SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479157884|ref|YP_007787479.1| from [Ruminococcus] torques

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479157884|ref|YP_007787479.1|
Domain Number 1 Region: 26-58,934-1081
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000578
Family ABC transporter ATPase domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 11-108,224-269,304-381
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000984
Family ABC transporter ATPase domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 362-477
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000811
Family Apolipoprotein 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479157884|ref|YP_007787479.1|
Sequence length 1122
Comment hypothetical protein RTO_24920 [Ruminococcus torques L2-14]
Sequence
MKEKQSKKIFTRMLMNNWGGISHKVMEFHEYVNLFSGKSGSGKSTVMDAIQVVLYGSISS
TFLNKAADDAKNRRSVLSYLRGAQKDGSFNREDQDFCSQIVLEIKDTGKNTHTCIGVSFE
VGKADTDIRKYCFFSHSGKIPEDEYLTEEGVPYTIAKLKKLVEARIESADNRGRGDVNRV
YPSKEAYLKTVYDAIFGYVEPGRMMTMEKSAIALRMTNGTGQFIKDYMFPKSKEDTVATI
SDQLGAYREIKERVEDLEQRIKMLDEISQHNLALQKARADKIYVEQILKYIEIENCKAHL
QSKEDDLQDILKKIEEKEEKRKSYLAEKDAYTKEQVEVEAELKASDYGQKEKELKEIENT
IQLLATNSEQWRDIVKGLSAWEEDDEVSAYVSNQALHRIDDIRDGVVSEDSIEKLKQYLS
DALDNINTELGDVRERIRENQKELQEKREMVEDLKNDRKPYRAELKRARQELQNILSTQY
GRTIHVNIFADLFDITDEEWKNAIEGRMGRVKHSLVTAPEYTLDAAKAFRKMKQMKGIED
VELMDTAAIVRDKPNADENTLYECVRAEEAYVDTCLKRYLGRIKKCETVEELHETRDGVT
KDCYSYSNYIFRHLRKNDYEKYACIGTKVSKAKLLELEEEAAKLKQEVEEDCRVEMALRA
AQKFECLNQSTEQILHLSKAAEQLQDYYEKQEKLRLEVEELKRGDRTVELKKKKQELLEL
LKKNAEILDSIQSEVVQYAKTQGQIESNIKSFSEKINFLTEGFVVNEQLQNEVTDALKVQ
SEAAYKRDKTKEKDALETLEETEREELQRSRNKFNNAYPAYGFTGIEHENDVYDKVLNQC
RKDFEPKYKEEFDKQYNLVYYTLRENVIASIHGEIKAAYRHKKEINRLLAKIKFSDSIYQ
IDIIPAQNENGQFYEMLTAPELDSKVFDDYGFEGQLSLGEDEFYQKYEEDIKRLTEKFMP
PKEEDARSLSQYRQQMEQYVDYRNYLTFSMYEKVEDENGNIRKNAVDDMAGRDSGGEGQN
PKYVALLAGFAMLYMQQTNRDSKIRLVLLDEAFSKMDKERSEVCLHYARELELQLIVCVP
DERLQSLIRNVDCVYGFRRHQNQVSMMHIDKGDYLDMVEGNE
Download sequence
Identical sequences D4M6V9
gi|479157884|ref|YP_007787479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]