SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|401765298|ref|YP_006580305.1| from Enterobacter cloacae subsp. cloacae ENHKU01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|401765298|ref|YP_006580305.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.14e-106
Family FMN-linked oxidoreductases 0.0000000000502
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.41e-39
Family N-terminal domain of adrenodoxin reductase-like 0.00000127
Further Details:      
 
Domain Number 3 Region: 461-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.61e-24
Family C-terminal domain of adrenodoxin reductase-like 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|401765298|ref|YP_006580305.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Enterobacter cloacae subsp. cloacae ENHKU01]
Sequence
MSRYPSLFAPLDLGFTTLKNRVLMGSMHTGLEERPDGAERLAAFYAERSRHGVALIVTGG
VAPASSGVTMEGGAVLNDASQLAHHRIVTDAVHKEGGKIALQILHTGRYSYQPKLVAPSA
IQAPINRFTPHALSHDEIIALIDDFARCAALAREAGYDGVEVMGSEGYLINEFLAARTNQ
REDEWGGDYVRRMRFAVEVVRAVRERTGTDFIIIFRLSMLDLVEGGGTFDETVQLAQAIE
AAGATLINTGIGWHEARIPTIATPVPRAAFSWVTRKLKGKVSVPLVTTNRINDPQVADDV
ISRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPR
ACHETKMPVVPAASIKRLAVVGAGPAGLAFAVNAASRGHSVTLFDAAGEIGGQFNIAKQI
PGKEEFYETLRYYRRMIDLTGVELRLNQFVSAADLIGFDEVILASGIVPRTPAIAGIDHP
KVLSYLDVLRDKVPVGKSVAIIGCGGIGFDTAMYLSQPGEATSQNIAEFCVEWGIDTSLS
QSGGLRPEGPQLPKSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLSRGVKMIPAVSYEK
IDDEGLHVTIGGEPQLLRVDHVILCAGQEPRRDLADPLREAGRTVHLIGGCDVAMELDAR
RAIAQGTKLALAI
Download sequence
Identical sequences WP_014885316.1.18398 WP_014885316.1.19825 WP_014885316.1.31942 WP_014885316.1.43860 WP_014885316.1.70186 WP_014885316.1.86567 WP_014885316.1.9304 gi|401765298|ref|YP_006580305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]