP_003900704.1.99529 WP_003900704.1.99548 WP_003900704.1.99572 WP_003900704.1.99575 WP_003900704.1.99578 WP_003900704.1.99605 WP_003900704.1.99609 WP_003900704.1.99617 WP_003900704.1.99635 WP_003900704.1.99650 WP_003900704.1.99672 WP_003900704.1.99701 WP_003900704.1.99711 WP_003900704.1.99716 WP_003900704.1.99740 WP_003900704.1.99745 WP_003900704.1.99749 WP_003900704.1.9976 WP_003900704.1.99798 WP_003900704.1.99817 WP_003900704.1.99832 WP_003900704.1.99847 WP_003900704.1.99852 WP_003900704.1.99886 WP_003900704.1.99897 WP_003900704.1.99899 WP_003900704.1.99915 WP_003900704.1.9993 WP_003900704.1.99982 WP_003900704.1.99991 gi|494701924|ref|YP_007967406.1| gi|506928073|ref|YP_008008523.1| gi|375297741|ref|YP_005102008.1| gi|479057464|ref|YP_007353270.1| gi|224991886|ref|YP_002646575.1| gi|449065581|ref|YP_007432664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]