SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|401762589|ref|YP_006577596.1| from Enterobacter cloacae subsp. cloacae ENHKU01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|401762589|ref|YP_006577596.1|
Domain Number 1 Region: 96-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000484
Family NfeD domain-like 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|401762589|ref|YP_006577596.1|
Domain Number - Region: 33-76
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00785
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|401762589|ref|YP_006577596.1|
Sequence length 150
Comment nodulation efficiency family protein [Enterobacter cloacae subsp. cloacae ENHKU01]
Sequence
MIELIVAHPHAFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWILPLDWAWQGALF
AVLTLVAAWLWWRWLNRQVNEQKPLDAHLNQRGQQIVGKRFTLDTPLVNGRGHMRVGDSS
WPVVADDDLSAGTRVEVIAVEGITLRVKAC
Download sequence
Identical sequences A0A0F0Y4T7
gi|401762589|ref|YP_006577596.1| WP_014882823.1.18398 WP_014882823.1.19825 WP_014882823.1.31942 WP_014882823.1.43860 WP_014882823.1.70186 WP_014882823.1.7722 WP_014882823.1.86567 WP_014882823.1.9304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]