SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340625969|ref|YP_004744421.1| from Mycobacterium canettii CIPT 140010059

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340625969|ref|YP_004744421.1|
Domain Number 1 Region: 14-212
Classification Level Classification E-value
Superfamily Formyltransferase 5.1e-54
Family Formyltransferase 0.0000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340625969|ref|YP_004744421.1|
Sequence length 215
Comment putative 5'-phosphoribosylglycinamide formyltransferase PURN [Mycobacterium canettii CIPT 140010059]
Sequence
MQEPLRVPPSAPARLVVLASGTGSLLRSLLDAAVGDYPARVVAVGVDRECRAAEIAAEAS
VPVFTVRLADHPSRDAWDVAITAATAAHEPDLVVSAGFMRILGPQFLSRFYGRTLNTHPA
LLPSFPGTHGVANALAYGVKVTGATVHLVDAGTDTGPILAQQPVPVLDGDDEETLHERIK
VTERRLLVAAVAALATHGVTVVGRTATMGRKVTIR
Download sequence
Identical sequences G0TG67
WP_014000520.1.45062 WP_014000520.1.60091 WP_014000520.1.71399 gi|433626045|ref|YP_007259674.1| gi|340625969|ref|YP_004744421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]