SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340626920|ref|YP_004745372.1| from Mycobacterium canettii CIPT 140010059

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340626920|ref|YP_004745372.1|
Domain Number 1 Region: 56-200
Classification Level Classification E-value
Superfamily PEBP-like 5.23e-37
Family Prokaryotic PEBP-like proteins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340626920|ref|YP_004745372.1|
Sequence length 201
Comment putative lipoprotein LPPC [Mycobacterium canettii CIPT 140010059]
Sequence
MTSTLHRTPLATAGLALVMALGGCGGGGGDSRETPPYVPKATTVDATTPAPAAEPLTIAS
PMFADGAPIPVQFSCKGANVAPPLTWSSPAGAAELALVVDDPDAVGGLYVHWIVTGIAPG
SGSTADGQTPAGGHSVPNSGGRQGYFGPCPPAGTGTHHYRFTLYHLPVALQLPPGATGVQ
AAQAIAQAASGQARLVGTFEG
Download sequence
Identical sequences G0TLH5
gi|340626920|ref|YP_004745372.1| WP_014001004.1.45062 WP_014001004.1.71399 gi|433627007|ref|YP_007260636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]