SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479157734|ref|YP_007787329.1| from [Ruminococcus] torques

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479157734|ref|YP_007787329.1|
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.02e-41
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479157734|ref|YP_007787329.1|
Sequence length 152
Comment PTS system, fructose subfamily, IIA component [Ruminococcus torques L2-14]
Sequence
MGMADMIDERLVSFGLDVTNKEDAIRKICKMMYDAGKVSSYEDYLQGVKDRELEFETGMG
NGIAIPHCKGGCVKEAAFTLVKLNQKIEWGSLDGEPVDYVIMLAAPNTADNVHLKMLSSL
AVGLMDDDFREALKDATDVDQIIDIFKSKKEE
Download sequence
Identical sequences D4M6F9
gi|479157734|ref|YP_007787329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]