SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479157488|ref|YP_007787083.1| from [Ruminococcus] torques

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479157488|ref|YP_007787083.1|
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily L28p-like 1.79e-19
Family Ribosomal protein L28 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479157488|ref|YP_007787083.1|
Sequence length 61
Comment LSU ribosomal protein L28P [Ruminococcus torques L2-14]
Sequence
MAKCAICEKGAHFGNNVSHSHRRSPKMWKSNVKSVRVKTEGGSQKMYVCTSCLRSGLVER
A
Download sequence
Identical sequences A0A174XV64 A0A1Q6JGT5 D4M5R3 R6Q460
WP_015529161.1.15757 WP_015529161.1.50932 WP_015529161.1.67896 WP_015529161.1.92070 gi|479157488|ref|YP_007787083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]