SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340626189|ref|YP_004744641.1| from Mycobacterium canettii CIPT 140010059

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340626189|ref|YP_004744641.1|
Domain Number 1 Region: 1-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.53e-105
Family FMN-linked oxidoreductases 0.0000000147
Further Details:      
 
Domain Number 2 Region: 335-517
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.85e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000219
Further Details:      
 
Domain Number 3 Region: 462-520,555-652
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.56e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340626189|ref|YP_004744641.1|
Sequence length 674
Comment putative NADPH dependent 2,4-DIenoyl-COA reductase FADH [Mycobacterium canettii CIPT 140010059]
Sequence
MTNPYPNLLSPLDLGFTTLRNRVVMGSMHTGLEDRARHIDRLADYFAERARGGVGLIITG
GYAPNRTGWLLPFASELVTSAQARRHRRITRAVHDSGAKILLQILHAGRYAYHPLAVSAS
PIKAPITPFRPRALSARGVEATIADFARCAQLARDAGYDGVEIMGSEGYLLNQFLAPRTN
KRTDSWGGTPANRRRFPVEIIRRSRAAVGSDFIICYRLSMADYVAEGQSWDEIVALATEV
EGAGATIINSGFGWHEARVPTIVTSVPGGAFVDISSAVAEHVTIPVVASNRINMPQAAER
ILAETQVRLISMARPMLSDPDWVLKAQSNRVDEINTCISCNQACLDHAFARKTVSCLLNP
RAGRETQLVLSPTRRARSVAVVGAGPAGLATAANAAQRGHRVTLFEANDFIGGQFDMARR
IPGKEEFSETIRYFSTILAKHGVEVRLGTRVAAQELTGYDEVVLATGVAPRIPAIPGIDH
PMVLTYAEAITGVRPVGRTVAVVGAGGIGFDVTELLVTDSSPTLNLKEWKAEWGVADPRE
ARGALTTPLPAPPAREVYLLQRTKGPQGKRLGKTTGWVHRASLKAKGVHQLSGVNYEQIN
DDGLHISFGPKRRRPQLLAVDNVVVCAGQEPVRDLESELRRHGINPHIIGGAAVAAELDA
KRAIKQGTELAARL
Download sequence
Identical sequences A0A045IZA6 A0A0H3L8N7 G0TH69 Q7D8P5
gi|253799781|ref|YP_003032782.1| gi|494699586|ref|YP_007965068.1| WP_003898755.1.100000 WP_003898755.1.100021 WP_003898755.1.100069 WP_003898755.1.100087 WP_003898755.1.10015 WP_003898755.1.100208 WP_003898755.1.100216 WP_003898755.1.100255 WP_003898755.1.100260 WP_003898755.1.100270 WP_003898755.1.100279 WP_003898755.1.100286 WP_003898755.1.100308 WP_003898755.1.100309 WP_003898755.1.10037 WP_003898755.1.100383 WP_003898755.1.100396 WP_003898755.1.1004 WP_003898755.1.100401 WP_003898755.1.100459 WP_003898755.1.100460 WP_003898755.1.100552 WP_003898755.1.100581 WP_003898755.1.100600 WP_003898755.1.100625 WP_003898755.1.10064 WP_003898755.1.100666 WP_003898755.1.100671 WP_003898755.1.100677 WP_003898755.1.100697 WP_003898755.1.100703 WP_003898755.1.100716 WP_003898755.1.100722 WP_003898755.1.100754 WP_003898755.1.100757 WP_003898755.1.100772 WP_003898755.1.1008 WP_003898755.1.100812 WP_003898755.1.100866 WP_003898755.1.10088 WP_003898755.1.100889 WP_003898755.1.10090 WP_003898755.1.100910 WP_003898755.1.100915 WP_003898755.1.100918 WP_003898755.1.100935 WP_003898755.1.100984 WP_003898755.1.100992 WP_003898755.1.100998 WP_003898755.1.101 WP_003898755.1.101048 WP_003898755.1.101054 WP_003898755.1.101075 WP_003898755.1.101143 WP_003898755.1.10116 WP_003898755.1.10117 WP_003898755.1.101209 WP_003898755.1.101290 WP_003898755.1.101323 WP_003898755.1.101324 WP_003898755.1.101350 WP_003898755.1.101403 WP_003898755.1.10144 WP_003898755.1.101442 WP_003898755.1.10145 WP_003898755.1.101456 WP_003898755.1.101481 WP_003898755.1.101496 WP_003898755.1.101535 WP_003898755.1.101553 WP_003898755.1.101558 WP_003898755.1.10156 WP_003898755.1.101573 WP_003898755.1.101576 WP_003898755.1.10159 WP_003898755.1.101592 WP_003898755.1.101604 WP_003898755.1.101607 WP_003898755.1.101644 WP_003898755.1.101671 WP_003898755.1.101687 WP_003898755.1.101698 WP_003898755.1.10170 WP_003898755.1.101713 WP_003898755.1.101743 WP_003898755.1.101764 WP_003898755.1.101773 WP_003898755.1.101797 WP_003898755.1.101798 WP_003898755.1.101802 WP_003898755.1.101836 WP_003898755.1.101859 WP_003898755.1.101862 WP_003898755.1.101888 WP_003898755.1.101894 WP_003898755.1.101899 WP_003898755.1.1019 WP_003898755.1.101923 WP_003898755.1.101925 WP_003898755.1.102 WP_003898755.1.102008 WP_003898755.1.102017 WP_003898755.1.102053 WP_003898755.1.102055 WP_003898755.1.102063 WP_003898755.1.102099 WP_003898755.1.10211 WP_003898755.1.102121 WP_003898755.1.102143 WP_003898755.1.10216 WP_003898755.1.10224 WP_003898755.1.10253 WP_003898755.1.10262 WP_003898755.1.10277 WP_003898755.1.1033 WP_003898755.1.10350 WP_003898755.1.10362 WP_003898755.1.10366 WP_003898755.1.10376 WP_003898755.1.10396 WP_003898755.1.10410 WP_003898755.1.10414 WP_003898755.1.10421 WP_003898755.1.10430 WP_003898755.1.10440 WP_003898755.1.10445 WP_003898755.1.10472 WP_003898755.1.105 WP_003898755.1.10518 WP_003898755.1.10545 WP_003898755.1.1057 WP_003898755.1.10594 WP_003898755.1.10603 WP_003898755.1.10606 WP_003898755.1.10615 WP_003898755.1.10623 WP_003898755.1.10635 WP_003898755.1.10643 WP_003898755.1.10648 WP_003898755.1.10662 WP_003898755.1.10735 WP_003898755.1.10756 WP_003898755.1.1078 WP_003898755.1.10799 WP_003898755.1.10825 WP_003898755.1.10848 WP_003898755.1.10863 WP_003898755.1.10879 WP_003898755.1.10916 WP_003898755.1.10927 WP_003898755.1.1095 WP_003898755.1.10956 WP_003898755.1.10962 WP_003898755.1.10980 WP_003898755.1.1100 WP_003898755.1.11040 WP_003898755.1.11061 WP_003898755.1.11175 WP_003898755.1.11176 WP_003898755.1.11222 WP_003898755.1.11236 WP_003898755.1.11329 WP_003898755.1.1133 WP_003898755.1.11342 WP_003898755.1.11373 WP_003898755.1.11390 WP_003898755.1.11402 WP_003898755.1.11487 WP_003898755.1.11489 WP_003898755.1.11514 WP_003898755.1.11589 WP_003898755.1.11604 WP_003898755.1.11610 WP_003898755.1.11697 WP_003898755.1.11707 WP_003898755.1.11752 WP_003898755.1.11758 WP_003898755.1.11761 WP_003898755.1.11822 WP_003898755.1.11826 WP_003898755.1.11856 WP_003898755.1.11898 WP_003898755.1.11906 WP_003898755.1.11939 WP_003898755.1.11972 WP_003898755.1.11984 WP_003898755.1.12001 WP_003898755.1.12049 WP_003898755.1.12052 WP_003898755.1.12100 WP_003898755.1.12116 WP_003898755.1.12161 WP_003898755.1.12165 WP_003898755.1.12184 WP_003898755.1.12190 WP_003898755.1.12216 WP_003898755.1.12265 WP_003898755.1.12293 WP_003898755.1.12294 WP_003898755.1.1231 WP_003898755.1.12314 WP_003898755.1.12327 WP_003898755.1.12338 WP_003898755.1.1236 WP_003898755.1.12371 WP_003898755.1.12372 WP_003898755.1.12406 WP_003898755.1.1241 WP_003898755.1.12446 WP_003898755.1.12479 WP_003898755.1.12519 WP_003898755.1.12526 WP_003898755.1.12550 WP_003898755.1.12551 WP_003898755.1.12563 WP_003898755.1.12669 WP_003898755.1.1267 WP_003898755.1.12692 WP_003898755.1.1271 WP_003898755.1.1279 WP_003898755.1.12804 WP_003898755.1.12821 WP_003898755.1.12841 WP_003898755.1.12854 WP_003898755.1.12871 WP_003898755.1.12901 WP_003898755.1.12941 WP_003898755.1.12947 WP_003898755.1.12957 WP_003898755.1.12972 WP_003898755.1.13028 WP_003898755.1.13043 WP_003898755.1.13086 WP_003898755.1.13087 WP_003898755.1.13090 WP_003898755.1.13096 WP_003898755.1.13163 WP_003898755.1.13175 WP_003898755.1.13183 WP_003898755.1.132 WP_003898755.1.13282 WP_003898755.1.13284 WP_003898755.1.13296 WP_003898755.1.13298 WP_003898755.1.13306 WP_003898755.1.13312 WP_003898755.1.13313 WP_003898755.1.13345 WP_003898755.1.13358 WP_003898755.1.13375 WP_003898755.1.1338 WP_003898755.1.13420 WP_003898755.1.13435 WP_003898755.1.13438 WP_003898755.1.13461 WP_003898755.1.13466 WP_003898755.1.13489 WP_003898755.1.13551 WP_003898755.1.13564 WP_003898755.1.13579 WP_003898755.1.13647 WP_003898755.1.13697 WP_003898755.1.13763 WP_003898755.1.1377 WP_003898755.1.13774 WP_003898755.1.13786 WP_003898755.1.13793 WP_003898755.1.13794 WP_003898755.1.13817 WP_003898755.1.13834 WP_003898755.1.13866 WP_003898755.1.13880 WP_003898755.1.13899 WP_003898755.1.13919 WP_003898755.1.13920 WP_003898755.1.13952 WP_003898755.1.13953 WP_003898755.1.1398 WP_003898755.1.13988 WP_003898755.1.14046 WP_003898755.1.14115 WP_003898755.1.1415 WP_003898755.1.14152 WP_003898755.1.14158 WP_003898755.1.14162 WP_003898755.1.14175 WP_003898755.1.14178 WP_003898755.1.14195 WP_003898755.1.14208 WP_003898755.1.14238 WP_003898755.1.14266 WP_003898755.1.14273 WP_003898755.1.14303 WP_003898755.1.14306 WP_003898755.1.14307 WP_003898755.1.14310 WP_003898755.1.14382 WP_003898755.1.14416 WP_003898755.1.14428 WP_003898755.1.14441 WP_003898755.1.14469 WP_003898755.1.14477 WP_003898755.1.14504 WP_003898755.1.14514 WP_003898755.1.1452 WP_003898755.1.14527 WP_003898755.1.1454 WP_003898755.1.14544 WP_003898755.1.14548 WP_003898755.1.14561 WP_003898755.1.1462 WP_003898755.1.14667 WP_003898755.1.14668 WP_003898755.1.14675 WP_003898755.1.14694 WP_003898755.1.14709 WP_003898755.1.14766 WP_003898755.1.14783 WP_003898755.1.14865 WP_003898755.1.14905 WP_003898755.1.14926 WP_003898755.1.14951 WP_003898755.1.14955 WP_003898755.1.15003 WP_003898755.1.15009 WP_003898755.1.15028 WP_003898755.1.15052 WP_003898755.1.15065 WP_003898755.1.15072 WP_003898755.1.15089 WP_003898755.1.1509 WP_003898755.1.15126 WP_003898755.1.15131 WP_003898755.1.15168 WP_003898755.1.15174 WP_003898755.1.15187 WP_003898755.1.15196 WP_003898755.1.15210 WP_003898755.1.15216 WP_003898755.1.15217 WP_003898755.1.1523 WP_003898755.1.15232 WP_003898755.1.15238 WP_003898755.1.15253 WP_003898755.1.15267 WP_003898755.1.15299 WP_003898755.1.15302 WP_003898755.1.15322 WP_003898755.1.1534 WP_003898755.1.15365 WP_003898755.1.15386 WP_003898755.1.15387 WP_003898755.1.15447 WP_003898755.1.15449 WP_003898755.1.15477 WP_003898755.1.15481 WP_003898755.1.15492 WP_003898755.1.15511 WP_003898755.1.15512 WP_003898755.1.15558 WP_003898755.1.15566 WP_003898755.1.15599 WP_003898755.1.1560 WP_003898755.1.15611 WP_003898755.1.1563 WP_003898755.1.15633 WP_003898755.1.15643 WP_003898755.1.15688 WP_003898755.1.15763 WP_003898755.1.15774 WP_003898755.1.1578 WP_003898755.1.15834 WP_003898755.1.15842 WP_003898755.1.15870 WP_003898755.1.15877 WP_003898755.1.15896 WP_003898755.1.15946 WP_003898755.1.15973 WP_003898755.1.15987 WP_003898755.1.15993 WP_003898755.1.16025 WP_003898755.1.16043 WP_003898755.1.16066 WP_003898755.1.16069 WP_003898755.1.16077 WP_003898755.1.16106 WP_003898755.1.16139 WP_003898755.1.16143 WP_003898755.1.1630 WP_003898755.1.16318 WP_003898755.1.1632 WP_003898755.1.16327 WP_003898755.1.16334 WP_003898755.1.16341 WP_003898755.1.16345 WP_003898755.1.16374 WP_003898755.1.16384 WP_003898755.1.16386 WP_003898755.1.164 WP_003898755.1.1642 WP_003898755.1.16426 WP_003898755.1.16431 WP_003898755.1.16442 WP_003898755.1.16448 WP_003898755.1.16476 WP_003898755.1.16480 WP_003898755.1.1652 WP_003898755.1.16549 WP_003898755.1.16560 WP_003898755.1.16598 WP_003898755.1.16609 WP_003898755.1.16619 WP_003898755.1.16622 WP_003898755.1.16637 WP_003898755.1.1669 WP_003898755.1.16707 WP_003898755.1.16724 WP_003898755.1.16731 WP_003898755.1.16743 WP_003898755.1.16837 WP_003898755.1.16852 WP_003898755.1.16937 WP_003898755.1.16940 WP_003898755.1.16950 WP_003898755.1.16959 WP_003898755.1.16968 WP_003898755.1.1697 WP_003898755.1.16987 WP_003898755.1.17005 WP_003898755.1.17006 WP_003898755.1.17010 WP_003898755.1.17015 WP_003898755.1.17019 WP_003898755.1.17052 WP_003898755.1.17062 WP_003898755.1.1707 WP_003898755.1.17094 WP_003898755.1.17130 WP_003898755.1.17147 WP_003898755.1.17224 WP_003898755.1.17251 WP_003898755.1.17288 WP_003898755.1.17304 WP_003898755.1.17381 WP_003898755.1.17412 WP_003898755.1.1743 WP_003898755.1.17466 WP_003898755.1.17477 WP_003898755.1.17483 WP_003898755.1.17505 WP_003898755.1.17527 WP_003898755.1.17535 WP_003898755.1.17540 WP_003898755.1.17553 WP_003898755.1.17558 WP_003898755.1.17599 WP_003898755.1.17635 WP_003898755.1.17655 WP_003898755.1.17679 WP_003898755.1.17687 WP_003898755.1.17710 WP_003898755.1.17713 WP_003898755.1.17746 WP_003898755.1.17788 WP_003898755.1.17798 WP_003898755.1.17821 WP_003898755.1.17830 WP_003898755.1.17868 WP_003898755.1.17878 WP_003898755.1.1792 WP_003898755.1.1795 WP_003898755.1.17955 WP_003898755.1.17973 WP_003898755.1.18009 WP_003898755.1.18057 WP_003898755.1.18065 WP_003898755.1.18070 WP_003898755.1.18116 WP_003898755.1.18120 WP_003898755.1.18126 WP_003898755.1.1817 WP_003898755.1.18170 WP_003898755.1.18206 WP_003898755.1.18216 WP_003898755.1.18240 WP_003898755.1.18297 WP_003898755.1.18306 WP_003898755.1.18364 WP_003898755.1.18399 WP_003898755.1.18411 WP_003898755.1.18444 WP_003898755.1.18467 WP_003898755.1.18476 WP_003898755.1.18522 WP_003898755.1.18580 WP_003898755.1.18582 WP_003898755.1.18587 WP_003898755.1.186 WP_003898755.1.18601 WP_003898755.1.18639 WP_003898755.1.18646 WP_003898755.1.18647 WP_003898755.1.1868 WP_003898755.1.18694 WP_003898755.1.18710 WP_003898755.1.18751 WP_003898755.1.18781 WP_003898755.1.18804 WP_003898755.1.18816 WP_003898755.1.18823 WP_003898755.1.18827 WP_003898755.1.18849 WP_003898755.1.18856 WP_003898755.1.18945 WP_003898755.1.1898 WP_003898755.1.19056 WP_003898755.1.19066 WP_003898755.1.19085 WP_003898755.1.19094 WP_003898755.1.19144 WP_003898755.1.19159 WP_003898755.1.19193 WP_003898755.1.19231 WP_003898755.1.19264 WP_003898755.1.19295 WP_003898755.1.1933 WP_003898755.1.19364 WP_003898755.1.19382 WP_003898755.1.19400 WP_003898755.1.19426 WP_003898755.1.19480 WP_003898755.1.19562 WP_003898755.1.19564 WP_003898755.1.19572 WP_003898755.1.19595 WP_003898755.1.19596 WP_003898755.1.19600 WP_003898755.1.1967 WP_003898755.1.19694 WP_003898755.1.1970 WP_003898755.1.19707 WP_003898755.1.19785 WP_003898755.1.19820 WP_003898755.1.19874 WP_003898755.1.19900 WP_003898755.1.19922 WP_003898755.1.19936 WP_003898755.1.19949 WP_003898755.1.19960 WP_003898755.1.19964 WP_003898755.1.20007 WP_003898755.1.20016 WP_003898755.1.2003 WP_003898755.1.20037 WP_003898755.1.20039 WP_003898755.1.20097 WP_003898755.1.20116 WP_003898755.1.20130 WP_003898755.1.20141 WP_003898755.1.20142 WP_003898755.1.20158 WP_003898755.1.20272 WP_003898755.1.20273 WP_003898755.1.20280 WP_003898755.1.20294 WP_003898755.1.20300 WP_003898755.1.20309 WP_003898755.1.20322 WP_003898755.1.2037 WP_003898755.1.20381 WP_003898755.1.204 WP_003898755.1.20427 WP_003898755.1.20457 WP_003898755.1.20460 WP_003898755.1.20542 WP_003898755.1.20578 WP_003898755.1.20608 WP_003898755.1.20624 WP_003898755.1.20707 WP_003898755.1.20722 WP_003898755.1.20729 WP_003898755.1.20742 WP_003898755.1.20751 WP_003898755.1.20776 WP_003898755.1.20843 WP_003898755.1.20850 WP_003898755.1.2086 WP_003898755.1.20868 WP_003898755.1.20876 WP_003898755.1.20897 WP_003898755.1.20911 WP_003898755.1.20921 WP_003898755.1.20926 WP_003898755.1.20927 WP_003898755.1.20951 WP_003898755.1.20970 WP_003898755.1.2104 WP_003898755.1.21070 WP_003898755.1.21127 WP_003898755.1.21173 WP_003898755.1.21187 WP_003898755.1.212 WP_003898755.1.21218 WP_003898755.1.21219 WP_003898755.1.2123 WP_003898755.1.21231 WP_003898755.1.21234 WP_003898755.1.2126 WP_003898755.1.21292 WP_003898755.1.21307 WP_003898755.1.2131 WP_003898755.1.21311 WP_003898755.1.21365 WP_003898755.1.2137 WP_003898755.1.21397 WP_003898755.1.21403 WP_003898755.1.21415 WP_003898755.1.21418 WP_003898755.1.21430 WP_003898755.1.21434 WP_003898755.1.21444 WP_003898755.1.21468 WP_003898755.1.21498 WP_003898755.1.21509 WP_003898755.1.21513 WP_003898755.1.21560 WP_003898755.1.21565 WP_003898755.1.21586 WP_003898755.1.21591 WP_003898755.1.21594 WP_003898755.1.21602 WP_003898755.1.21615 WP_003898755.1.21638 WP_003898755.1.21639 WP_003898755.1.21655 WP_003898755.1.2168 WP_003898755.1.2174 WP_003898755.1.21777 WP_003898755.1.21786 WP_003898755.1.218 WP_003898755.1.21826 WP_003898755.1.21829 WP_003898755.1.21840 WP_003898755.1.21843 WP_003898755.1.21872 WP_003898755.1.2188 WP_003898755.1.21882 WP_003898755.1.21906 WP_003898755.1.21912 WP_003898755.1.2194 WP_003898755.1.21941 WP_003898755.1.21956 WP_003898755.1.21958 WP_003898755.1.21960 WP_003898755.1.21973 WP_003898755.1.21983 WP_003898755.1.22003 WP_003898755.1.22013 WP_003898755.1.22025 WP_003898755.1.22036 WP_003898755.1.22075 WP_003898755.1.22092 WP_003898755.1.2212 WP_003898755.1.22127 WP_003898755.1.22233 WP_003898755.1.22255 WP_003898755.1.22277 WP_003898755.1.22348 WP_003898755.1.22356 WP_003898755.1.22366 WP_003898755.1.2238 WP_003898755.1.22380 WP_003898755.1.22437 WP_003898755.1.22438 WP_003898755.1.22445 WP_003898755.1.22511 WP_003898755.1.22585 WP_003898755.1.22589 WP_003898755.1.22608 WP_003898755.1.22609 WP_003898755.1.22618 WP_003898755.1.2262 WP_003898755.1.22624 WP_003898755.1.22629 WP_003898755.1.22647 WP_003898755.1.22664 WP_003898755.1.22665 WP_003898755.1.22670 WP_003898755.1.22725 WP_003898755.1.22728 WP_003898755.1.22733 WP_003898755.1.22737 WP_003898755.1.22754 WP_003898755.1.22800 WP_003898755.1.22804 WP_003898755.1.22829 WP_003898755.1.22840 WP_003898755.1.22844 WP_003898755.1.22970 WP_003898755.1.22996 WP_003898755.1.22997 WP_003898755.1.22999 WP_003898755.1.23015 WP_003898755.1.231 WP_003898755.1.23101 WP_003898755.1.2312 WP_003898755.1.23153 WP_003898755.1.23171 WP_003898755.1.23199 WP_003898755.1.2320 WP_003898755.1.23204 WP_003898755.1.23216 WP_003898755.1.23229 WP_003898755.1.23233 WP_003898755.1.2326 WP_003898755.1.23261 WP_003898755.1.23272 WP_003898755.1.2329 WP_003898755.1.23316 WP_003898755.1.23325 WP_003898755.1.2339 WP_003898755.1.23406 WP_003898755.1.23445 WP_003898755.1.23447 WP_003898755.1.23452 WP_003898755.1.2349 WP_003898755.1.23496 WP_003898755.1.23506 WP_003898755.1.23530 WP_003898755.1.23539 WP_003898755.1.23546 WP_003898755.1.23551 WP_003898755.1.23573 WP_003898755.1.23583 WP_003898755.1.23588 WP_003898755.1.23628 WP_003898755.1.23677 WP_003898755.1.23683 WP_003898755.1.23692 WP_003898755.1.23694 WP_003898755.1.23699 WP_003898755.1.2371 WP_003898755.1.23807 WP_003898755.1.23825 WP_003898755.1.23832 WP_003898755.1.23843 WP_003898755.1.23894 WP_003898755.1.23993 WP_003898755.1.2400 WP_003898755.1.24007 WP_003898755.1.24008 WP_003898755.1.24046 WP_003898755.1.24057 WP_003898755.1.24113 WP_003898755.1.24128 WP_003898755.1.24190 WP_003898755.1.24202 WP_003898755.1.24261 WP_003898755.1.24294 WP_003898755.1.24357 WP_003898755.1.24396 WP_003898755.1.24423 WP_003898755.1.2443 WP_003898755.1.24446 WP_003898755.1.24461 WP_003898755.1.24529 WP_003898755.1.24553 WP_003898755.1.24629 WP_003898755.1.24648 WP_003898755.1.24824 WP_003898755.1.24831 WP_003898755.1.24840 WP_003898755.1.24848 WP_003898755.1.2487 WP_003898755.1.24907 WP_003898755.1.24933 WP_003898755.1.24956 WP_003898755.1.24958 WP_003898755.1.24985 WP_003898755.1.25004 WP_003898755.1.2505 WP_003898755.1.25051 WP_003898755.1.25096 WP_003898755.1.25103 WP_003898755.1.25129 WP_003898755.1.25171 WP_003898755.1.25184 WP_003898755.1.25247 WP_003898755.1.25278 WP_003898755.1.25309 WP_003898755.1.25313 WP_003898755.1.25343 WP_003898755.1.25367 WP_003898755.1.25393 WP_003898755.1.25406 WP_003898755.1.25435 WP_003898755.1.25455 WP_003898755.1.25473 WP_003898755.1.25513 WP_003898755.1.25542 WP_003898755.1.25579 WP_003898755.1.25606 WP_003898755.1.25645 WP_003898755.1.2566 WP_003898755.1.25673 WP_003898755.1.25674 WP_003898755.1.25693 WP_003898755.1.25699 WP_003898755.1.25727 WP_003898755.1.25736 WP_003898755.1.25738 WP_003898755.1.25756 WP_003898755.1.25759 WP_003898755.1.25813 WP_003898755.1.25853 WP_003898755.1.25854 WP_003898755.1.25874 WP_003898755.1.25885 WP_003898755.1.25906 WP_003898755.1.25914 WP_003898755.1.2594 WP_003898755.1.25972 WP_003898755.1.26017 WP_003898755.1.26072 WP_003898755.1.26097 WP_003898755.1.26118 WP_003898755.1.26126 WP_003898755.1.26168 WP_003898755.1.26182 WP_003898755.1.26190 WP_003898755.1.26243 WP_003898755.1.26292 WP_003898755.1.26310 WP_003898755.1.26328 WP_003898755.1.26349 WP_003898755.1.26366 WP_003898755.1.26454 WP_003898755.1.26464 WP_003898755.1.2653 WP_003898755.1.26560 WP_003898755.1.2659 WP_003898755.1.26597 WP_003898755.1.26629 WP_003898755.1.26651 WP_003898755.1.26702 WP_003898755.1.26707 WP_003898755.1.26710 WP_003898755.1.26737 WP_003898755.1.26738 WP_003898755.1.2676 WP_003898755.1.26780 WP_003898755.1.26854 WP_003898755.1.26888 WP_003898755.1.26945 WP_003898755.1.26984 WP_003898755.1.26992 WP_003898755.1.27004 WP_003898755.1.27017 WP_003898755.1.27045 WP_003898755.1.27074 WP_003898755.1.27075 WP_003898755.1.27128 WP_003898755.1.27130 WP_003898755.1.27139 WP_003898755.1.27152 WP_003898755.1.27162 WP_003898755.1.27193 WP_003898755.1.27278 WP_003898755.1.27343 WP_003898755.1.27352 WP_003898755.1.27369 WP_003898755.1.27391 WP_003898755.1.27398 WP_003898755.1.27410 WP_003898755.1.27411 WP_003898755.1.27449 WP_003898755.1.27460 WP_003898755.1.27463 WP_003898755.1.27492 WP_003898755.1.27528 WP_003898755.1.27541 WP_003898755.1.27576 WP_003898755.1.27582 WP_003898755.1.27596 WP_003898755.1.27607 WP_003898755.1.2766 WP_003898755.1.277 WP_003898755.1.27724 WP_003898755.1.27730 WP_003898755.1.27736 WP_003898755.1.27743 WP_003898755.1.27750 WP_003898755.1.27779 WP_003898755.1.27795 WP_003898755.1.27819 WP_003898755.1.27835 WP_003898755.1.27915 WP_003898755.1.27935 WP_003898755.1.27962 WP_003898755.1.28053 WP_003898755.1.28092 WP_003898755.1.28106 WP_003898755.1.28131 WP_003898755.1.28159 WP_003898755.1.2816 WP_003898755.1.28161 WP_003898755.1.28192 WP_003898755.1.28241 WP_003898755.1.28251 WP_003898755.1.28255 WP_003898755.1.28269 WP_003898755.1.28276 WP_003898755.1.28293 WP_003898755.1.28331 WP_003898755.1.28367 WP_003898755.1.28378 WP_003898755.1.2842 WP_003898755.1.28448 WP_003898755.1.2847 WP_003898755.1.28493 WP_003898755.1.28497 WP_003898755.1.28530 WP_003898755.1.28545 WP_003898755.1.28561 WP_003898755.1.28567 WP_003898755.1.28585 WP_003898755.1.286 WP_003898755.1.28610 WP_003898755.1.28617 WP_003898755.1.28642 WP_003898755.1.28682 WP_003898755.1.28739 WP_003898755.1.28758 WP_003898755.1.28781 WP_003898755.1.28827 WP_003898755.1.28839 WP_003898755.1.28847 WP_003898755.1.28850 WP_003898755.1.28851 WP_003898755.1.28865 WP_003898755.1.28897 WP_003898755.1.28914 WP_003898755.1.28936 WP_003898755.1.28939 WP_003898755.1.28943 WP_003898755.1.28952 WP_003898755.1.28975 WP_003898755.1.2899 WP_003898755.1.28993 WP_003898755.1.29000 WP_003898755.1.2901 WP_003898755.1.29028 WP_003898755.1.29033 WP_003898755.1.29058 WP_003898755.1.29078 WP_003898755.1.29102 WP_003898755.1.29115 WP_003898755.1.2916 WP_003898755.1.29217 WP_003898755.1.29223 WP_003898755.1.29234 WP_003898755.1.29264 WP_003898755.1.29275 WP_003898755.1.29306 WP_003898755.1.29364 WP_003898755.1.29367 WP_003898755.1.2944 WP_003898755.1.29449 WP_003898755.1.29450 WP_003898755.1.29452 WP_003898755.1.2949 WP_003898755.1.29515 WP_003898755.1.29525 WP_003898755.1.2953 WP_003898755.1.29587 WP_003898755.1.29592 WP_003898755.1.29599 WP_003898755.1.29632 WP_003898755.1.29649 WP_003898755.1.2965 WP_003898755.1.2969 WP_003898755.1.29696 WP_003898755.1.29718 WP_003898755.1.29742 WP_003898755.1.29745 WP_003898755.1.29747 WP_003898755.1.29769 WP_003898755.1.29830 WP_003898755.1.29847 WP_003898755.1.29861 WP_003898755.1.29869 WP_003898755.1.29883 WP_003898755.1.29890 WP_003898755.1.29931 WP_003898755.1.29960 WP_003898755.1.30014 WP_003898755.1.3004 WP_003898755.1.30043 WP_003898755.1.30074 WP_003898755.1.30097 WP_003898755.1.30106 WP_003898755.1.30114 WP_003898755.1.30126 WP_003898755.1.30131 WP_003898755.1.30139 WP_003898755.1.30145 WP_003898755.1.30235 WP_003898755.1.30237 WP_003898755.1.3027 WP_003898755.1.30279 WP_003898755.1.30282 WP_003898755.1.30288 WP_003898755.1.30291 WP_003898755.1.30363 WP_003898755.1.30374 WP_003898755.1.30404 WP_003898755.1.30438 WP_003898755.1.30462 WP_003898755.1.30464 WP_003898755.1.30468 WP_003898755.1.30500 WP_003898755.1.3057 WP_003898755.1.30574 WP_003898755.1.30628 WP_003898755.1.30642 WP_003898755.1.30661 WP_003898755.1.30683 WP_003898755.1.30709 WP_003898755.1.30713 WP_003898755.1.30716 WP_003898755.1.30719 WP_003898755.1.30730 WP_003898755.1.30736 WP_003898755.1.30745 WP_003898755.1.30760 WP_003898755.1.30791 WP_003898755.1.308 WP_003898755.1.30807 WP_003898755.1.30818 WP_003898755.1.30824 WP_003898755.1.30877 WP_003898755.1.30901 WP_003898755.1.30903 WP_003898755.1.30914 WP_003898755.1.30919 WP_003898755.1.30977 WP_003898755.1.3100 WP_003898755.1.31002 WP_003898755.1.3101 WP_003898755.1.31034 WP_003898755.1.31070 WP_003898755.1.31074 WP_003898755.1.31102 WP_003898755.1.31127 WP_003898755.1.31184 WP_003898755.1.31199 WP_003898755.1.31226 WP_003898755.1.31230 WP_003898755.1.31263 WP_003898755.1.31264 WP_003898755.1.31270 WP_003898755.1.31287 WP_003898755.1.31290 WP_003898755.1.31346 WP_003898755.1.31348 WP_003898755.1.31354 WP_003898755.1.31390 WP_003898755.1.31414 WP_003898755.1.31417 WP_003898755.1.3143 WP_003898755.1.31458 WP_003898755.1.31483 WP_003898755.1.3149 WP_003898755.1.31507 WP_003898755.1.31537 WP_003898755.1.31548 WP_003898755.1.316 WP_003898755.1.31629 WP_003898755.1.31666 WP_003898755.1.31693 WP_003898755.1.31703 WP_003898755.1.31744 WP_003898755.1.31770 WP_003898755.1.31776 WP_003898755.1.31783 WP_003898755.1.318 WP_003898755.1.3184 WP_003898755.1.31880 WP_003898755.1.31911 WP_003898755.1.31930 WP_003898755.1.31932 WP_003898755.1.31985 WP_003898755.1.31991 WP_003898755.1.31995 WP_003898755.1.32004 WP_003898755.1.32039 WP_003898755.1.3204 WP_003898755.1.32045 WP_003898755.1.32071 WP_003898755.1.32098 WP_003898755.1.32157 WP_003898755.1.32179 WP_003898755.1.32198 WP_003898755.1.32297 WP_003898755.1.32383 WP_003898755.1.32403 WP_003898755.1.32416 WP_003898755.1.32421 WP_003898755.1.32433 WP_003898755.1.32461 WP_003898755.1.32503 WP_003898755.1.32556 WP_003898755.1.32562 WP_003898755.1.32569 WP_003898755.1.32620 WP_003898755.1.32647 WP_003898755.1.32654 WP_003898755.1.3268 WP_003898755.1.32695 WP_003898755.1.32706 WP_003898755.1.32716 WP_003898755.1.32738 WP_003898755.1.32781 WP_003898755.1.32793 WP_003898755.1.32799 WP_003898755.1.32833 WP_003898755.1.32862 WP_003898755.1.32880 WP_003898755.1.32909 WP_003898755.1.32935 WP_003898755.1.33007 WP_003898755.1.3302 WP_003898755.1.33028 WP_003898755.1.33054 WP_003898755.1.33082 WP_003898755.1.33141 WP_003898755.1.33148 WP_003898755.1.33155 WP_003898755.1.33215 WP_003898755.1.3325 WP_003898755.1.3327 WP_003898755.1.33278 WP_003898755.1.33305 WP_003898755.1.3331 WP_003898755.1.33319 WP_003898755.1.3333 WP_003898755.1.33393 WP_003898755.1.33403 WP_003898755.1.33452 WP_003898755.1.33467 WP_003898755.1.33477 WP_003898755.1.33542 WP_003898755.1.33601 WP_003898755.1.33602 WP_003898755.1.33633 WP_003898755.1.33646 WP_003898755.1.33673 WP_003898755.1.33762 WP_003898755.1.33783 WP_003898755.1.33832 WP_003898755.1.33848 WP_003898755.1.3387 WP_003898755.1.33886 WP_003898755.1.33895 WP_003898755.1.33912 WP_003898755.1.33954 WP_003898755.1.34042 WP_003898755.1.3405 WP_003898755.1.34055 WP_003898755.1.34056 WP_003898755.1.34065 WP_003898755.1.34109 WP_003898755.1.34152 WP_003898755.1.34163 WP_003898755.1.34181 WP_003898755.1.34198 WP_003898755.1.34219 WP_003898755.1.34260 WP_003898755.1.34275 WP_003898755.1.34347 WP_003898755.1.34392 WP_003898755.1.34428 WP_003898755.1.3443 WP_003898755.1.34435 WP_003898755.1.34499 WP_003898755.1.34505 WP_003898755.1.34529 WP_003898755.1.34551 WP_003898755.1.34563 WP_003898755.1.34576 WP_003898755.1.34581 WP_003898755.1.34588 WP_003898755.1.34596 WP_003898755.1.34599 WP_003898755.1.34639 WP_003898755.1.34724 WP_003898755.1.34740 WP_003898755.1.34755 WP_003898755.1.34777 WP_003898755.1.34841 WP_003898755.1.34908 WP_003898755.1.34919 WP_003898755.1.34933 WP_003898755.1.34945 WP_003898755.1.34946 WP_003898755.1.34954 WP_003898755.1.34960 WP_003898755.1.34961 WP_003898755.1.34963 WP_003898755.1.34965 WP_003898755.1.34968 WP_003898755.1.35023 WP_003898755.1.35069 WP_003898755.1.35072 WP_003898755.1.35156 WP_003898755.1.35160 WP_003898755.1.35162 WP_003898755.1.35176 WP_003898755.1.35221 WP_003898755.1.35246 WP_003898755.1.35301 WP_003898755.1.35311 WP_003898755.1.35312 WP_003898755.1.35317 WP_003898755.1.35319 WP_003898755.1.35347 WP_003898755.1.35363 WP_003898755.1.35382 WP_003898755.1.35385 WP_003898755.1.35426 WP_003898755.1.35455 WP_003898755.1.3548 WP_003898755.1.35484 WP_003898755.1.35492 WP_003898755.1.3553 WP_003898755.1.35553 WP_003898755.1.35635 WP_003898755.1.35657 WP_003898755.1.35687 WP_003898755.1.35689 WP_003898755.1.35707 WP_003898755.1.35732 WP_003898755.1.35754 WP_003898755.1.35767 WP_003898755.1.35770 WP_003898755.1.35771 WP_003898755.1.35780 WP_003898755.1.35805 WP_003898755.1.35811 WP_003898755.1.3584 WP_003898755.1.35848 WP_003898755.1.35864 WP_003898755.1.35874 WP_003898755.1.35876 WP_003898755.1.35899 WP_003898755.1.35954 WP_003898755.1.36005 WP_003898755.1.36014 WP_003898755.1.36023 WP_003898755.1.36051 WP_003898755.1.36053 WP_003898755.1.36075 WP_003898755.1.36089 WP_003898755.1.36097 WP_003898755.1.36098 WP_003898755.1.36116 WP_003898755.1.36205 WP_003898755.1.36228 WP_003898755.1.36252 WP_003898755.1.36260 WP_003898755.1.36271 WP_003898755.1.36303 WP_003898755.1.36309 WP_003898755.1.36315 WP_003898755.1.36319 WP_003898755.1.3634 WP_003898755.1.36356 WP_003898755.1.36357 WP_003898755.1.3636 WP_003898755.1.36385 WP_003898755.1.36399 WP_003898755.1.36436 WP_003898755.1.36465 WP_003898755.1.36469 WP_003898755.1.36473 WP_003898755.1.36485 WP_003898755.1.36508 WP_003898755.1.36540 WP_003898755.1.36561 WP_003898755.1.36571 WP_003898755.1.36573 WP_003898755.1.36578 WP_003898755.1.36585 WP_003898755.1.36597 WP_003898755.1.36614 WP_003898755.1.36674 WP_003898755.1.36720 WP_003898755.1.36733 WP_003898755.1.36810 WP_003898755.1.36851 WP_003898755.1.36893 WP_003898755.1.36901 WP_003898755.1.36935 WP_003898755.1.3695 WP_003898755.1.36968 WP_003898755.1.3700 WP_003898755.1.37004 WP_003898755.1.37012 WP_003898755.1.37071 WP_003898755.1.37088 WP_003898755.1.37157 WP_003898755.1.37175 WP_003898755.1.37188 WP_003898755.1.37213 WP_003898755.1.37229 WP_003898755.1.37277 WP_003898755.1.37305 WP_003898755.1.37330 WP_003898755.1.37389 WP_003898755.1.37400 WP_003898755.1.37440 WP_003898755.1.37459 WP_003898755.1.37468 WP_003898755.1.37475 WP_003898755.1.37484 WP_003898755.1.37601 WP_003898755.1.37612 WP_003898755.1.37632 WP_003898755.1.37655 WP_003898755.1.37660 WP_003898755.1.37674 WP_003898755.1.37700 WP_003898755.1.37711 WP_003898755.1.37721 WP_003898755.1.37722 WP_003898755.1.37765 WP_003898755.1.37772 WP_003898755.1.37804 WP_003898755.1.37809 WP_003898755.1.37859 WP_003898755.1.37877 WP_003898755.1.37913 WP_003898755.1.37943 WP_003898755.1.37950 WP_003898755.1.37973 WP_003898755.1.37975 WP_003898755.1.38 WP_003898755.1.38002 WP_003898755.1.3802 WP_003898755.1.38040 WP_003898755.1.38067 WP_003898755.1.38068 WP_003898755.1.38138 WP_003898755.1.38144 WP_003898755.1.38158 WP_003898755.1.38210 WP_003898755.1.38233 WP_003898755.1.38240 WP_003898755.1.38299 WP_003898755.1.38332 WP_003898755.1.38347 WP_003898755.1.38354 WP_003898755.1.38398 WP_003898755.1.38402 WP_003898755.1.38421 WP_003898755.1.38466 WP_003898755.1.38477 WP_003898755.1.38483 WP_003898755.1.3849 WP_003898755.1.385 WP_003898755.1.38530 WP_003898755.1.38535 WP_003898755.1.38539 WP_003898755.1.38594 WP_003898755.1.38611 WP_003898755.1.38639 WP_003898755.1.38646 WP_003898755.1.38648 WP_003898755.1.38660 WP_003898755.1.38666 WP_003898755.1.38671 WP_003898755.1.38672 WP_003898755.1.38750 WP_003898755.1.38772 WP_003898755.1.38812 WP_003898755.1.38821 WP_003898755.1.38844 WP_003898755.1.38863 WP_003898755.1.38873 WP_003898755.1.3889 WP_003898755.1.38909 WP_003898755.1.38939 WP_003898755.1.38974 WP_003898755.1.38991 WP_003898755.1.39070 WP_003898755.1.39072 WP_003898755.1.39106 WP_003898755.1.39174 WP_003898755.1.39176 WP_003898755.1.39178 WP_003898755.1.39190 WP_003898755.1.39201 WP_003898755.1.39207 WP_003898755.1.39236 WP_003898755.1.39252 WP_003898755.1.39288 WP_003898755.1.39295 WP_003898755.1.39306 WP_003898755.1.39359 WP_003898755.1.39400 WP_003898755.1.39447 WP_003898755.1.3945 WP_003898755.1.39450 WP_003898755.1.39455 WP_003898755.1.39521 WP_003898755.1.39560 WP_003898755.1.39592 WP_003898755.1.396 WP_003898755.1.3960 WP_003898755.1.39616 WP_003898755.1.39654 WP_003898755.1.39657 WP_003898755.1.39674 WP_003898755.1.3968 WP_003898755.1.39694 WP_003898755.1.3971 WP_003898755.1.39718 WP_003898755.1.39728 WP_003898755.1.39739 WP_003898755.1.39748 WP_003898755.1.39751 WP_003898755.1.39759 WP_003898755.1.39804 WP_003898755.1.39848 WP_003898755.1.39925 WP_003898755.1.3994 WP_003898755.1.39959 WP_003898755.1.3996 WP_003898755.1.39960 WP_003898755.1.3997 WP_003898755.1.39980 WP_003898755.1.40000 WP_003898755.1.40028 WP_003898755.1.4003 WP_003898755.1.40150 WP_003898755.1.40156 WP_003898755.1.40174 WP_003898755.1.40276 WP_003898755.1.40277 WP_003898755.1.40323 WP_003898755.1.40336 WP_003898755.1.40353 WP_003898755.1.4036 WP_003898755.1.40372 WP_003898755.1.40402 WP_003898755.1.40413 WP_003898755.1.40446 WP_003898755.1.40451 WP_003898755.1.40455 WP_003898755.1.40523 WP_003898755.1.40641 WP_003898755.1.40646 WP_003898755.1.40651 WP_003898755.1.40653 WP_003898755.1.40723 WP_003898755.1.40735 WP_003898755.1.40799 WP_003898755.1.40852 WP_003898755.1.40876 WP_003898755.1.40881 WP_003898755.1.4095 WP_003898755.1.40956 WP_003898755.1.40957 WP_003898755.1.4097 WP_003898755.1.410 WP_003898755.1.41000 WP_003898755.1.41108 WP_003898755.1.41177 WP_003898755.1.41202 WP_003898755.1.41219 WP_003898755.1.41231 WP_003898755.1.41249 WP_003898755.1.4127 WP_003898755.1.41355 WP_003898755.1.41376 WP_003898755.1.41430 WP_003898755.1.41447 WP_003898755.1.41469 WP_003898755.1.41504 WP_003898755.1.41553 WP_003898755.1.41564 WP_003898755.1.41632 WP_003898755.1.41635 WP_003898755.1.41636 WP_003898755.1.41648 WP_003898755.1.41660 WP_003898755.1.41685 WP_003898755.1.41695 WP_003898755.1.41704 WP_003898755.1.41733 WP_003898755.1.41744 WP_003898755.1.41791 WP_003898755.1.41803 WP_003898755.1.41820 WP_003898755.1.41828 WP_003898755.1.41829 WP_003898755.1.41860 WP_003898755.1.41912 WP_003898755.1.41921 WP_003898755.1.41933 WP_003898755.1.41944 WP_003898755.1.42043 WP_003898755.1.42075 WP_003898755.1.42078 WP_003898755.1.42094 WP_003898755.1.42112 WP_003898755.1.4212 WP_003898755.1.42122 WP_003898755.1.42134 WP_003898755.1.42183 WP_003898755.1.42188 WP_003898755.1.42202 WP_003898755.1.42247 WP_003898755.1.42255 WP_003898755.1.42273 WP_003898755.1.42278 WP_003898755.1.42304 WP_003898755.1.42309 WP_003898755.1.42385 WP_003898755.1.42400 WP_003898755.1.42430 WP_003898755.1.42461 WP_003898755.1.42465 WP_003898755.1.42467 WP_003898755.1.42473 WP_003898755.1.42474 WP_003898755.1.4248 WP_003898755.1.42494 WP_003898755.1.42519 WP_003898755.1.42524 WP_003898755.1.42562 WP_003898755.1.42568 WP_003898755.1.42570 WP_003898755.1.42618 WP_003898755.1.42660 WP_003898755.1.42695 WP_003898755.1.42704 WP_003898755.1.42705 WP_003898755.1.42722 WP_003898755.1.42777 WP_003898755.1.42782 WP_003898755.1.42835 WP_003898755.1.42839 WP_003898755.1.42842 WP_003898755.1.42905 WP_003898755.1.42916 WP_003898755.1.42971 WP_003898755.1.43005 WP_003898755.1.43009 WP_003898755.1.43053 WP_003898755.1.43082 WP_003898755.1.43087 WP_003898755.1.43098 WP_003898755.1.43208 WP_003898755.1.43236 WP_003898755.1.43246 WP_003898755.1.43255 WP_003898755.1.43266 WP_003898755.1.43273 WP_003898755.1.43296 WP_003898755.1.43306 WP_003898755.1.4335 WP_003898755.1.43368 WP_003898755.1.43395 WP_003898755.1.43462 WP_003898755.1.43475 WP_003898755.1.43478 WP_003898755.1.43484 WP_003898755.1.43557 WP_003898755.1.43578 WP_003898755.1.43588 WP_003898755.1.43643 WP_003898755.1.43664 WP_003898755.1.43684 WP_003898755.1.43706 WP_003898755.1.4377 WP_003898755.1.43781 WP_003898755.1.43794 WP_003898755.1.43815 WP_003898755.1.43846 WP_003898755.1.43861 WP_003898755.1.43863 WP_003898755.1.43866 WP_003898755.1.43872 WP_003898755.1.43885 WP_003898755.1.43897 WP_003898755.1.43921 WP_003898755.1.43936 WP_003898755.1.43937 WP_003898755.1.43960 WP_003898755.1.43965 WP_003898755.1.4399 WP_003898755.1.43993 WP_003898755.1.43996 WP_003898755.1.44 WP_003898755.1.44001 WP_003898755.1.44033 WP_003898755.1.44037 WP_003898755.1.44070 WP_003898755.1.44071 WP_003898755.1.44076 WP_003898755.1.44104 WP_003898755.1.44169 WP_003898755.1.44219 WP_003898755.1.44237 WP_003898755.1.44277 WP_003898755.1.44279 WP_003898755.1.44336 WP_003898755.1.44355 WP_003898755.1.44358 WP_003898755.1.4438 WP_003898755.1.44392 WP_003898755.1.4441 WP_003898755.1.44415 WP_003898755.1.44466 WP_003898755.1.44489 WP_003898755.1.44492 WP_003898755.1.44494 WP_003898755.1.44500 WP_003898755.1.44519 WP_003898755.1.44532 WP_003898755.1.44534 WP_003898755.1.44562 WP_003898755.1.44597 WP_003898755.1.44600 WP_003898755.1.44602 WP_003898755.1.44615 WP_003898755.1.4464 WP_003898755.1.44651 WP_003898755.1.44659 WP_003898755.1.44665 WP_003898755.1.44694 WP_003898755.1.44700 WP_003898755.1.44713 WP_003898755.1.44735 WP_003898755.1.44740 WP_003898755.1.4476 WP_003898755.1.44761 WP_003898755.1.44767 WP_003898755.1.44776 WP_003898755.1.44779 WP_003898755.1.44786 WP_003898755.1.44864 WP_003898755.1.44901 WP_003898755.1.44908 WP_003898755.1.44913 WP_003898755.1.4492 WP_003898755.1.44939 WP_003898755.1.44979 WP_003898755.1.44981 WP_003898755.1.45002 WP_003898755.1.45011 WP_003898755.1.4504 WP_003898755.1.45062 WP_003898755.1.45081 WP_003898755.1.45113 WP_003898755.1.45129 WP_003898755.1.45135 WP_003898755.1.45147 WP_003898755.1.45168 WP_003898755.1.4517 WP_003898755.1.45185 WP_003898755.1.45192 WP_003898755.1.45200 WP_003898755.1.45205 WP_003898755.1.45211 WP_003898755.1.4526 WP_003898755.1.45286 WP_003898755.1.45326 WP_003898755.1.45374 WP_003898755.1.45390 WP_003898755.1.45407 WP_003898755.1.45453 WP_003898755.1.45463 WP_003898755.1.45474 WP_003898755.1.45491 WP_003898755.1.45510 WP_003898755.1.45563 WP_003898755.1.45590 WP_003898755.1.45619 WP_003898755.1.45626 WP_003898755.1.45631 WP_003898755.1.45666 WP_003898755.1.45697 WP_003898755.1.4571 WP_003898755.1.45731 WP_003898755.1.45805 WP_003898755.1.45815 WP_003898755.1.45849 WP_003898755.1.45867 WP_003898755.1.4590 WP_003898755.1.45926 WP_003898755.1.45963 WP_003898755.1.45992 WP_003898755.1.46083 WP_003898755.1.46090 WP_003898755.1.46092 WP_003898755.1.46100 WP_003898755.1.46101 WP_003898755.1.46103 WP_003898755.1.46107 WP_003898755.1.46129 WP_003898755.1.46141 WP_003898755.1.46150 WP_003898755.1.46226 WP_003898755.1.4624 WP_003898755.1.46253 WP_003898755.1.46268 WP_003898755.1.46285 WP_003898755.1.46300 WP_003898755.1.46313 WP_003898755.1.46336 WP_003898755.1.46365 WP_003898755.1.46370 WP_003898755.1.46411 WP_003898755.1.4644 WP_003898755.1.46442 WP_003898755.1.46453 WP_003898755.1.46463 WP_003898755.1.46492 WP_003898755.1.46521 WP_003898755.1.4653 WP_003898755.1.46539 WP_003898755.1.46568 WP_003898755.1.46585 WP_003898755.1.46609 WP_003898755.1.46613 WP_003898755.1.46625 WP_003898755.1.46642 WP_003898755.1.46647 WP_003898755.1.46674 WP_003898755.1.46724 WP_003898755.1.46773 WP_003898755.1.46792 WP_003898755.1.46847 WP_003898755.1.46851 WP_003898755.1.46897 WP_003898755.1.47011 WP_003898755.1.47066 WP_003898755.1.47077 WP_003898755.1.47083 WP_003898755.1.47106 WP_003898755.1.47147 WP_003898755.1.47178 WP_003898755.1.47194 WP_003898755.1.47210 WP_003898755.1.47261 WP_003898755.1.47262 WP_003898755.1.47423 WP_003898755.1.47467 WP_003898755.1.47502 WP_003898755.1.4751 WP_003898755.1.47511 WP_003898755.1.47537 WP_003898755.1.47540 WP_003898755.1.47568 WP_003898755.1.47572 WP_003898755.1.47636 WP_003898755.1.47653 WP_003898755.1.47679 WP_003898755.1.47681 WP_003898755.1.47690 WP_003898755.1.4771 WP_003898755.1.47717 WP_003898755.1.47743 WP_003898755.1.47754 WP_003898755.1.47773 WP_003898755.1.47780 WP_003898755.1.47805 WP_003898755.1.47832 WP_003898755.1.47847 WP_003898755.1.47893 WP_003898755.1.47899 WP_003898755.1.479 WP_003898755.1.47912 WP_003898755.1.47926 WP_003898755.1.4794 WP_003898755.1.47943 WP_003898755.1.47944 WP_003898755.1.47959 WP_003898755.1.47974 WP_003898755.1.47993 WP_003898755.1.48039 WP_003898755.1.48050 WP_003898755.1.48084 WP_003898755.1.48097 WP_003898755.1.48101 WP_003898755.1.48130 WP_003898755.1.48135 WP_003898755.1.48143 WP_003898755.1.48152 WP_003898755.1.48155 WP_003898755.1.48170 WP_003898755.1.48177 WP_003898755.1.48185 WP_003898755.1.48219 WP_003898755.1.48240 WP_003898755.1.48256 WP_003898755.1.48264 WP_003898755.1.48287 WP_003898755.1.48330 WP_003898755.1.48348 WP_003898755.1.48354 WP_003898755.1.48372 WP_003898755.1.48383 WP_003898755.1.48388 WP_003898755.1.48423 WP_003898755.1.48443 WP_003898755.1.48462 WP_003898755.1.48550 WP_003898755.1.4863 WP_003898755.1.48658 WP_003898755.1.48666 WP_003898755.1.48687 WP_003898755.1.48779 WP_003898755.1.4878 WP_003898755.1.48843 WP_003898755.1.48857 WP_003898755.1.4890 WP_003898755.1.48946 WP_003898755.1.48979 WP_003898755.1.49017 WP_003898755.1.49048 WP_003898755.1.49059 WP_003898755.1.4906 WP_003898755.1.4907 WP_003898755.1.49110 WP_003898755.1.49111 WP_003898755.1.4919 WP_003898755.1.49251 WP_003898755.1.49254 WP_003898755.1.49291 WP_003898755.1.49335 WP_003898755.1.49337 WP_003898755.1.49419 WP_003898755.1.49426 WP_003898755.1.49437 WP_003898755.1.49474 WP_003898755.1.49506 WP_003898755.1.49516 WP_003898755.1.49523 WP_003898755.1.49526 WP_003898755.1.49532 WP_003898755.1.4959 WP_003898755.1.49678 WP_003898755.1.49687 WP_003898755.1.49699 WP_003898755.1.49709 WP_003898755.1.4971 WP_003898755.1.4972 WP_003898755.1.49736 WP_003898755.1.49746 WP_003898755.1.49796 WP_003898755.1.49814 WP_003898755.1.49815 WP_003898755.1.49816 WP_003898755.1.49857 WP_003898755.1.49880 WP_003898755.1.49944 WP_003898755.1.49990 WP_003898755.1.50068 WP_003898755.1.50077 WP_003898755.1.5008 WP_003898755.1.50122 WP_003898755.1.50126 WP_003898755.1.50149 WP_003898755.1.50162 WP_003898755.1.5018 WP_003898755.1.50194 WP_003898755.1.50218 WP_003898755.1.50249 WP_003898755.1.50265 WP_003898755.1.50324 WP_003898755.1.50347 WP_003898755.1.50372 WP_003898755.1.50398 WP_003898755.1.50407 WP_003898755.1.50444 WP_003898755.1.50466 WP_003898755.1.5048 WP_003898755.1.50498 WP_003898755.1.5050 WP_003898755.1.50540 WP_003898755.1.50554 WP_003898755.1.50557 WP_003898755.1.50610 WP_003898755.1.50632 WP_003898755.1.50633 WP_003898755.1.50655 WP_003898755.1.50659 WP_003898755.1.50683 WP_003898755.1.50689 WP_003898755.1.50692 WP_003898755.1.50714 WP_003898755.1.50729 WP_003898755.1.50756 WP_003898755.1.50784 WP_003898755.1.50877 WP_003898755.1.5096 WP_003898755.1.50981 WP_003898755.1.50987 WP_003898755.1.51003 WP_003898755.1.51009 WP_003898755.1.51037 WP_003898755.1.51074 WP_003898755.1.51082 WP_003898755.1.51101 WP_003898755.1.51149 WP_003898755.1.51156 WP_003898755.1.51213 WP_003898755.1.51232 WP_003898755.1.51239 WP_003898755.1.51266 WP_003898755.1.51291 WP_003898755.1.51294 WP_003898755.1.51301 WP_003898755.1.51329 WP_003898755.1.51391 WP_003898755.1.51422 WP_003898755.1.51445 WP_003898755.1.51455 WP_003898755.1.51466 WP_003898755.1.51478 WP_003898755.1.51497 WP_003898755.1.51520 WP_003898755.1.51628 WP_003898755.1.5164 WP_003898755.1.51660 WP_003898755.1.51696 WP_003898755.1.51788 WP_003898755.1.51795 WP_003898755.1.51801 WP_003898755.1.51817 WP_003898755.1.51819 WP_003898755.1.51854 WP_003898755.1.51923 WP_003898755.1.51942 WP_003898755.1.51948 WP_003898755.1.51963 WP_003898755.1.51969 WP_003898755.1.52000 WP_003898755.1.52003 WP_003898755.1.52036 WP_003898755.1.52046 WP_003898755.1.52059 WP_003898755.1.52082 WP_003898755.1.52102 WP_003898755.1.52166 WP_003898755.1.52168 WP_003898755.1.52173 WP_003898755.1.52178 WP_003898755.1.52206 WP_003898755.1.52216 WP_003898755.1.52238 WP_003898755.1.52241 WP_003898755.1.52280 WP_003898755.1.52314 WP_003898755.1.52390 WP_003898755.1.524 WP_003898755.1.52460 WP_003898755.1.52485 WP_003898755.1.52486 WP_003898755.1.52495 WP_003898755.1.52504 WP_003898755.1.52522 WP_003898755.1.52531 WP_003898755.1.52533 WP_003898755.1.52545 WP_003898755.1.52553 WP_003898755.1.52563 WP_003898755.1.52564 WP_003898755.1.52574 WP_003898755.1.52641 WP_003898755.1.52673 WP_003898755.1.52674 WP_003898755.1.52708 WP_003898755.1.52713 WP_003898755.1.52761 WP_003898755.1.52797 WP_003898755.1.52872 WP_003898755.1.52873 WP_003898755.1.52891 WP_003898755.1.52892 WP_003898755.1.52909 WP_003898755.1.52970 WP_003898755.1.53053 WP_003898755.1.53056 WP_003898755.1.5306 WP_003898755.1.53088 WP_003898755.1.5309 WP_003898755.1.531 WP_003898755.1.53117 WP_003898755.1.53118 WP_003898755.1.53142 WP_003898755.1.53143 WP_003898755.1.53157 WP_003898755.1.53200 WP_003898755.1.53213 WP_003898755.1.53217 WP_003898755.1.53226 WP_003898755.1.53237 WP_003898755.1.53254 WP_003898755.1.53257 WP_003898755.1.5327 WP_003898755.1.53278 WP_003898755.1.533 WP_003898755.1.5334 WP_003898755.1.5335 WP_003898755.1.53353 WP_003898755.1.53381 WP_003898755.1.53413 WP_003898755.1.53458 WP_003898755.1.53460 WP_003898755.1.53480 WP_003898755.1.53517 WP_003898755.1.53522 WP_003898755.1.53525 WP_003898755.1.53526 WP_003898755.1.53553 WP_003898755.1.53606 WP_003898755.1.53628 WP_003898755.1.53643 WP_003898755.1.53667 WP_003898755.1.53715 WP_003898755.1.53730 WP_003898755.1.53742 WP_003898755.1.53743 WP_003898755.1.53754 WP_003898755.1.53775 WP_003898755.1.53803 WP_003898755.1.53818 WP_003898755.1.53822 WP_003898755.1.53853 WP_003898755.1.53865 WP_003898755.1.53888 WP_003898755.1.53900 WP_003898755.1.53912 WP_003898755.1.53914 WP_003898755.1.53952 WP_003898755.1.5398 WP_003898755.1.5408 WP_003898755.1.54089 WP_003898755.1.54125 WP_003898755.1.54141 WP_003898755.1.54162 WP_003898755.1.54179 WP_003898755.1.54206 WP_003898755.1.54225 WP_003898755.1.54227 WP_003898755.1.54232 WP_003898755.1.54241 WP_003898755.1.54245 WP_003898755.1.54247 WP_003898755.1.54260 WP_003898755.1.54275 WP_003898755.1.54294 WP_003898755.1.54351 WP_003898755.1.54428 WP_003898755.1.54494 WP_003898755.1.54514 WP_003898755.1.54519 WP_003898755.1.5452 WP_003898755.1.54531 WP_003898755.1.54537 WP_003898755.1.54553 WP_003898755.1.54575 WP_003898755.1.54633 WP_003898755.1.54686 WP_003898755.1.54687 WP_003898755.1.54705 WP_003898755.1.54730 WP_003898755.1.54732 WP_003898755.1.5475 WP_003898755.1.54807 WP_003898755.1.54836 WP_003898755.1.54838 WP_003898755.1.54860 WP_003898755.1.54888 WP_003898755.1.54905 WP_003898755.1.54909 WP_003898755.1.54937 WP_003898755.1.54944 WP_003898755.1.54945 WP_003898755.1.54953 WP_003898755.1.54964 WP_003898755.1.55015 WP_003898755.1.55023 WP_003898755.1.55051 WP_003898755.1.55072 WP_003898755.1.55106 WP_003898755.1.55126 WP_003898755.1.55128 WP_003898755.1.55140 WP_003898755.1.55150 WP_003898755.1.55210 WP_003898755.1.55227 WP_003898755.1.55248 WP_003898755.1.55257 WP_003898755.1.55267 WP_003898755.1.55307 WP_003898755.1.55328 WP_003898755.1.55396 WP_003898755.1.55398 WP_003898755.1.55459 WP_003898755.1.55501 WP_003898755.1.55504 WP_003898755.1.55578 WP_003898755.1.55626 WP_003898755.1.55641 WP_003898755.1.5569 WP_003898755.1.55723 WP_003898755.1.55735 WP_003898755.1.5574 WP_003898755.1.55772 WP_003898755.1.55802 WP_003898755.1.55807 WP_003898755.1.55821 WP_003898755.1.5583 WP_003898755.1.55856 WP_003898755.1.55860 WP_003898755.1.55882 WP_003898755.1.55883 WP_003898755.1.55894 WP_003898755.1.55902 WP_003898755.1.55908 WP_003898755.1.55909 WP_003898755.1.5591 WP_003898755.1.55961 WP_003898755.1.55977 WP_003898755.1.56028 WP_003898755.1.56057 WP_003898755.1.56060 WP_003898755.1.56107 WP_003898755.1.56163 WP_003898755.1.56167 WP_003898755.1.56178 WP_003898755.1.56287 WP_003898755.1.56292 WP_003898755.1.56327 WP_003898755.1.56341 WP_003898755.1.56359 WP_003898755.1.56365 WP_003898755.1.56394 WP_003898755.1.56443 WP_003898755.1.56473 WP_003898755.1.56478 WP_003898755.1.56500 WP_003898755.1.56517 WP_003898755.1.56534 WP_003898755.1.56577 WP_003898755.1.56593 WP_003898755.1.56625 WP_003898755.1.56637 WP_003898755.1.56697 WP_003898755.1.567 WP_003898755.1.56701 WP_003898755.1.56709 WP_003898755.1.56743 WP_003898755.1.56755 WP_003898755.1.56764 WP_003898755.1.56769 WP_003898755.1.56795 WP_003898755.1.5681 WP_003898755.1.56827 WP_003898755.1.56839 WP_003898755.1.56863 WP_003898755.1.56868 WP_003898755.1.56869 WP_003898755.1.56915 WP_003898755.1.56926 WP_003898755.1.56961 WP_003898755.1.56971 WP_003898755.1.56972 WP_003898755.1.57023 WP_003898755.1.57087 WP_003898755.1.57134 WP_003898755.1.57169 WP_003898755.1.57208 WP_003898755.1.57212 WP_003898755.1.57230 WP_003898755.1.5724 WP_003898755.1.5725 WP_003898755.1.5727 WP_003898755.1.57273 WP_003898755.1.57314 WP_003898755.1.57326 WP_003898755.1.57328 WP_003898755.1.57340 WP_003898755.1.57351 WP_003898755.1.57352 WP_003898755.1.57380 WP_003898755.1.57430 WP_003898755.1.5744 WP_003898755.1.57440 WP_003898755.1.57461 WP_003898755.1.57469 WP_003898755.1.57489 WP_003898755.1.575 WP_003898755.1.57509 WP_003898755.1.57519 WP_003898755.1.57525 WP_003898755.1.57551 WP_003898755.1.5758 WP_003898755.1.57604 WP_003898755.1.57619 WP_003898755.1.57627 WP_003898755.1.57689 WP_003898755.1.57708 WP_003898755.1.57794 WP_003898755.1.57825 WP_003898755.1.57843 WP_003898755.1.57906 WP_003898755.1.57926 WP_003898755.1.57957 WP_003898755.1.57964 WP_003898755.1.57991 WP_003898755.1.58086 WP_003898755.1.58103 WP_003898755.1.58108 WP_003898755.1.5811 WP_003898755.1.58121 WP_003898755.1.58145 WP_003898755.1.58164 WP_003898755.1.58174 WP_003898755.1.582 WP_003898755.1.58209 WP_003898755.1.58259 WP_003898755.1.58283 WP_003898755.1.5830 WP_003898755.1.58303 WP_003898755.1.58311 WP_003898755.1.58330 WP_003898755.1.58386 WP_003898755.1.58393 WP_003898755.1.58431 WP_003898755.1.5844 WP_003898755.1.58457 WP_003898755.1.58488 WP_003898755.1.58518 WP_003898755.1.58534 WP_003898755.1.58559 WP_003898755.1.58567 WP_003898755.1.58573 WP_003898755.1.58602 WP_003898755.1.58612 WP_003898755.1.58619 WP_003898755.1.58630 WP_003898755.1.5865 WP_003898755.1.58671 WP_003898755.1.58690 WP_003898755.1.5879 WP_003898755.1.5881 WP_003898755.1.58848 WP_003898755.1.58857 WP_003898755.1.58891 WP_003898755.1.58892 WP_003898755.1.5890 WP_003898755.1.58921 WP_003898755.1.58930 WP_003898755.1.58953 WP_003898755.1.58961 WP_003898755.1.5898 WP_003898755.1.59025 WP_003898755.1.59037 WP_003898755.1.59044 WP_003898755.1.59112 WP_003898755.1.59130 WP_003898755.1.5914 WP_003898755.1.59147 WP_003898755.1.59166 WP_003898755.1.59205 WP_003898755.1.59209 WP_003898755.1.59237 WP_003898755.1.59240 WP_003898755.1.59254 WP_003898755.1.59262 WP_003898755.1.59270 WP_003898755.1.5928 WP_003898755.1.59304 WP_003898755.1.59305 WP_003898755.1.59309 WP_003898755.1.59326 WP_003898755.1.59328 WP_003898755.1.59333 WP_003898755.1.59338 WP_003898755.1.59487 WP_003898755.1.59537 WP_003898755.1.59561 WP_003898755.1.59677 WP_003898755.1.59722 WP_003898755.1.59732 WP_003898755.1.59738 WP_003898755.1.59750 WP_003898755.1.59757 WP_003898755.1.59808 WP_003898755.1.59850 WP_003898755.1.59860 WP_003898755.1.59861 WP_003898755.1.59952 WP_003898755.1.59974 WP_003898755.1.6000 WP_003898755.1.6003 WP_003898755.1.6007 WP_003898755.1.60121 WP_003898755.1.60125 WP_003898755.1.60135 WP_003898755.1.60139 WP_003898755.1.60152 WP_003898755.1.60171 WP_003898755.1.60197 WP_003898755.1.6020 WP_003898755.1.60205 WP_003898755.1.60207 WP_003898755.1.60217 WP_003898755.1.60267 WP_003898755.1.60288 WP_003898755.1.60301 WP_003898755.1.60305 WP_003898755.1.60312 WP_003898755.1.60313 WP_003898755.1.60314 WP_003898755.1.60376 WP_003898755.1.60403 WP_003898755.1.60413 WP_003898755.1.60421 WP_003898755.1.60451 WP_003898755.1.60460 WP_003898755.1.60512 WP_003898755.1.60573 WP_003898755.1.60583 WP_003898755.1.60632 WP_003898755.1.60657 WP_003898755.1.60687 WP_003898755.1.60689 WP_003898755.1.60727 WP_003898755.1.60763 WP_003898755.1.6077 WP_003898755.1.60791 WP_003898755.1.60834 WP_003898755.1.60870 WP_003898755.1.60878 WP_003898755.1.60879 WP_003898755.1.60978 WP_003898755.1.61000 WP_003898755.1.61014 WP_003898755.1.61037 WP_003898755.1.61052 WP_003898755.1.61065 WP_003898755.1.61100 WP_003898755.1.61101 WP_003898755.1.61138 WP_003898755.1.61142 WP_003898755.1.61234 WP_003898755.1.61281 WP_003898755.1.61314 WP_003898755.1.61321 WP_003898755.1.61326 WP_003898755.1.61328 WP_003898755.1.61368 WP_003898755.1.61391 WP_003898755.1.61406 WP_003898755.1.61420 WP_003898755.1.61422 WP_003898755.1.61425 WP_003898755.1.61469 WP_003898755.1.61494 WP_003898755.1.61552 WP_003898755.1.61557 WP_003898755.1.61567 WP_003898755.1.61571 WP_003898755.1.61586 WP_003898755.1.6159 WP_003898755.1.61592 WP_003898755.1.6160 WP_003898755.1.61614 WP_003898755.1.6163 WP_003898755.1.61655 WP_003898755.1.61665 WP_003898755.1.61669 WP_003898755.1.61682 WP_003898755.1.61692 WP_003898755.1.61719 WP_003898755.1.61728 WP_003898755.1.61754 WP_003898755.1.61755 WP_003898755.1.61757 WP_003898755.1.6179 WP_003898755.1.61816 WP_003898755.1.61842 WP_003898755.1.61862 WP_003898755.1.61865 WP_003898755.1.61868 WP_003898755.1.61911 WP_003898755.1.61941 WP_003898755.1.61979 WP_003898755.1.61986 WP_003898755.1.61987 WP_003898755.1.61998 WP_003898755.1.62089 WP_003898755.1.62101 WP_003898755.1.62104 WP_003898755.1.6211 WP_003898755.1.62132 WP_003898755.1.62162 WP_003898755.1.62225 WP_003898755.1.62230 WP_003898755.1.62238 WP_003898755.1.62249 WP_003898755.1.62270 WP_003898755.1.62281 WP_003898755.1.62307 WP_003898755.1.6231 WP_003898755.1.62359 WP_003898755.1.62371 WP_003898755.1.62395 WP_003898755.1.62449 WP_003898755.1.62468 WP_003898755.1.6248 WP_003898755.1.62508 WP_003898755.1.62594 WP_003898755.1.62606 WP_003898755.1.62687 WP_003898755.1.62715 WP_003898755.1.62730 WP_003898755.1.62738 WP_003898755.1.62766 WP_003898755.1.62813 WP_003898755.1.62839 WP_003898755.1.62841 WP_003898755.1.62936 WP_003898755.1.6294 WP_003898755.1.63007 WP_003898755.1.63019 WP_003898755.1.63032 WP_003898755.1.63037 WP_003898755.1.63064 WP_003898755.1.63066 WP_003898755.1.63072 WP_003898755.1.6308 WP_003898755.1.63081 WP_003898755.1.63096 WP_003898755.1.63106 WP_003898755.1.63144 WP_003898755.1.63154 WP_003898755.1.63160 WP_003898755.1.63161 WP_003898755.1.63166 WP_003898755.1.63175 WP_003898755.1.63194 WP_003898755.1.63247 WP_003898755.1.63291 WP_003898755.1.63312 WP_003898755.1.63317 WP_003898755.1.63331 WP_003898755.1.63403 WP_003898755.1.63428 WP_003898755.1.6345 WP_003898755.1.63464 WP_003898755.1.63483 WP_003898755.1.63522 WP_003898755.1.63530 WP_003898755.1.63564 WP_003898755.1.63567 WP_003898755.1.63600 WP_003898755.1.63623 WP_003898755.1.63625 WP_003898755.1.63627 WP_003898755.1.63654 WP_003898755.1.63662 WP_003898755.1.63711 WP_003898755.1.63734 WP_003898755.1.63807 WP_003898755.1.63819 WP_003898755.1.63888 WP_003898755.1.63913 WP_003898755.1.63918 WP_003898755.1.63970 WP_003898755.1.64000 WP_003898755.1.64027 WP_003898755.1.64058 WP_003898755.1.64065 WP_003898755.1.6407 WP_003898755.1.64091 WP_003898755.1.64102 WP_003898755.1.64104 WP_003898755.1.64219 WP_003898755.1.6422 WP_003898755.1.64222 WP_003898755.1.64223 WP_003898755.1.64228 WP_003898755.1.64235 WP_003898755.1.64249 WP_003898755.1.6427 WP_003898755.1.64278 WP_003898755.1.64287 WP_003898755.1.64414 WP_003898755.1.64419 WP_003898755.1.6443 WP_003898755.1.64480 WP_003898755.1.64497 WP_003898755.1.64506 WP_003898755.1.64511 WP_003898755.1.64513 WP_003898755.1.64514 WP_003898755.1.64515 WP_003898755.1.64522 WP_003898755.1.64543 WP_003898755.1.64567 WP_003898755.1.64588 WP_003898755.1.64589 WP_003898755.1.64594 WP_003898755.1.64595 WP_003898755.1.64608 WP_003898755.1.64619 WP_003898755.1.64629 WP_003898755.1.6464 WP_003898755.1.64664 WP_003898755.1.64669 WP_003898755.1.64672 WP_003898755.1.64680 WP_003898755.1.64682 WP_003898755.1.64729 WP_003898755.1.64774 WP_003898755.1.64776 WP_003898755.1.64832 WP_003898755.1.6486 WP_003898755.1.64898 WP_003898755.1.64922 WP_003898755.1.64924 WP_003898755.1.6493 WP_003898755.1.64973 WP_003898755.1.65001 WP_003898755.1.65026 WP_003898755.1.65070 WP_003898755.1.65079 WP_003898755.1.65102 WP_003898755.1.65157 WP_003898755.1.65229 WP_003898755.1.6523 WP_003898755.1.65253 WP_003898755.1.65289 WP_003898755.1.65291 WP_003898755.1.65315 WP_003898755.1.65329 WP_003898755.1.65359 WP_003898755.1.65374 WP_003898755.1.65386 WP_003898755.1.65414 WP_003898755.1.65416 WP_003898755.1.65433 WP_003898755.1.65455 WP_003898755.1.65467 WP_003898755.1.65488 WP_003898755.1.65529 WP_003898755.1.65539 WP_003898755.1.65583 WP_003898755.1.65612 WP_003898755.1.65623 WP_003898755.1.65635 WP_003898755.1.65637 WP_003898755.1.65648 WP_003898755.1.65683 WP_003898755.1.65686 WP_003898755.1.65688 WP_003898755.1.65707 WP_003898755.1.65733 WP_003898755.1.65746 WP_003898755.1.65747 WP_003898755.1.65830 WP_003898755.1.65858 WP_003898755.1.65869 WP_003898755.1.65893 WP_003898755.1.65929 WP_003898755.1.65958 WP_003898755.1.66004 WP_003898755.1.6606 WP_003898755.1.66089 WP_003898755.1.66149 WP_003898755.1.66151 WP_003898755.1.66293 WP_003898755.1.66297 WP_003898755.1.66323 WP_003898755.1.6633 WP_003898755.1.66334 WP_003898755.1.66355 WP_003898755.1.66367 WP_003898755.1.66394 WP_003898755.1.66396 WP_003898755.1.66451 WP_003898755.1.66457 WP_003898755.1.66464 WP_003898755.1.66504 WP_003898755.1.66544 WP_003898755.1.66580 WP_003898755.1.66582 WP_003898755.1.66617 WP_003898755.1.66635 WP_003898755.1.66656 WP_003898755.1.66663 WP_003898755.1.66675 WP_003898755.1.66715 WP_003898755.1.66718 WP_003898755.1.66762 WP_003898755.1.66776 WP_003898755.1.66808 WP_003898755.1.66817 WP_003898755.1.66819 WP_003898755.1.66826 WP_003898755.1.66830 WP_003898755.1.66842 WP_003898755.1.66868 WP_003898755.1.66878 WP_003898755.1.66880 WP_003898755.1.66893 WP_003898755.1.67005 WP_003898755.1.6704 WP_003898755.1.67044 WP_003898755.1.67061 WP_003898755.1.67098 WP_003898755.1.67170 WP_003898755.1.67197 WP_003898755.1.67198 WP_003898755.1.6720 WP_003898755.1.67207 WP_003898755.1.67218 WP_003898755.1.67220 WP_003898755.1.67225 WP_003898755.1.67231 WP_003898755.1.6724 WP_003898755.1.67257 WP_003898755.1.67298 WP_003898755.1.67307 WP_003898755.1.67324 WP_003898755.1.67332 WP_003898755.1.67360 WP_003898755.1.67422 WP_003898755.1.67453 WP_003898755.1.67459 WP_003898755.1.67473 WP_003898755.1.67482 WP_003898755.1.67496 WP_003898755.1.67499 WP_003898755.1.67536 WP_003898755.1.67575 WP_003898755.1.67587 WP_003898755.1.67598 WP_003898755.1.67600 WP_003898755.1.67602 WP_003898755.1.67679 WP_003898755.1.67692 WP_003898755.1.67744 WP_003898755.1.67750 WP_003898755.1.6777 WP_003898755.1.67809 WP_003898755.1.67816 WP_003898755.1.67844 WP_003898755.1.67870 WP_003898755.1.67915 WP_003898755.1.67945 WP_003898755.1.67949 WP_003898755.1.67980 WP_003898755.1.67982 WP_003898755.1.68022 WP_003898755.1.68037 WP_003898755.1.68038 WP_003898755.1.68045 WP_003898755.1.68057 WP_003898755.1.68088 WP_003898755.1.68106 WP_003898755.1.68110 WP_003898755.1.68164 WP_003898755.1.68193 WP_003898755.1.68212 WP_003898755.1.68227 WP_003898755.1.68243 WP_003898755.1.6825 WP_003898755.1.68297 WP_003898755.1.68309 WP_003898755.1.68325 WP_003898755.1.68329 WP_003898755.1.68340 WP_003898755.1.68384 WP_003898755.1.68388 WP_003898755.1.68444 WP_003898755.1.68465 WP_003898755.1.68484 WP_003898755.1.68580 WP_003898755.1.68586 WP_003898755.1.68623 WP_003898755.1.68624 WP_003898755.1.68646 WP_003898755.1.68672 WP_003898755.1.68684 WP_003898755.1.68704 WP_003898755.1.68708 WP_003898755.1.6872 WP_003898755.1.68730 WP_003898755.1.68734 WP_003898755.1.68761 WP_003898755.1.68763 WP_003898755.1.68766 WP_003898755.1.68774 WP_003898755.1.68796 WP_003898755.1.68824 WP_003898755.1.68832 WP_003898755.1.68833 WP_003898755.1.68841 WP_003898755.1.68859 WP_003898755.1.68876 WP_003898755.1.68906 WP_003898755.1.68916 WP_003898755.1.68923 WP_003898755.1.68945 WP_003898755.1.6896 WP_003898755.1.68981 WP_003898755.1.68984 WP_003898755.1.68997 WP_003898755.1.69076 WP_003898755.1.69079 WP_003898755.1.6908 WP_003898755.1.69082 WP_003898755.1.69178 WP_003898755.1.69208 WP_003898755.1.69231 WP_003898755.1.69311 WP_003898755.1.69315 WP_003898755.1.69322 WP_003898755.1.69342 WP_003898755.1.6936 WP_003898755.1.69374 WP_003898755.1.69398 WP_003898755.1.69401 WP_003898755.1.69426 WP_003898755.1.69429 WP_003898755.1.6949 WP_003898755.1.6951 WP_003898755.1.69526 WP_003898755.1.69528 WP_003898755.1.69547 WP_003898755.1.69573 WP_003898755.1.69581 WP_003898755.1.6960 WP_003898755.1.69617 WP_003898755.1.69634 WP_003898755.1.69647 WP_003898755.1.69659 WP_003898755.1.69673 WP_003898755.1.69682 WP_003898755.1.69684 WP_003898755.1.69709 WP_003898755.1.69723 WP_003898755.1.69736 WP_003898755.1.69778 WP_003898755.1.69800 WP_003898755.1.69802 WP_003898755.1.69845 WP_003898755.1.69870 WP_003898755.1.69913 WP_003898755.1.69925 WP_003898755.1.69955 WP_003898755.1.69981 WP_003898755.1.69990 WP_003898755.1.70 WP_003898755.1.70000 WP_003898755.1.70017 WP_003898755.1.70055 WP_003898755.1.70062 WP_003898755.1.70072 WP_003898755.1.70131 WP_003898755.1.70132 WP_003898755.1.7022 WP_003898755.1.70227 WP_003898755.1.70255 WP_003898755.1.70271 WP_003898755.1.70274 WP_003898755.1.70325 WP_003898755.1.70356 WP_003898755.1.70364 WP_003898755.1.70368 WP_003898755.1.70369 WP_003898755.1.70418 WP_003898755.1.70422 WP_003898755.1.70444 WP_003898755.1.70463 WP_003898755.1.70471 WP_003898755.1.70480 WP_003898755.1.70494 WP_003898755.1.70498 WP_003898755.1.70525 WP_003898755.1.70573 WP_003898755.1.70577 WP_003898755.1.70610 WP_003898755.1.70615 WP_003898755.1.70618 WP_003898755.1.70622 WP_003898755.1.70626 WP_003898755.1.70668 WP_003898755.1.70699 WP_003898755.1.70729 WP_003898755.1.70757 WP_003898755.1.70782 WP_003898755.1.70830 WP_003898755.1.7084 WP_003898755.1.70840 WP_003898755.1.70864 WP_003898755.1.70871 WP_003898755.1.70955 WP_003898755.1.70958 WP_003898755.1.70964 WP_003898755.1.70976 WP_003898755.1.71015 WP_003898755.1.71076 WP_003898755.1.71083 WP_003898755.1.7111 WP_003898755.1.7113 WP_003898755.1.71187 WP_003898755.1.71191 WP_003898755.1.71258 WP_003898755.1.71259 WP_003898755.1.71326 WP_003898755.1.71331 WP_003898755.1.71344 WP_003898755.1.71390 WP_003898755.1.71399 WP_003898755.1.71457 WP_003898755.1.71464 WP_003898755.1.71492 WP_003898755.1.71516 WP_003898755.1.71517 WP_003898755.1.71527 WP_003898755.1.71545 WP_003898755.1.71546 WP_003898755.1.71604 WP_003898755.1.71630 WP_003898755.1.71638 WP_003898755.1.71654 WP_003898755.1.71664 WP_003898755.1.71665 WP_003898755.1.71683 WP_003898755.1.71701 WP_003898755.1.71718 WP_003898755.1.71731 WP_003898755.1.71778 WP_003898755.1.71781 WP_003898755.1.71803 WP_003898755.1.71847 WP_003898755.1.7185 WP_003898755.1.71851 WP_003898755.1.71871 WP_003898755.1.71909 WP_003898755.1.71957 WP_003898755.1.72047 WP_003898755.1.72061 WP_003898755.1.72072 WP_003898755.1.72111 WP_003898755.1.72128 WP_003898755.1.72143 WP_003898755.1.72168 WP_003898755.1.72179 WP_003898755.1.72227 WP_003898755.1.7224 WP_003898755.1.72268 WP_003898755.1.72332 WP_003898755.1.72380 WP_003898755.1.72401 WP_003898755.1.72405 WP_003898755.1.72441 WP_003898755.1.72451 WP_003898755.1.72452 WP_003898755.1.72459 WP_003898755.1.72460 WP_003898755.1.72487 WP_003898755.1.72488 WP_003898755.1.72492 WP_003898755.1.72506 WP_003898755.1.72543 WP_003898755.1.7256 WP_003898755.1.72576 WP_003898755.1.72578 WP_003898755.1.72585 WP_003898755.1.72591 WP_003898755.1.72592 WP_003898755.1.72684 WP_003898755.1.72744 WP_003898755.1.72755 WP_003898755.1.72792 WP_003898755.1.72826 WP_003898755.1.72852 WP_003898755.1.72853 WP_003898755.1.72938 WP_003898755.1.72954 WP_003898755.1.72957 WP_003898755.1.72982 WP_003898755.1.72993 WP_003898755.1.73006 WP_003898755.1.73013 WP_003898755.1.73025 WP_003898755.1.73028 WP_003898755.1.73045 WP_003898755.1.73118 WP_003898755.1.7312 WP_003898755.1.73134 WP_003898755.1.73154 WP_003898755.1.73163 WP_003898755.1.73182 WP_003898755.1.73205 WP_003898755.1.7321 WP_003898755.1.73310 WP_003898755.1.73365 WP_003898755.1.73404 WP_003898755.1.73424 WP_003898755.1.73436 WP_003898755.1.73445 WP_003898755.1.73453 WP_003898755.1.73470 WP_003898755.1.73471 WP_003898755.1.73478 WP_003898755.1.73507 WP_003898755.1.73532 WP_003898755.1.73623 WP_003898755.1.73629 WP_003898755.1.7366 WP_003898755.1.73661 WP_003898755.1.7368 WP_003898755.1.73688 WP_003898755.1.73723 WP_003898755.1.73750 WP_003898755.1.7379 WP_003898755.1.73813 WP_003898755.1.73840 WP_003898755.1.73876 WP_003898755.1.74016 WP_003898755.1.74039 WP_003898755.1.74083 WP_003898755.1.74101 WP_003898755.1.74107 WP_003898755.1.74129 WP_003898755.1.74144 WP_003898755.1.7417 WP_003898755.1.74190 WP_003898755.1.74210 WP_003898755.1.74262 WP_003898755.1.74269 WP_003898755.1.74282 WP_003898755.1.74291 WP_003898755.1.74296 WP_003898755.1.74304 WP_003898755.1.7432 WP_003898755.1.74347 WP_003898755.1.7436 WP_003898755.1.74382 WP_003898755.1.74395 WP_003898755.1.74400 WP_003898755.1.74432 WP_003898755.1.74442 WP_003898755.1.74487 WP_003898755.1.74499 WP_003898755.1.74511 WP_003898755.1.74523 WP_003898755.1.74525 WP_003898755.1.74551 WP_003898755.1.74555 WP_003898755.1.74628 WP_003898755.1.74653 WP_003898755.1.74660 WP_003898755.1.74683 WP_003898755.1.7469 WP_003898755.1.74725 WP_003898755.1.74760 WP_003898755.1.74786 WP_003898755.1.74809 WP_003898755.1.74820 WP_003898755.1.74870 WP_003898755.1.74881 WP_003898755.1.74952 WP_003898755.1.7496 WP_003898755.1.74988 WP_003898755.1.75078 WP_003898755.1.75120 WP_003898755.1.75200 WP_003898755.1.75202 WP_003898755.1.75234 WP_003898755.1.75239 WP_003898755.1.75263 WP_003898755.1.75342 WP_003898755.1.75376 WP_003898755.1.75395 WP_003898755.1.75510 WP_003898755.1.75598 WP_003898755.1.75645 WP_003898755.1.75671 WP_003898755.1.75741 WP_003898755.1.75749 WP_003898755.1.75772 WP_003898755.1.75774 WP_003898755.1.75811 WP_003898755.1.75833 WP_003898755.1.7585 WP_003898755.1.75868 WP_003898755.1.75878 WP_003898755.1.75927 WP_003898755.1.75946 WP_003898755.1.75968 WP_003898755.1.75974 WP_003898755.1.76007 WP_003898755.1.76032 WP_003898755.1.7604 WP_003898755.1.76045 WP_003898755.1.76052 WP_003898755.1.76058 WP_003898755.1.76064 WP_003898755.1.76110 WP_003898755.1.76138 WP_003898755.1.76157 WP_003898755.1.76172 WP_003898755.1.76177 WP_003898755.1.76183 WP_003898755.1.76209 WP_003898755.1.76277 WP_003898755.1.76280 WP_003898755.1.76281 WP_003898755.1.76297 WP_003898755.1.76360 WP_003898755.1.76403 WP_003898755.1.76413 WP_003898755.1.76414 WP_003898755.1.76427 WP_003898755.1.76436 WP_003898755.1.76442 WP_003898755.1.76443 WP_003898755.1.76456 WP_003898755.1.76533 WP_003898755.1.76616 WP_003898755.1.76625 WP_003898755.1.76629 WP_003898755.1.76635 WP_003898755.1.76638 WP_003898755.1.76639 WP_003898755.1.76640 WP_003898755.1.76644 WP_003898755.1.76677 WP_003898755.1.76678 WP_003898755.1.76679 WP_003898755.1.76734 WP_003898755.1.76744 WP_003898755.1.76750 WP_003898755.1.76754 WP_003898755.1.76757 WP_003898755.1.76818 WP_003898755.1.76824 WP_003898755.1.76835 WP_003898755.1.76873 WP_003898755.1.76888 WP_003898755.1.76900 WP_003898755.1.7691 WP_003898755.1.76955 WP_003898755.1.76963 WP_003898755.1.770 WP_003898755.1.77000 WP_003898755.1.77008 WP_003898755.1.77021 WP_003898755.1.77056 WP_003898755.1.77065 WP_003898755.1.77075 WP_003898755.1.77107 WP_003898755.1.77115 WP_003898755.1.77118 WP_003898755.1.77125 WP_003898755.1.77141 WP_003898755.1.77142 WP_003898755.1.77285 WP_003898755.1.77312 WP_003898755.1.77351 WP_003898755.1.77352 WP_003898755.1.77361 WP_003898755.1.774 WP_003898755.1.77404 WP_003898755.1.77463 WP_003898755.1.77474 WP_003898755.1.7748 WP_003898755.1.77491 WP_003898755.1.77499 WP_003898755.1.77510 WP_003898755.1.77559 WP_003898755.1.77599 WP_003898755.1.7762 WP_003898755.1.77649 WP_003898755.1.77654 WP_003898755.1.7766 WP_003898755.1.77704 WP_003898755.1.77706 WP_003898755.1.7778 WP_003898755.1.77790 WP_003898755.1.77809 WP_003898755.1.77820 WP_003898755.1.77843 WP_003898755.1.77855 WP_003898755.1.77865 WP_003898755.1.77868 WP_003898755.1.77909 WP_003898755.1.77911 WP_003898755.1.77931 WP_003898755.1.77984 WP_003898755.1.78020 WP_003898755.1.78024 WP_003898755.1.78075 WP_003898755.1.78084 WP_003898755.1.78086 WP_003898755.1.7809 WP_003898755.1.78098 WP_003898755.1.78105 WP_003898755.1.78113 WP_003898755.1.78162 WP_003898755.1.78200 WP_003898755.1.78216 WP_003898755.1.78236 WP_003898755.1.78360 WP_003898755.1.78386 WP_003898755.1.78435 WP_003898755.1.7844 WP_003898755.1.78459 WP_003898755.1.78488 WP_003898755.1.7849 WP_003898755.1.78499 WP_003898755.1.785 WP_003898755.1.78516 WP_003898755.1.78524 WP_003898755.1.78526 WP_003898755.1.78538 WP_003898755.1.78545 WP_003898755.1.78547 WP_003898755.1.78574 WP_003898755.1.78580 WP_003898755.1.78620 WP_003898755.1.78646 WP_003898755.1.78648 WP_003898755.1.78649 WP_003898755.1.78655 WP_003898755.1.78692 WP_003898755.1.78760 WP_003898755.1.78766 WP_003898755.1.78776 WP_003898755.1.78778 WP_003898755.1.78784 WP_003898755.1.78790 WP_003898755.1.7887 WP_003898755.1.78932 WP_003898755.1.78969 WP_003898755.1.78977 WP_003898755.1.78980 WP_003898755.1.79005 WP_003898755.1.79016 WP_003898755.1.79066 WP_003898755.1.79068 WP_003898755.1.79095 WP_003898755.1.79122 WP_003898755.1.79145 WP_003898755.1.79152 WP_003898755.1.79163 WP_003898755.1.79182 WP_003898755.1.79198 WP_003898755.1.79218 WP_003898755.1.79268 WP_003898755.1.79278 WP_003898755.1.79290 WP_003898755.1.79319 WP_003898755.1.79330 WP_003898755.1.79339 WP_003898755.1.79394 WP_003898755.1.79399 WP_003898755.1.79413 WP_003898755.1.79422 WP_003898755.1.79445 WP_003898755.1.79447 WP_003898755.1.79455 WP_003898755.1.79471 WP_003898755.1.79488 WP_003898755.1.79502 WP_003898755.1.79514 WP_003898755.1.79561 WP_003898755.1.79565 WP_003898755.1.79578 WP_003898755.1.79588 WP_003898755.1.79598 WP_003898755.1.79615 WP_003898755.1.79684 WP_003898755.1.79698 WP_003898755.1.79784 WP_003898755.1.79806 WP_003898755.1.79819 WP_003898755.1.79826 WP_003898755.1.79828 WP_003898755.1.79851 WP_003898755.1.79853 WP_003898755.1.79863 WP_003898755.1.79881 WP_003898755.1.79885 WP_003898755.1.79898 WP_003898755.1.7990 WP_003898755.1.79900 WP_003898755.1.79913 WP_003898755.1.79918 WP_003898755.1.79948 WP_003898755.1.7997 WP_003898755.1.80004 WP_003898755.1.80015 WP_003898755.1.80022 WP_003898755.1.80030 WP_003898755.1.80054 WP_003898755.1.80099 WP_003898755.1.80129 WP_003898755.1.80177 WP_003898755.1.8026 WP_003898755.1.8029 WP_003898755.1.80299 WP_003898755.1.80304 WP_003898755.1.80326 WP_003898755.1.8037 WP_003898755.1.80370 WP_003898755.1.80399 WP_003898755.1.8044 WP_003898755.1.80451 WP_003898755.1.80461 WP_003898755.1.80503 WP_003898755.1.80507 WP_003898755.1.80552 WP_003898755.1.80576 WP_003898755.1.80588 WP_003898755.1.80599 WP_003898755.1.8060 WP_003898755.1.80673 WP_003898755.1.80714 WP_003898755.1.80743 WP_003898755.1.80784 WP_003898755.1.80815 WP_003898755.1.80853 WP_003898755.1.80918 WP_003898755.1.8093 WP_003898755.1.80967 WP_003898755.1.81007 WP_003898755.1.81013 WP_003898755.1.81063 WP_003898755.1.81066 WP_003898755.1.81091 WP_003898755.1.81119 WP_003898755.1.81125 WP_003898755.1.81136 WP_003898755.1.8114 WP_003898755.1.812 WP_003898755.1.81230 WP_003898755.1.81249 WP_003898755.1.81250 WP_003898755.1.81264 WP_003898755.1.8128 WP_003898755.1.81297 WP_003898755.1.8138 WP_003898755.1.81407 WP_003898755.1.8143 WP_003898755.1.81465 WP_003898755.1.81505 WP_003898755.1.81529 WP_003898755.1.81538 WP_003898755.1.81560 WP_003898755.1.81561 WP_003898755.1.81567 WP_003898755.1.81583 WP_003898755.1.81712 WP_003898755.1.81720 WP_003898755.1.81774 WP_003898755.1.81788 WP_003898755.1.81820 WP_003898755.1.81883 WP_003898755.1.81918 WP_003898755.1.82011 WP_003898755.1.82048 WP_003898755.1.82069 WP_003898755.1.82071 WP_003898755.1.82108 WP_003898755.1.82136 WP_003898755.1.82142 WP_003898755.1.8215 WP_003898755.1.82158 WP_003898755.1.82209 WP_003898755.1.82228 WP_003898755.1.82236 WP_003898755.1.82251 WP_003898755.1.82271 WP_003898755.1.82305 WP_003898755.1.82307 WP_003898755.1.82317 WP_003898755.1.8232 WP_003898755.1.82374 WP_003898755.1.82385 WP_003898755.1.82429 WP_003898755.1.82460 WP_003898755.1.82483 WP_003898755.1.82494 WP_003898755.1.82531 WP_003898755.1.82546 WP_003898755.1.82577 WP_003898755.1.82592 WP_003898755.1.82597 WP_003898755.1.82625 WP_003898755.1.82642 WP_003898755.1.82651 WP_003898755.1.82653 WP_003898755.1.82685 WP_003898755.1.8271 WP_003898755.1.82712 WP_003898755.1.8273 WP_003898755.1.82743 WP_003898755.1.82757 WP_003898755.1.82774 WP_003898755.1.82860 WP_003898755.1.82871 WP_003898755.1.82892 WP_003898755.1.82935 WP_003898755.1.82957 WP_003898755.1.82973 WP_003898755.1.82981 WP_003898755.1.82983 WP_003898755.1.83009 WP_003898755.1.83044 WP_003898755.1.83074 WP_003898755.1.83110 WP_003898755.1.83149 WP_003898755.1.83159 WP_003898755.1.8317 WP_003898755.1.83181 WP_003898755.1.83182 WP_003898755.1.83191 WP_003898755.1.83212 WP_003898755.1.8326 WP_003898755.1.83309 WP_003898755.1.83332 WP_003898755.1.83334 WP_003898755.1.83341 WP_003898755.1.83349 WP_003898755.1.83353 WP_003898755.1.83380 WP_003898755.1.83381 WP_003898755.1.83389 WP_003898755.1.83408 WP_003898755.1.83524 WP_003898755.1.83526 WP_003898755.1.8358 WP_003898755.1.83589 WP_003898755.1.83601 WP_003898755.1.83611 WP_003898755.1.83638 WP_003898755.1.83656 WP_003898755.1.83667 WP_003898755.1.83689 WP_003898755.1.83692 WP_003898755.1.83766 WP_003898755.1.83793 WP_003898755.1.83794 WP_003898755.1.83802 WP_003898755.1.83805 WP_003898755.1.83839 WP_003898755.1.83842 WP_003898755.1.83861 WP_003898755.1.83884 WP_003898755.1.83920 WP_003898755.1.83929 WP_003898755.1.83975 WP_003898755.1.83991 WP_003898755.1.8400 WP_003898755.1.84027 WP_003898755.1.8404 WP_003898755.1.84057 WP_003898755.1.84070 WP_003898755.1.8409 WP_003898755.1.84112 WP_003898755.1.84146 WP_003898755.1.8415 WP_003898755.1.84176 WP_003898755.1.84192 WP_003898755.1.84228 WP_003898755.1.8424 WP_003898755.1.84244 WP_003898755.1.84259 WP_003898755.1.84287 WP_003898755.1.84388 WP_003898755.1.84409 WP_003898755.1.84438 WP_003898755.1.84460 WP_003898755.1.84504 WP_003898755.1.84525 WP_003898755.1.84623 WP_003898755.1.84641 WP_003898755.1.84655 WP_003898755.1.84666 WP_003898755.1.84670 WP_003898755.1.84739 WP_003898755.1.84748 WP_003898755.1.84766 WP_003898755.1.84772 WP_003898755.1.84774 WP_003898755.1.848 WP_003898755.1.84812 WP_003898755.1.84836 WP_003898755.1.84846 WP_003898755.1.84938 WP_003898755.1.84968 WP_003898755.1.84973 WP_003898755.1.84981 WP_003898755.1.84985 WP_003898755.1.8503 WP_003898755.1.85038 WP_003898755.1.85043 WP_003898755.1.8505 WP_003898755.1.85074 WP_003898755.1.8509 WP_003898755.1.8512 WP_003898755.1.8518 WP_003898755.1.85242 WP_003898755.1.85281 WP_003898755.1.85284 WP_003898755.1.85314 WP_003898755.1.85319 WP_003898755.1.85330 WP_003898755.1.85341 WP_003898755.1.8535 WP_003898755.1.85363 WP_003898755.1.85371 WP_003898755.1.85377 WP_003898755.1.85399 WP_003898755.1.8546 WP_003898755.1.85478 WP_003898755.1.85480 WP_003898755.1.85488 WP_003898755.1.85495 WP_003898755.1.85551 WP_003898755.1.85557 WP_003898755.1.85577 WP_003898755.1.85599 WP_003898755.1.85610 WP_003898755.1.8563 WP_003898755.1.85648 WP_003898755.1.85679 WP_003898755.1.85704 WP_003898755.1.85763 WP_003898755.1.85808 WP_003898755.1.85819 WP_003898755.1.85820 WP_003898755.1.85832 WP_003898755.1.8586 WP_003898755.1.85894 WP_003898755.1.85913 WP_003898755.1.85953 WP_003898755.1.85986 WP_003898755.1.86000 WP_003898755.1.86024 WP_003898755.1.86025 WP_003898755.1.86032 WP_003898755.1.86048 WP_003898755.1.86052 WP_003898755.1.86067 WP_003898755.1.86122 WP_003898755.1.86124 WP_003898755.1.86160 WP_003898755.1.86164 WP_003898755.1.86190 WP_003898755.1.86204 WP_003898755.1.86249 WP_003898755.1.86260 WP_003898755.1.86290 WP_003898755.1.863 WP_003898755.1.86327 WP_003898755.1.86334 WP_003898755.1.86368 WP_003898755.1.86377 WP_003898755.1.86425 WP_003898755.1.86459 WP_003898755.1.86499 WP_003898755.1.86561 WP_003898755.1.86575 WP_003898755.1.86626 WP_003898755.1.86648 WP_003898755.1.86684 WP_003898755.1.86705 WP_003898755.1.86718 WP_003898755.1.86725 WP_003898755.1.86757 WP_003898755.1.86766 WP_003898755.1.86801 WP_003898755.1.86814 WP_003898755.1.86820 WP_003898755.1.86834 WP_003898755.1.86851 WP_003898755.1.86855 WP_003898755.1.86867 WP_003898755.1.86877 WP_003898755.1.86892 WP_003898755.1.86933 WP_003898755.1.86941 WP_003898755.1.86950 WP_003898755.1.86962 WP_003898755.1.86963 WP_003898755.1.86979 WP_003898755.1.8700 WP_003898755.1.87001 WP_003898755.1.87002 WP_003898755.1.87116 WP_003898755.1.8714 WP_003898755.1.87178 WP_003898755.1.87191 WP_003898755.1.87201 WP_003898755.1.87209 WP_003898755.1.87240 WP_003898755.1.87266 WP_003898755.1.87273 WP_003898755.1.87275 WP_003898755.1.8733 WP_003898755.1.87345 WP_003898755.1.87369 WP_003898755.1.8737 WP_003898755.1.87401 WP_003898755.1.87404 WP_003898755.1.87409 WP_003898755.1.87446 WP_003898755.1.87459 WP_003898755.1.87489 WP_003898755.1.87494 WP_003898755.1.87496 WP_003898755.1.87582 WP_003898755.1.87588 WP_003898755.1.87617 WP_003898755.1.87620 WP_003898755.1.87634 WP_003898755.1.87643 WP_003898755.1.8765 WP_003898755.1.87654 WP_003898755.1.87658 WP_003898755.1.87665 WP_003898755.1.87676 WP_003898755.1.87684 WP_003898755.1.87707 WP_003898755.1.87732 WP_003898755.1.87784 WP_003898755.1.87796 WP_003898755.1.87809 WP_003898755.1.87817 WP_003898755.1.87827 WP_003898755.1.87831 WP_003898755.1.87835 WP_003898755.1.87837 WP_003898755.1.87866 WP_003898755.1.8789 WP_003898755.1.87911 WP_003898755.1.87951 WP_003898755.1.87956 WP_003898755.1.87991 WP_003898755.1.88037 WP_003898755.1.88039 WP_003898755.1.88072 WP_003898755.1.88077 WP_003898755.1.88121 WP_003898755.1.88191 WP_003898755.1.88205 WP_003898755.1.88217 WP_003898755.1.88219 WP_003898755.1.88245 WP_003898755.1.88253 WP_003898755.1.88294 WP_003898755.1.88315 WP_003898755.1.88316 WP_003898755.1.88320 WP_003898755.1.8840 WP_003898755.1.88437 WP_003898755.1.88469 WP_003898755.1.88489 WP_003898755.1.88521 WP_003898755.1.88530 WP_003898755.1.88537 WP_003898755.1.88592 WP_003898755.1.88616 WP_003898755.1.88618 WP_003898755.1.88625 WP_003898755.1.88634 WP_003898755.1.88649 WP_003898755.1.8870 WP_003898755.1.88737 WP_003898755.1.888 WP_003898755.1.88824 WP_003898755.1.88886 WP_003898755.1.88965 WP_003898755.1.88985 WP_003898755.1.89025 WP_003898755.1.89162 WP_003898755.1.89168 WP_003898755.1.8917 WP_003898755.1.89205 WP_003898755.1.89207 WP_003898755.1.89225 WP_003898755.1.8925 WP_003898755.1.89286 WP_003898755.1.89293 WP_003898755.1.8935 WP_003898755.1.89371 WP_003898755.1.89378 WP_003898755.1.89406 WP_003898755.1.89473 WP_003898755.1.89475 WP_003898755.1.895 WP_003898755.1.89513 WP_003898755.1.89517 WP_003898755.1.89522 WP_003898755.1.89543 WP_003898755.1.89567 WP_003898755.1.8957 WP_003898755.1.89572 WP_003898755.1.89613 WP_003898755.1.89625 WP_003898755.1.89648 WP_003898755.1.8967 WP_003898755.1.89670 WP_003898755.1.89729 WP_003898755.1.89739 WP_003898755.1.89762 WP_003898755.1.8977 WP_003898755.1.89808 WP_003898755.1.8982 WP_003898755.1.89829 WP_003898755.1.89831 WP_003898755.1.89849 WP_003898755.1.8989 WP_003898755.1.89903 WP_003898755.1.89909 WP_003898755.1.89922 WP_003898755.1.89963 WP_003898755.1.8998 WP_003898755.1.89987 WP_003898755.1.900 WP_003898755.1.90048 WP_003898755.1.9007 WP_003898755.1.90080 WP_003898755.1.90130 WP_003898755.1.90134 WP_003898755.1.90137 WP_003898755.1.90157 WP_003898755.1.90184 WP_003898755.1.90199 WP_003898755.1.90231 WP_003898755.1.90245 WP_003898755.1.90308 WP_003898755.1.90328 WP_003898755.1.90372 WP_003898755.1.90481 WP_003898755.1.9050 WP_003898755.1.90550 WP_003898755.1.90560 WP_003898755.1.90612 WP_003898755.1.90640 WP_003898755.1.90672 WP_003898755.1.90691 WP_003898755.1.90711 WP_003898755.1.90722 WP_003898755.1.9075 WP_003898755.1.90756 WP_003898755.1.90767 WP_003898755.1.90771 WP_003898755.1.90785 WP_003898755.1.90788 WP_003898755.1.90800 WP_003898755.1.90810 WP_003898755.1.90816 WP_003898755.1.90819 WP_003898755.1.90899 WP_003898755.1.90906 WP_003898755.1.90958 WP_003898755.1.90976 WP_003898755.1.9102 WP_003898755.1.91026 WP_003898755.1.91032 WP_003898755.1.91053 WP_003898755.1.91082 WP_003898755.1.91106 WP_003898755.1.91144 WP_003898755.1.91167 WP_003898755.1.91169 WP_003898755.1.91192 WP_003898755.1.91201 WP_003898755.1.91208 WP_003898755.1.91214 WP_003898755.1.91230 WP_003898755.1.91251 WP_003898755.1.91265 WP_003898755.1.91294 WP_003898755.1.91322 WP_003898755.1.91386 WP_003898755.1.91398 WP_003898755.1.91430 WP_003898755.1.91436 WP_003898755.1.91483 WP_003898755.1.91507 WP_003898755.1.91694 WP_003898755.1.91695 WP_003898755.1.91717 WP_003898755.1.91743 WP_003898755.1.91759 WP_003898755.1.91784 WP_003898755.1.91785 WP_003898755.1.91786 WP_003898755.1.91802 WP_003898755.1.91822 WP_003898755.1.91896 WP_003898755.1.9190 WP_003898755.1.91915 WP_003898755.1.91937 WP_003898755.1.91953 WP_003898755.1.91957 WP_003898755.1.91976 WP_003898755.1.92021 WP_003898755.1.92083 WP_003898755.1.92127 WP_003898755.1.92144 WP_003898755.1.92150 WP_003898755.1.92153 WP_003898755.1.92190 WP_003898755.1.92192 WP_003898755.1.92200 WP_003898755.1.92220 WP_003898755.1.92221 WP_003898755.1.92222 WP_003898755.1.92273 WP_003898755.1.92289 WP_003898755.1.9229 WP_003898755.1.92300 WP_003898755.1.92317 WP_003898755.1.92334 WP_003898755.1.92338 WP_003898755.1.92356 WP_003898755.1.92364 WP_003898755.1.92380 WP_003898755.1.92447 WP_003898755.1.92456 WP_003898755.1.92467 WP_003898755.1.92471 WP_003898755.1.92490 WP_003898755.1.9251 WP_003898755.1.92511 WP_003898755.1.92523 WP_003898755.1.92527 WP_003898755.1.92536 WP_003898755.1.92603 WP_003898755.1.92610 WP_003898755.1.9265 WP_003898755.1.92650 WP_003898755.1.92660 WP_003898755.1.92677 WP_003898755.1.92689 WP_003898755.1.92714 WP_003898755.1.92736 WP_003898755.1.9274 WP_003898755.1.92752 WP_003898755.1.92760 WP_003898755.1.92803 WP_003898755.1.92833 WP_003898755.1.92856 WP_003898755.1.92881 WP_003898755.1.92908 WP_003898755.1.9291 WP_003898755.1.92917 WP_003898755.1.92996 WP_003898755.1.93006 WP_003898755.1.93009 WP_003898755.1.93015 WP_003898755.1.93043 WP_003898755.1.9307 WP_003898755.1.93083 WP_003898755.1.93097 WP_003898755.1.93137 WP_003898755.1.93192 WP_003898755.1.93203 WP_003898755.1.93212 WP_003898755.1.93234 WP_003898755.1.93257 WP_003898755.1.93320 WP_003898755.1.93328 WP_003898755.1.93337 WP_003898755.1.93343 WP_003898755.1.93349 WP_003898755.1.93363 WP_003898755.1.93377 WP_003898755.1.9338 WP_003898755.1.93407 WP_003898755.1.93417 WP_003898755.1.93419 WP_003898755.1.93426 WP_003898755.1.9344 WP_003898755.1.93443 WP_003898755.1.93470 WP_003898755.1.93483 WP_003898755.1.93487 WP_003898755.1.93495 WP_003898755.1.93499 WP_003898755.1.93516 WP_003898755.1.93544 WP_003898755.1.93555 WP_003898755.1.93564 WP_003898755.1.93573 WP_003898755.1.93576 WP_003898755.1.93588 WP_003898755.1.9363 WP_003898755.1.93689 WP_003898755.1.93693 WP_003898755.1.9371 WP_003898755.1.93792 WP_003898755.1.93823 WP_003898755.1.93871 WP_003898755.1.9388 WP_003898755.1.93894 WP_003898755.1.93903 WP_003898755.1.93907 WP_003898755.1.93913 WP_003898755.1.93946 WP_003898755.1.93988 WP_003898755.1.9407 WP_003898755.1.94143 WP_003898755.1.94154 WP_003898755.1.94204 WP_003898755.1.94205 WP_003898755.1.94226 WP_003898755.1.94231 WP_003898755.1.94256 WP_003898755.1.94261 WP_003898755.1.94292 WP_003898755.1.94297 WP_003898755.1.94326 WP_003898755.1.94339 WP_003898755.1.94392 WP_003898755.1.94416 WP_003898755.1.94421 WP_003898755.1.94456 WP_003898755.1.94480 WP_003898755.1.94495 WP_003898755.1.94511 WP_003898755.1.94512 WP_003898755.1.94528 WP_003898755.1.94564 WP_003898755.1.946 WP_003898755.1.94629 WP_003898755.1.9465 WP_003898755.1.94673 WP_003898755.1.94730 WP_003898755.1.94736 WP_003898755.1.94776 WP_003898755.1.9478 WP_003898755.1.94834 WP_003898755.1.94852 WP_003898755.1.94872 WP_003898755.1.9488 WP_003898755.1.94902 WP_003898755.1.94916 WP_003898755.1.94979 WP_003898755.1.94994 WP_003898755.1.95007 WP_003898755.1.95015 WP_003898755.1.95034 WP_003898755.1.95068 WP_003898755.1.95081 WP_003898755.1.95082 WP_003898755.1.9509 WP_003898755.1.95112 WP_003898755.1.95138 WP_003898755.1.95179 WP_003898755.1.95188 WP_003898755.1.95190 WP_003898755.1.95234 WP_003898755.1.95245 WP_003898755.1.95257 WP_003898755.1.9531 WP_003898755.1.95335 WP_003898755.1.95344 WP_003898755.1.9535 WP_003898755.1.95370 WP_003898755.1.95392 WP_003898755.1.95416 WP_003898755.1.95417 WP_003898755.1.95454 WP_003898755.1.95455 WP_003898755.1.95491 WP_003898755.1.95497 WP_003898755.1.95509 WP_003898755.1.95529 WP_003898755.1.95556 WP_003898755.1.95565 WP_003898755.1.95578 WP_003898755.1.95580 WP_003898755.1.95643 WP_003898755.1.95679 WP_003898755.1.95685 WP_003898755.1.957 WP_003898755.1.95727 WP_003898755.1.95730 WP_003898755.1.95735 WP_003898755.1.95758 WP_003898755.1.95772 WP_003898755.1.95839 WP_003898755.1.9585 WP_003898755.1.9590 WP_003898755.1.95924 WP_003898755.1.95926 WP_003898755.1.95953 WP_003898755.1.95958 WP_003898755.1.95964 WP_003898755.1.96006 WP_003898755.1.9602 WP_003898755.1.96062 WP_003898755.1.96065 WP_003898755.1.96098 WP_003898755.1.96146 WP_003898755.1.96171 WP_003898755.1.96230 WP_003898755.1.96235 WP_003898755.1.96245 WP_003898755.1.96254 WP_003898755.1.96259 WP_003898755.1.96286 WP_003898755.1.96313 WP_003898755.1.96318 WP_003898755.1.96360 WP_003898755.1.96456 WP_003898755.1.96486 WP_003898755.1.96560 WP_003898755.1.96569 WP_003898755.1.96573 WP_003898755.1.96575 WP_003898755.1.96576 WP_003898755.1.96611 WP_003898755.1.9667 WP_003898755.1.96726 WP_003898755.1.96733 WP_003898755.1.96742 WP_003898755.1.96754 WP_003898755.1.9678 WP_003898755.1.96832 WP_003898755.1.9685 WP_003898755.1.97008 WP_003898755.1.97009 WP_003898755.1.97056 WP_003898755.1.97084 WP_003898755.1.97087 WP_003898755.1.97094 WP_003898755.1.97096 WP_003898755.1.97099 WP_003898755.1.97108 WP_003898755.1.97122 WP_003898755.1.97127 WP_003898755.1.97129 WP_003898755.1.97136 WP_003898755.1.9716 WP_003898755.1.97176 WP_003898755.1.97222 WP_003898755.1.97242 WP_003898755.1.97296 WP_003898755.1.97321 WP_003898755.1.97325 WP_003898755.1.97366 WP_003898755.1.97380 WP_003898755.1.97519 WP_003898755.1.97535 WP_003898755.1.97540 WP_003898755.1.97546 WP_003898755.1.97550 WP_003898755.1.97577 WP_003898755.1.97584 WP_003898755.1.9759 WP_003898755.1.97591 WP_003898755.1.97609 WP_003898755.1.97618 WP_003898755.1.97669 WP_003898755.1.97701 WP_003898755.1.9773 WP_003898755.1.97740 WP_003898755.1.97751 WP_003898755.1.97754 WP_003898755.1.97797 WP_003898755.1.9782 WP_003898755.1.9784 WP_003898755.1.9795 WP_003898755.1.97951 WP_003898755.1.97958 WP_003898755.1.97966 WP_003898755.1.97977 WP_003898755.1.97995 WP_003898755.1.98018 WP_003898755.1.98034 WP_003898755.1.98071 WP_003898755.1.98072 WP_003898755.1.98113 WP_003898755.1.98114 WP_003898755.1.98128 WP_003898755.1.98188 WP_003898755.1.98189 WP_003898755.1.98213 WP_003898755.1.98335 WP_003898755.1.98350 WP_003898755.1.98395 WP_003898755.1.98412 WP_003898755.1.98441 WP_003898755.1.98462 WP_003898755.1.9848 WP_003898755.1.98482 WP_003898755.1.98488 WP_003898755.1.98503 WP_003898755.1.98536 WP_003898755.1.98541 WP_003898755.1.98566 WP_003898755.1.98576 WP_003898755.1.98590 WP_003898755.1.98594 WP_003898755.1.98599 WP_003898755.1.98629 WP_003898755.1.98645 WP_003898755.1.98649 WP_003898755.1.98656 WP_003898755.1.9867 WP_003898755.1.98674 WP_003898755.1.98697 WP_003898755.1.98739 WP_003898755.1.98765 WP_003898755.1.98770 WP_003898755.1.98777 WP_003898755.1.98838 WP_003898755.1.98906 WP_003898755.1.98935 WP_003898755.1.98948 WP_003898755.1.98953 WP_003898755.1.98984 WP_003898755.1.99000 WP_003898755.1.99023 WP_003898755.1.99030 WP_003898755.1.99055 WP_003898755.1.99062 WP_003898755.1.99086 WP_003898755.1.99115 WP_003898755.1.99161 WP_003898755.1.99211 WP_003898755.1.99251 WP_003898755.1.99294 WP_003898755.1.99316 WP_003898755.1.99322 WP_003898755.1.99328 WP_003898755.1.99365 WP_003898755.1.99368 WP_003898755.1.99396 WP_003898755.1.99402 WP_003898755.1.99404 WP_003898755.1.99419 WP_003898755.1.99438 WP_003898755.1.99460 WP_003898755.1.99468 WP_003898755.1.99473 WP_003898755.1.99513 WP_003898755.1.99529 WP_003898755.1.99548 WP_003898755.1.99572 WP_003898755.1.99578 WP_003898755.1.99605 WP_003898755.1.99609 WP_003898755.1.99635 WP_003898755.1.99650 WP_003898755.1.99672 WP_003898755.1.99701 WP_003898755.1.99711 WP_003898755.1.99740 WP_003898755.1.99745 WP_003898755.1.99749 WP_003898755.1.99798 WP_003898755.1.99817 WP_003898755.1.99852 WP_003898755.1.99886 WP_003898755.1.99897 WP_003898755.1.99899 WP_003898755.1.9993 gi|385997960|ref|YP_005916258.1| gi|340626189|ref|YP_004744641.1| gi|15840618|ref|NP_335655.1| 336982.TBFG_11200 478434.TBMG_02806 83331.MT1212 gi|197739895|ref|YP_002161209.1| gi|375297021|ref|YP_005101288.1| gi|148822391|ref|YP_001287145.1| gi|392385871|ref|YP_005307500.1| gi|385990614|ref|YP_005908912.1| gi|433626271|ref|YP_007259900.1| gi|471337085|ref|YP_007609798.1| gi|506925640|ref|YP_008006090.1| gi|392433230|ref|YP_006474274.1| gi|479314078|ref|YP_007854130.1| gi|506925640|ref|YP_008006090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]