SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479156147|ref|YP_007785742.1| from [Ruminococcus] torques

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479156147|ref|YP_007785742.1|
Domain Number 1 Region: 5-277
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-76
Family G proteins 0.00000426
Further Details:      
 
Domain Number 2 Region: 476-594
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-41
Family Translational machinery components 0.0000226
Further Details:      
 
Domain Number 3 Region: 598-684
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.4e-26
Family EF-G/eEF-2 domains III and V 0.00022
Further Details:      
 
Domain Number 4 Region: 262-394
Classification Level Classification E-value
Superfamily Translation proteins 9.34e-26
Family Elongation factors 0.00078
Further Details:      
 
Domain Number 5 Region: 400-475
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000000302
Family EF-G/eEF-2 domains III and V 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479156147|ref|YP_007785742.1|
Sequence length 691
Comment translation elongation factor 2 (EF-2/EF-G) [Ruminococcus torques L2-14]
Sequence
MKVYRTDEIRNVVLLGHGGSGKTSLAEAMLYVSGATNRMGKISESNTVSDFDKEEQKRGF
SISTSLVPIEWEKAKINILDTPGYFDFVGEVEEAVSAADAAVIVVSGKAGVQVGTEKAWE
LCDKYNLPRMIYVTEMDVDDASFRQVVADLTERYGKKIAPHFQPIRENEKLVGYINIIKN
AGRRYTGIGQREECEIPDYCMPNLEILRDSLMEAVAETSEEFMERYFNGEEFSVEEIRAA
MRTEVMDGDIVPVAMGSNVQAQGVANLLSDIVRFFPSPDKRTCAGINRRTNEIFEANYDF
AKAKSAYVFKTMVDPFIGKYSFVKVCSGVLKGDDVLYNADTDAEEKPGKLYTMCGSKPSE
VTELFAGDIGAIGKLTNTRTGDTLSVKGTPVSYAKTDYSVPYTYMKYRVKNKGDEDKVSQ
ALARMTAEDVTLKAVNDSENRQSLLYGMGEQHLEIVASKLAARYKVEITLETPKVAFRET
IRKNSDVDSKYKKQSGGHGQYGHVKMKFEPSGDLETPFVFEECVVGGAVPKNYFPAVEKG
LQESVVKGPLAGYPVVGVKATLYDGSYHPVDSSEMAFKTATIQAFKKGFMEASPVLLEPI
ASLKVTVPDDYTGDIMGDLNKRRGRVLGMIPVAGGKQVIEADIPMTGLFGYCTTLRSMTG
GRGSYEYTFARYEQAPSDVQEKEIAARAEEA
Download sequence
Identical sequences D4M1X2
gi|479156147|ref|YP_007785742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]