SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479157434|ref|YP_007787029.1| from [Ruminococcus] torques

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479157434|ref|YP_007787029.1|
Domain Number 1 Region: 1-284
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.14e-93
Family Methylenetetrahydrofolate reductase 0.000000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479157434|ref|YP_007787029.1|
Sequence length 289
Comment 5,10-methylenetetrahydrofolate reductase, prokaryotic form [Ruminococcus torques L2-14]
Sequence
MKIIDKLNQKGIHISFEVFPPKTDAGFDKVLSATDEIAKLNPSYISVTYGAGGGTSKNTA
KIASHIKDDLGVMSLAHLTCASSTKEEVGEVIENLKAHGIENILALRGDIPEGMTFPDGD
RFHYAYELVQEIKKHGDFCIGAACYPEGHVEQEHKEDDIRYLKQKVDSGVDFLTTQMFFD
NDIHYNFLYRIREAGITVPVLPGIMPITSAAQMKRSQELSGTVFPRRFLAILDRFGSSPE
AMKQAGIAYATDQIIDLLANGVNNIHIYSMNKPEIAIAIMNNLSEIIKC
Download sequence
Identical sequences D4M5K9 R6Q152
WP_015529109.1.67896 WP_015529109.1.92070 gi|479157434|ref|YP_007787029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]