SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340627148|ref|YP_004745600.1| from Mycobacterium canettii CIPT 140010059

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340627148|ref|YP_004745600.1|
Domain Number 1 Region: 17-174
Classification Level Classification E-value
Superfamily PEBP-like 1.83e-47
Family Prokaryotic PEBP-like proteins 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340627148|ref|YP_004745600.1|
Sequence length 176
Comment hypothetical protein MCAN_21641 [Mycobacterium canettii CIPT 140010059]
Sequence
MTTSPDPYAALPKLPSFSLTSTSITDGQPLATPQVSGIMGAGGADASPQLRWSGFPSETR
SFAVTVYDPDAPTLSGFWHWAVANLPANVTELPEGVGDGRELPGGALTLVNDAGMRRYVG
AAPPPGHGVHRYYVAVHAVKVEKLDLPEDASPAYLGFNLFQHAIARAVIFGTYEQR
Download sequence
Identical sequences A0A045JPS4 A0A0H3LHN1 A0A0H3M7V3 A0A0K2HXA9 A0A109SXU0 A0A120IX96 A0A1A9E8H6 A0A1S1BCS2 A5U4G6 F8M0F1 G0TMR2 I6Y8H8 M8CDL2 P67227 P9WFN0 P9WFN1 R4M9T3
gi|224990516|ref|YP_002645203.1| gi|15609277|ref|NP_216656.1| gi|121638022|ref|YP_978246.1| gi|378771870|ref|YP_005171603.1| gi|253798796|ref|YP_003031797.1| d4bega1 gi|385998917|ref|YP_005917215.1| gi|197740762|ref|YP_002162076.1| gi|471338115|ref|YP_007610828.1| gi|340627148|ref|YP_004745600.1| gi|506926654|ref|YP_008007104.1| gi|339632172|ref|YP_004723814.1| gi|433642321|ref|YP_007288080.1| gi|385991486|ref|YP_005909784.1| gi|375296054|ref|YP_005100321.1| gi|506926654|ref|YP_008007104.1| NP_216656.1.84033 WP_003411119.1.100021 WP_003411119.1.100069 WP_003411119.1.100087 WP_003411119.1.10015 WP_003411119.1.100208 WP_003411119.1.100216 WP_003411119.1.10022 WP_003411119.1.100255 WP_003411119.1.100260 WP_003411119.1.100270 WP_003411119.1.100279 WP_003411119.1.100286 WP_003411119.1.100308 WP_003411119.1.100309 WP_003411119.1.100318 WP_003411119.1.100338 WP_003411119.1.10037 WP_003411119.1.100383 WP_003411119.1.100395 WP_003411119.1.100396 WP_003411119.1.1004 WP_003411119.1.100401 WP_003411119.1.100459 WP_003411119.1.100460 WP_003411119.1.100552 WP_003411119.1.100581 WP_003411119.1.100600 WP_003411119.1.100625 WP_003411119.1.10064 WP_003411119.1.100666 WP_003411119.1.100671 WP_003411119.1.100677 WP_003411119.1.100697 WP_003411119.1.100703 WP_003411119.1.100716 WP_003411119.1.100722 WP_003411119.1.100754 WP_003411119.1.100757 WP_003411119.1.100772 WP_003411119.1.1008 WP_003411119.1.100812 WP_003411119.1.100845 WP_003411119.1.100866 WP_003411119.1.10088 WP_003411119.1.100889 WP_003411119.1.10090 WP_003411119.1.100910 WP_003411119.1.100915 WP_003411119.1.100918 WP_003411119.1.100935 WP_003411119.1.100984 WP_003411119.1.100992 WP_003411119.1.100998 WP_003411119.1.101 WP_003411119.1.101025 WP_003411119.1.101028 WP_003411119.1.10104 WP_003411119.1.101048 WP_003411119.1.101054 WP_003411119.1.101075 WP_003411119.1.101143 WP_003411119.1.101146 WP_003411119.1.10116 WP_003411119.1.10117 WP_003411119.1.101209 WP_003411119.1.10125 WP_003411119.1.101290 WP_003411119.1.101323 WP_003411119.1.101324 WP_003411119.1.101350 WP_003411119.1.101367 WP_003411119.1.101398 WP_003411119.1.101403 WP_003411119.1.101421 WP_003411119.1.10144 WP_003411119.1.101442 WP_003411119.1.10145 WP_003411119.1.101452 WP_003411119.1.101456 WP_003411119.1.101481 WP_003411119.1.101493 WP_003411119.1.101496 WP_003411119.1.101525 WP_003411119.1.101533 WP_003411119.1.101535 WP_003411119.1.101553 WP_003411119.1.101558 WP_003411119.1.10156 WP_003411119.1.101573 WP_003411119.1.101576 WP_003411119.1.10159 WP_003411119.1.101592 WP_003411119.1.101604 WP_003411119.1.101607 WP_003411119.1.101622 WP_003411119.1.101644 WP_003411119.1.101659 WP_003411119.1.101671 WP_003411119.1.101687 WP_003411119.1.101698 WP_003411119.1.10170 WP_003411119.1.101713 WP_003411119.1.101722 WP_003411119.1.101733 WP_003411119.1.101743 WP_003411119.1.101753 WP_003411119.1.101754 WP_003411119.1.101764 WP_003411119.1.101773 WP_003411119.1.101795 WP_003411119.1.101797 WP_003411119.1.101798 WP_003411119.1.101802 WP_003411119.1.101826 WP_003411119.1.101836 WP_003411119.1.101858 WP_003411119.1.101859 WP_003411119.1.101862 WP_003411119.1.101888 WP_003411119.1.101894 WP_003411119.1.101899 WP_003411119.1.1019 WP_003411119.1.101923 WP_003411119.1.101925 WP_003411119.1.10193 WP_003411119.1.101996 WP_003411119.1.102 WP_003411119.1.102008 WP_003411119.1.102017 WP_003411119.1.102053 WP_003411119.1.102055 WP_003411119.1.102063 WP_003411119.1.102099 WP_003411119.1.1021 WP_003411119.1.10211 WP_003411119.1.102119 WP_003411119.1.102121 WP_003411119.1.102143 WP_003411119.1.10216 WP_003411119.1.10224 WP_003411119.1.10253 WP_003411119.1.10262 WP_003411119.1.10272 WP_003411119.1.10277 WP_003411119.1.1033 WP_003411119.1.10350 WP_003411119.1.10362 WP_003411119.1.10366 WP_003411119.1.10376 WP_003411119.1.10396 WP_003411119.1.10410 WP_003411119.1.10430 WP_003411119.1.1044 WP_003411119.1.10440 WP_003411119.1.10445 WP_003411119.1.10471 WP_003411119.1.10472 WP_003411119.1.10489 WP_003411119.1.105 WP_003411119.1.10518 WP_003411119.1.10523 WP_003411119.1.10545 WP_003411119.1.1057 WP_003411119.1.10594 WP_003411119.1.10603 WP_003411119.1.10606 WP_003411119.1.10615 WP_003411119.1.10623 WP_003411119.1.10635 WP_003411119.1.10643 WP_003411119.1.10648 WP_003411119.1.10662 WP_003411119.1.10709 WP_003411119.1.10735 WP_003411119.1.10740 WP_003411119.1.10756 WP_003411119.1.1078 WP_003411119.1.10791 WP_003411119.1.10799 WP_003411119.1.10825 WP_003411119.1.10848 WP_003411119.1.10863 WP_003411119.1.10879 WP_003411119.1.10912 WP_003411119.1.10916 WP_003411119.1.10923 WP_003411119.1.10927 WP_003411119.1.1095 WP_003411119.1.10956 WP_003411119.1.10958 WP_003411119.1.10962 WP_003411119.1.10980 WP_003411119.1.10981 WP_003411119.1.10993 WP_003411119.1.1100 WP_003411119.1.11040 WP_003411119.1.11061 WP_003411119.1.11070 WP_003411119.1.11171 WP_003411119.1.11175 WP_003411119.1.11176 WP_003411119.1.11222 WP_003411119.1.11236 WP_003411119.1.11329 WP_003411119.1.1133 WP_003411119.1.11342 WP_003411119.1.11373 WP_003411119.1.11376 WP_003411119.1.11390 WP_003411119.1.11402 WP_003411119.1.11481 WP_003411119.1.11487 WP_003411119.1.11489 WP_003411119.1.11514 WP_003411119.1.11587 WP_003411119.1.11589 WP_003411119.1.11596 WP_003411119.1.11604 WP_003411119.1.11610 WP_003411119.1.11697 WP_003411119.1.11707 WP_003411119.1.11752 WP_003411119.1.11758 WP_003411119.1.11761 WP_003411119.1.11775 WP_003411119.1.11804 WP_003411119.1.11822 WP_003411119.1.11826 WP_003411119.1.11856 WP_003411119.1.11898 WP_003411119.1.11906 WP_003411119.1.11939 WP_003411119.1.11960 WP_003411119.1.11961 WP_003411119.1.11972 WP_003411119.1.120 WP_003411119.1.12001 WP_003411119.1.12049 WP_003411119.1.12052 WP_003411119.1.12100 WP_003411119.1.12116 WP_003411119.1.12133 WP_003411119.1.12161 WP_003411119.1.12165 WP_003411119.1.12184 WP_003411119.1.12187 WP_003411119.1.12190 WP_003411119.1.12216 WP_003411119.1.12265 WP_003411119.1.12275 WP_003411119.1.12293 WP_003411119.1.12294 WP_003411119.1.123 WP_003411119.1.1231 WP_003411119.1.12314 WP_003411119.1.12327 WP_003411119.1.12338 WP_003411119.1.1236 WP_003411119.1.12371 WP_003411119.1.12372 WP_003411119.1.12389 WP_003411119.1.12406 WP_003411119.1.1241 WP_003411119.1.12421 WP_003411119.1.12446 WP_003411119.1.12464 WP_003411119.1.12479 WP_003411119.1.12519 WP_003411119.1.12523 WP_003411119.1.12526 WP_003411119.1.1255 WP_003411119.1.12550 WP_003411119.1.12551 WP_003411119.1.12563 WP_003411119.1.12611 WP_003411119.1.12669 WP_003411119.1.1267 WP_003411119.1.12672 WP_003411119.1.12692 WP_003411119.1.1271 WP_003411119.1.12710 WP_003411119.1.12768 WP_003411119.1.1279 WP_003411119.1.12794 WP_003411119.1.12801 WP_003411119.1.12804 WP_003411119.1.12821 WP_003411119.1.12841 WP_003411119.1.12854 WP_003411119.1.12871 WP_003411119.1.12901 WP_003411119.1.12941 WP_003411119.1.12947 WP_003411119.1.12957 WP_003411119.1.12972 WP_003411119.1.13028 WP_003411119.1.13043 WP_003411119.1.13086 WP_003411119.1.13087 WP_003411119.1.13090 WP_003411119.1.13096 WP_003411119.1.13163 WP_003411119.1.13175 WP_003411119.1.13183 WP_003411119.1.132 WP_003411119.1.13249 WP_003411119.1.13282 WP_003411119.1.13284 WP_003411119.1.13296 WP_003411119.1.13298 WP_003411119.1.13306 WP_003411119.1.13312 WP_003411119.1.13313 WP_003411119.1.13321 WP_003411119.1.13345 WP_003411119.1.13358 WP_003411119.1.13370 WP_003411119.1.13375 WP_003411119.1.1338 WP_003411119.1.13420 WP_003411119.1.13433 WP_003411119.1.13435 WP_003411119.1.13438 WP_003411119.1.13461 WP_003411119.1.13466 WP_003411119.1.13489 WP_003411119.1.13551 WP_003411119.1.13561 WP_003411119.1.13564 WP_003411119.1.13579 WP_003411119.1.13647 WP_003411119.1.13667 WP_003411119.1.13687 WP_003411119.1.13697 WP_003411119.1.13719 WP_003411119.1.13763 WP_003411119.1.1377 WP_003411119.1.13774 WP_003411119.1.13786 WP_003411119.1.13793 WP_003411119.1.13794 WP_003411119.1.13817 WP_003411119.1.13834 WP_003411119.1.13866 WP_003411119.1.13880 WP_003411119.1.13899 WP_003411119.1.13909 WP_003411119.1.13910 WP_003411119.1.13919 WP_003411119.1.13920 WP_003411119.1.13952 WP_003411119.1.13953 WP_003411119.1.13962 WP_003411119.1.1398 WP_003411119.1.13988 WP_003411119.1.14027 WP_003411119.1.14046 WP_003411119.1.14115 WP_003411119.1.1415 WP_003411119.1.14152 WP_003411119.1.14158 WP_003411119.1.14162 WP_003411119.1.14175 WP_003411119.1.14178 WP_003411119.1.14194 WP_003411119.1.14195 WP_003411119.1.14208 WP_003411119.1.14238 WP_003411119.1.14266 WP_003411119.1.14273 WP_003411119.1.14303 WP_003411119.1.14306 WP_003411119.1.14307 WP_003411119.1.14310 WP_003411119.1.14382 WP_003411119.1.14416 WP_003411119.1.14428 WP_003411119.1.14441 WP_003411119.1.14469 WP_003411119.1.14477 WP_003411119.1.14504 WP_003411119.1.14514 WP_003411119.1.1452 WP_003411119.1.14527 WP_003411119.1.1454 WP_003411119.1.14544 WP_003411119.1.14548 WP_003411119.1.14551 WP_003411119.1.14561 WP_003411119.1.14573 WP_003411119.1.1462 WP_003411119.1.14658 WP_003411119.1.14668 WP_003411119.1.14675 WP_003411119.1.14694 WP_003411119.1.14695 WP_003411119.1.14709 WP_003411119.1.14766 WP_003411119.1.14783 WP_003411119.1.14865 WP_003411119.1.14872 WP_003411119.1.14905 WP_003411119.1.14926 WP_003411119.1.14951 WP_003411119.1.14955 WP_003411119.1.15003 WP_003411119.1.15009 WP_003411119.1.15028 WP_003411119.1.15040 WP_003411119.1.15052 WP_003411119.1.15065 WP_003411119.1.15072 WP_003411119.1.15089 WP_003411119.1.1509 WP_003411119.1.15126 WP_003411119.1.15131 WP_003411119.1.15168 WP_003411119.1.15172 WP_003411119.1.15174 WP_003411119.1.15187 WP_003411119.1.15196 WP_003411119.1.15210 WP_003411119.1.15216 WP_003411119.1.15217 WP_003411119.1.1523 WP_003411119.1.15232 WP_003411119.1.15238 WP_003411119.1.15240 WP_003411119.1.15253 WP_003411119.1.1527 WP_003411119.1.15292 WP_003411119.1.15299 WP_003411119.1.15302 WP_003411119.1.15322 WP_003411119.1.1534 WP_003411119.1.15365 WP_003411119.1.15386 WP_003411119.1.15387 WP_003411119.1.15442 WP_003411119.1.15447 WP_003411119.1.15449 WP_003411119.1.15477 WP_003411119.1.15481 WP_003411119.1.15492 WP_003411119.1.15511 WP_003411119.1.15512 WP_003411119.1.15558 WP_003411119.1.15559 WP_003411119.1.15566 WP_003411119.1.15599 WP_003411119.1.1560 WP_003411119.1.15611 WP_003411119.1.1563 WP_003411119.1.15633 WP_003411119.1.15643 WP_003411119.1.15688 WP_003411119.1.15755 WP_003411119.1.15763 WP_003411119.1.15774 WP_003411119.1.1578 WP_003411119.1.15780 WP_003411119.1.15827 WP_003411119.1.15834 WP_003411119.1.15842 WP_003411119.1.15848 WP_003411119.1.15853 WP_003411119.1.15870 WP_003411119.1.15877 WP_003411119.1.15893 WP_003411119.1.15896 WP_003411119.1.15926 WP_003411119.1.15933 WP_003411119.1.15946 WP_003411119.1.15958 WP_003411119.1.15973 WP_003411119.1.15987 WP_003411119.1.15993 WP_003411119.1.16009 WP_003411119.1.16025 WP_003411119.1.16043 WP_003411119.1.16066 WP_003411119.1.16069 WP_003411119.1.16077 WP_003411119.1.16106 WP_003411119.1.16108 WP_003411119.1.16130 WP_003411119.1.16136 WP_003411119.1.16139 WP_003411119.1.16141 WP_003411119.1.16143 WP_003411119.1.1630 WP_003411119.1.16318 WP_003411119.1.1632 WP_003411119.1.16327 WP_003411119.1.16334 WP_003411119.1.16341 WP_003411119.1.16345 WP_003411119.1.16374 WP_003411119.1.16384 WP_003411119.1.16386 WP_003411119.1.164 WP_003411119.1.1642 WP_003411119.1.16421 WP_003411119.1.16424 WP_003411119.1.16431 WP_003411119.1.1644 WP_003411119.1.16442 WP_003411119.1.16448 WP_003411119.1.16451 WP_003411119.1.16476 WP_003411119.1.16480 WP_003411119.1.16494 WP_003411119.1.1652 WP_003411119.1.16549 WP_003411119.1.16560 WP_003411119.1.16598 WP_003411119.1.16609 WP_003411119.1.16619 WP_003411119.1.16620 WP_003411119.1.16622 WP_003411119.1.16637 WP_003411119.1.1669 WP_003411119.1.16707 WP_003411119.1.16724 WP_003411119.1.16731 WP_003411119.1.16743 WP_003411119.1.1683 WP_003411119.1.16837 WP_003411119.1.16852 WP_003411119.1.16937 WP_003411119.1.16940 WP_003411119.1.16950 WP_003411119.1.16959 WP_003411119.1.16968 WP_003411119.1.1697 WP_003411119.1.16973 WP_003411119.1.16977 WP_003411119.1.16987 WP_003411119.1.17005 WP_003411119.1.17006 WP_003411119.1.17010 WP_003411119.1.17015 WP_003411119.1.17019 WP_003411119.1.17039 WP_003411119.1.17041 WP_003411119.1.17052 WP_003411119.1.17057 WP_003411119.1.17062 WP_003411119.1.1707 WP_003411119.1.17094 WP_003411119.1.17130 WP_003411119.1.17138 WP_003411119.1.17147 WP_003411119.1.17224 WP_003411119.1.17251 WP_003411119.1.17288 WP_003411119.1.17304 WP_003411119.1.17314 WP_003411119.1.17345 WP_003411119.1.17381 WP_003411119.1.17391 WP_003411119.1.17412 WP_003411119.1.1743 WP_003411119.1.17440 WP_003411119.1.17466 WP_003411119.1.17477 WP_003411119.1.17483 WP_003411119.1.17505 WP_003411119.1.17527 WP_003411119.1.17535 WP_003411119.1.17540 WP_003411119.1.17553 WP_003411119.1.17558 WP_003411119.1.17599 WP_003411119.1.17635 WP_003411119.1.17655 WP_003411119.1.17679 WP_003411119.1.1768 WP_003411119.1.17687 WP_003411119.1.17700 WP_003411119.1.17710 WP_003411119.1.17713 WP_003411119.1.17722 WP_003411119.1.17746 WP_003411119.1.17788 WP_003411119.1.17798 WP_003411119.1.17803 WP_003411119.1.17816 WP_003411119.1.17821 WP_003411119.1.17830 WP_003411119.1.17868 WP_003411119.1.17878 WP_003411119.1.1792 WP_003411119.1.17923 WP_003411119.1.1795 WP_003411119.1.17955 WP_003411119.1.17973 WP_003411119.1.18009 WP_003411119.1.18033 WP_003411119.1.18057 WP_003411119.1.18065 WP_003411119.1.18070 WP_003411119.1.18116 WP_003411119.1.18120 WP_003411119.1.18126 WP_003411119.1.1817 WP_003411119.1.18170 WP_003411119.1.18206 WP_003411119.1.18216 WP_003411119.1.18240 WP_003411119.1.18257 WP_003411119.1.18297 WP_003411119.1.18306 WP_003411119.1.18364 WP_003411119.1.18399 WP_003411119.1.18411 WP_003411119.1.18444 WP_003411119.1.18448 WP_003411119.1.18467 WP_003411119.1.18476 WP_003411119.1.18522 WP_003411119.1.18580 WP_003411119.1.18582 WP_003411119.1.18587 WP_003411119.1.186 WP_003411119.1.18601 WP_003411119.1.18639 WP_003411119.1.18646 WP_003411119.1.18647 WP_003411119.1.1868 WP_003411119.1.18694 WP_003411119.1.18710 WP_003411119.1.18751 WP_003411119.1.18781 WP_003411119.1.18793 WP_003411119.1.18804 WP_003411119.1.18816 WP_003411119.1.18823 WP_003411119.1.18827 WP_003411119.1.18838 WP_003411119.1.18849 WP_003411119.1.18856 WP_003411119.1.18945 WP_003411119.1.1898 WP_003411119.1.19005 WP_003411119.1.19056 WP_003411119.1.19066 WP_003411119.1.19071 WP_003411119.1.19085 WP_003411119.1.19094 WP_003411119.1.19144 WP_003411119.1.19159 WP_003411119.1.19193 WP_003411119.1.19231 WP_003411119.1.19243 WP_003411119.1.19264 WP_003411119.1.19295 WP_003411119.1.19307 WP_003411119.1.19326 WP_003411119.1.1933 WP_003411119.1.19364 WP_003411119.1.19382 WP_003411119.1.19400 WP_003411119.1.19426 WP_003411119.1.19429 WP_003411119.1.19464 WP_003411119.1.19480 WP_003411119.1.19553 WP_003411119.1.19562 WP_003411119.1.19564 WP_003411119.1.19568 WP_003411119.1.19572 WP_003411119.1.19595 WP_003411119.1.19596 WP_003411119.1.19600 WP_003411119.1.19630 WP_003411119.1.1967 WP_003411119.1.19694 WP_003411119.1.1970 WP_003411119.1.19707 WP_003411119.1.19742 WP_003411119.1.19785 WP_003411119.1.19820 WP_003411119.1.19868 WP_003411119.1.19874 WP_003411119.1.19890 WP_003411119.1.19900 WP_003411119.1.19922 WP_003411119.1.19936 WP_003411119.1.19946 WP_003411119.1.19949 WP_003411119.1.19960 WP_003411119.1.19964 WP_003411119.1.20007 WP_003411119.1.20016 WP_003411119.1.2003 WP_003411119.1.20037 WP_003411119.1.20039 WP_003411119.1.20082 WP_003411119.1.20085 WP_003411119.1.20097 WP_003411119.1.20116 WP_003411119.1.20130 WP_003411119.1.20140 WP_003411119.1.20141 WP_003411119.1.20142 WP_003411119.1.20158 WP_003411119.1.20239 WP_003411119.1.20243 WP_003411119.1.20259 WP_003411119.1.20262 WP_003411119.1.20272 WP_003411119.1.20280 WP_003411119.1.20294 WP_003411119.1.20300 WP_003411119.1.20309 WP_003411119.1.20322 WP_003411119.1.2037 WP_003411119.1.20372 WP_003411119.1.20381 WP_003411119.1.204 WP_003411119.1.20427 WP_003411119.1.20457 WP_003411119.1.20459 WP_003411119.1.20460 WP_003411119.1.20542 WP_003411119.1.20578 WP_003411119.1.20608 WP_003411119.1.20624 WP_003411119.1.20628 WP_003411119.1.20707 WP_003411119.1.20722 WP_003411119.1.20729 WP_003411119.1.20742 WP_003411119.1.20751 WP_003411119.1.20776 WP_003411119.1.20843 WP_003411119.1.20850 WP_003411119.1.2086 WP_003411119.1.20868 WP_003411119.1.20876 WP_003411119.1.20897 WP_003411119.1.20898 WP_003411119.1.2090 WP_003411119.1.20911 WP_003411119.1.20921 WP_003411119.1.20926 WP_003411119.1.20927 WP_003411119.1.20951 WP_003411119.1.20970 WP_003411119.1.2104 WP_003411119.1.21127 WP_003411119.1.21135 WP_003411119.1.21173 WP_003411119.1.21187 WP_003411119.1.212 WP_003411119.1.2120 WP_003411119.1.21218 WP_003411119.1.21219 WP_003411119.1.2123 WP_003411119.1.21231 WP_003411119.1.21234 WP_003411119.1.2126 WP_003411119.1.21292 WP_003411119.1.21307 WP_003411119.1.2131 WP_003411119.1.21311 WP_003411119.1.21321 WP_003411119.1.21365 WP_003411119.1.21392 WP_003411119.1.21397 WP_003411119.1.21403 WP_003411119.1.21415 WP_003411119.1.21430 WP_003411119.1.21434 WP_003411119.1.21444 WP_003411119.1.21468 WP_003411119.1.21498 WP_003411119.1.21509 WP_003411119.1.21513 WP_003411119.1.21560 WP_003411119.1.21565 WP_003411119.1.21586 WP_003411119.1.21591 WP_003411119.1.21594 WP_003411119.1.21602 WP_003411119.1.21615 WP_003411119.1.21638 WP_003411119.1.21639 WP_003411119.1.21655 WP_003411119.1.21658 WP_003411119.1.2168 WP_003411119.1.2174 WP_003411119.1.21741 WP_003411119.1.21742 WP_003411119.1.21777 WP_003411119.1.21786 WP_003411119.1.21795 WP_003411119.1.218 WP_003411119.1.21826 WP_003411119.1.21829 WP_003411119.1.21840 WP_003411119.1.21843 WP_003411119.1.21872 WP_003411119.1.21873 WP_003411119.1.2188 WP_003411119.1.21882 WP_003411119.1.21906 WP_003411119.1.21912 WP_003411119.1.2194 WP_003411119.1.21941 WP_003411119.1.21956 WP_003411119.1.21958 WP_003411119.1.21960 WP_003411119.1.21971 WP_003411119.1.21973 WP_003411119.1.21983 WP_003411119.1.22003 WP_003411119.1.22013 WP_003411119.1.22025 WP_003411119.1.22036 WP_003411119.1.22075 WP_003411119.1.22092 WP_003411119.1.2212 WP_003411119.1.22127 WP_003411119.1.22140 WP_003411119.1.22233 WP_003411119.1.22255 WP_003411119.1.22277 WP_003411119.1.22348 WP_003411119.1.22366 WP_003411119.1.2238 WP_003411119.1.22380 WP_003411119.1.22437 WP_003411119.1.22438 WP_003411119.1.22511 WP_003411119.1.22524 WP_003411119.1.2253 WP_003411119.1.22585 WP_003411119.1.22606 WP_003411119.1.22608 WP_003411119.1.22609 WP_003411119.1.22618 WP_003411119.1.2262 WP_003411119.1.22624 WP_003411119.1.22629 WP_003411119.1.22647 WP_003411119.1.22664 WP_003411119.1.22665 WP_003411119.1.22670 WP_003411119.1.22680 WP_003411119.1.22725 WP_003411119.1.22728 WP_003411119.1.22733 WP_003411119.1.22737 WP_003411119.1.2275 WP_003411119.1.22754 WP_003411119.1.22797 WP_003411119.1.22800 WP_003411119.1.22804 WP_003411119.1.22829 WP_003411119.1.22840 WP_003411119.1.22844 WP_003411119.1.22970 WP_003411119.1.22996 WP_003411119.1.22997 WP_003411119.1.22999 WP_003411119.1.23015 WP_003411119.1.23032 WP_003411119.1.231 WP_003411119.1.23101 WP_003411119.1.2312 WP_003411119.1.23140 WP_003411119.1.23153 WP_003411119.1.23171 WP_003411119.1.23199 WP_003411119.1.2320 WP_003411119.1.23204 WP_003411119.1.23216 WP_003411119.1.23229 WP_003411119.1.23233 WP_003411119.1.2326 WP_003411119.1.23261 WP_003411119.1.23272 WP_003411119.1.23289 WP_003411119.1.2329 WP_003411119.1.23308 WP_003411119.1.23316 WP_003411119.1.23321 WP_003411119.1.23325 WP_003411119.1.2339 WP_003411119.1.23406 WP_003411119.1.23438 WP_003411119.1.23445 WP_003411119.1.23447 WP_003411119.1.23452 WP_003411119.1.23461 WP_003411119.1.2349 WP_003411119.1.23496 WP_003411119.1.23497 WP_003411119.1.23506 WP_003411119.1.23530 WP_003411119.1.23539 WP_003411119.1.23546 WP_003411119.1.23551 WP_003411119.1.23573 WP_003411119.1.23583 WP_003411119.1.23588 WP_003411119.1.23628 WP_003411119.1.23677 WP_003411119.1.23683 WP_003411119.1.23692 WP_003411119.1.23694 WP_003411119.1.23699 WP_003411119.1.2371 WP_003411119.1.23807 WP_003411119.1.23825 WP_003411119.1.23832 WP_003411119.1.2384 WP_003411119.1.23843 WP_003411119.1.23863 WP_003411119.1.2387 WP_003411119.1.23894 WP_003411119.1.23993 WP_003411119.1.2400 WP_003411119.1.24007 WP_003411119.1.24008 WP_003411119.1.24046 WP_003411119.1.24057 WP_003411119.1.24062 WP_003411119.1.24113 WP_003411119.1.24119 WP_003411119.1.24140 WP_003411119.1.24176 WP_003411119.1.24190 WP_003411119.1.24202 WP_003411119.1.24244 WP_003411119.1.24261 WP_003411119.1.24284 WP_003411119.1.24294 WP_003411119.1.24357 WP_003411119.1.24396 WP_003411119.1.24423 WP_003411119.1.2443 WP_003411119.1.24446 WP_003411119.1.24461 WP_003411119.1.24500 WP_003411119.1.24507 WP_003411119.1.24509 WP_003411119.1.24529 WP_003411119.1.24553 WP_003411119.1.24599 WP_003411119.1.24638 WP_003411119.1.24648 WP_003411119.1.2466 WP_003411119.1.24767 WP_003411119.1.24824 WP_003411119.1.24831 WP_003411119.1.24840 WP_003411119.1.24848 WP_003411119.1.24857 WP_003411119.1.2487 WP_003411119.1.24893 WP_003411119.1.24933 WP_003411119.1.24956 WP_003411119.1.24958 WP_003411119.1.24985 WP_003411119.1.2499 WP_003411119.1.25004 WP_003411119.1.2505 WP_003411119.1.25051 WP_003411119.1.2507 WP_003411119.1.25096 WP_003411119.1.25103 WP_003411119.1.25129 WP_003411119.1.25171 WP_003411119.1.25184 WP_003411119.1.25247 WP_003411119.1.25278 WP_003411119.1.25309 WP_003411119.1.25313 WP_003411119.1.25338 WP_003411119.1.25342 WP_003411119.1.25343 WP_003411119.1.25367 WP_003411119.1.25393 WP_003411119.1.25406 WP_003411119.1.25435 WP_003411119.1.25437 WP_003411119.1.25445 WP_003411119.1.25455 WP_003411119.1.25473 WP_003411119.1.25504 WP_003411119.1.25513 WP_003411119.1.25542 WP_003411119.1.25579 WP_003411119.1.25594 WP_003411119.1.25606 WP_003411119.1.25645 WP_003411119.1.2566 WP_003411119.1.25673 WP_003411119.1.25674 WP_003411119.1.25693 WP_003411119.1.25699 WP_003411119.1.25727 WP_003411119.1.25736 WP_003411119.1.25738 WP_003411119.1.25756 WP_003411119.1.25759 WP_003411119.1.2580 WP_003411119.1.25813 WP_003411119.1.25854 WP_003411119.1.25874 WP_003411119.1.25885 WP_003411119.1.25892 WP_003411119.1.25906 WP_003411119.1.25914 WP_003411119.1.25916 WP_003411119.1.2594 WP_003411119.1.25954 WP_003411119.1.25965 WP_003411119.1.25972 WP_003411119.1.26017 WP_003411119.1.26032 WP_003411119.1.26038 WP_003411119.1.26072 WP_003411119.1.26089 WP_003411119.1.26097 WP_003411119.1.26098 WP_003411119.1.26108 WP_003411119.1.26109 WP_003411119.1.26118 WP_003411119.1.26126 WP_003411119.1.2614 WP_003411119.1.26168 WP_003411119.1.26182 WP_003411119.1.26190 WP_003411119.1.2620 WP_003411119.1.26243 WP_003411119.1.26265 WP_003411119.1.26267 WP_003411119.1.26292 WP_003411119.1.26310 WP_003411119.1.26328 WP_003411119.1.26349 WP_003411119.1.26366 WP_003411119.1.26374 WP_003411119.1.26407 WP_003411119.1.26412 WP_003411119.1.26454 WP_003411119.1.26464 WP_003411119.1.2653 WP_003411119.1.26560 WP_003411119.1.26571 WP_003411119.1.2659 WP_003411119.1.26597 WP_003411119.1.26603 WP_003411119.1.26629 WP_003411119.1.26651 WP_003411119.1.26702 WP_003411119.1.26707 WP_003411119.1.26710 WP_003411119.1.26719 WP_003411119.1.26737 WP_003411119.1.26738 WP_003411119.1.26745 WP_003411119.1.26756 WP_003411119.1.2676 WP_003411119.1.2677 WP_003411119.1.26779 WP_003411119.1.26780 WP_003411119.1.26854 WP_003411119.1.26868 WP_003411119.1.26888 WP_003411119.1.26914 WP_003411119.1.26945 WP_003411119.1.26959 WP_003411119.1.26969 WP_003411119.1.26984 WP_003411119.1.26992 WP_003411119.1.27017 WP_003411119.1.27045 WP_003411119.1.27074 WP_003411119.1.27075 WP_003411119.1.27128 WP_003411119.1.27130 WP_003411119.1.27139 WP_003411119.1.27152 WP_003411119.1.27162 WP_003411119.1.27164 WP_003411119.1.27193 WP_003411119.1.27235 WP_003411119.1.27254 WP_003411119.1.27278 WP_003411119.1.27343 WP_003411119.1.27352 WP_003411119.1.27369 WP_003411119.1.27391 WP_003411119.1.27398 WP_003411119.1.27402 WP_003411119.1.27410 WP_003411119.1.27411 WP_003411119.1.27449 WP_003411119.1.27460 WP_003411119.1.27463 WP_003411119.1.27492 WP_003411119.1.27528 WP_003411119.1.27541 WP_003411119.1.27576 WP_003411119.1.27582 WP_003411119.1.27596 WP_003411119.1.27607 WP_003411119.1.2766 WP_003411119.1.277 WP_003411119.1.27724 WP_003411119.1.27730 WP_003411119.1.27736 WP_003411119.1.27743 WP_003411119.1.27750 WP_003411119.1.27779 WP_003411119.1.27795 WP_003411119.1.27819 WP_003411119.1.27835 WP_003411119.1.27915 WP_003411119.1.27935 WP_003411119.1.27962 WP_003411119.1.28053 WP_003411119.1.28092 WP_003411119.1.28106 WP_003411119.1.28131 WP_003411119.1.28142 WP_003411119.1.28159 WP_003411119.1.2816 WP_003411119.1.28161 WP_003411119.1.28192 WP_003411119.1.28202 WP_003411119.1.28241 WP_003411119.1.28242 WP_003411119.1.28251 WP_003411119.1.28269 WP_003411119.1.28276 WP_003411119.1.28293 WP_003411119.1.28331 WP_003411119.1.28367 WP_003411119.1.28378 WP_003411119.1.28391 WP_003411119.1.2842 WP_003411119.1.28448 WP_003411119.1.2847 WP_003411119.1.28471 WP_003411119.1.28473 WP_003411119.1.28493 WP_003411119.1.28497 WP_003411119.1.28530 WP_003411119.1.28545 WP_003411119.1.28561 WP_003411119.1.28567 WP_003411119.1.28585 WP_003411119.1.286 WP_003411119.1.28610 WP_003411119.1.28617 WP_003411119.1.28634 WP_003411119.1.28642 WP_003411119.1.28671 WP_003411119.1.28698 WP_003411119.1.28703 WP_003411119.1.28739 WP_003411119.1.28781 WP_003411119.1.28787 WP_003411119.1.28827 WP_003411119.1.28839 WP_003411119.1.28847 WP_003411119.1.28850 WP_003411119.1.28851 WP_003411119.1.28865 WP_003411119.1.28897 WP_003411119.1.28914 WP_003411119.1.28935 WP_003411119.1.28936 WP_003411119.1.28939 WP_003411119.1.28943 WP_003411119.1.28952 WP_003411119.1.28975 WP_003411119.1.2899 WP_003411119.1.28993 WP_003411119.1.29000 WP_003411119.1.2901 WP_003411119.1.29028 WP_003411119.1.29033 WP_003411119.1.29058 WP_003411119.1.29115 WP_003411119.1.2916 WP_003411119.1.29217 WP_003411119.1.29234 WP_003411119.1.29264 WP_003411119.1.29275 WP_003411119.1.29306 WP_003411119.1.29339 WP_003411119.1.29348 WP_003411119.1.29364 WP_003411119.1.29367 WP_003411119.1.2938 WP_003411119.1.29426 WP_003411119.1.2944 WP_003411119.1.29449 WP_003411119.1.29450 WP_003411119.1.29452 WP_003411119.1.29510 WP_003411119.1.29515 WP_003411119.1.29525 WP_003411119.1.2953 WP_003411119.1.29559 WP_003411119.1.29587 WP_003411119.1.2959 WP_003411119.1.29592 WP_003411119.1.29599 WP_003411119.1.29611 WP_003411119.1.29632 WP_003411119.1.29649 WP_003411119.1.2965 WP_003411119.1.29659 WP_003411119.1.2969 WP_003411119.1.29696 WP_003411119.1.29698 WP_003411119.1.29718 WP_003411119.1.29745 WP_003411119.1.29747 WP_003411119.1.29769 WP_003411119.1.29825 WP_003411119.1.29830 WP_003411119.1.29847 WP_003411119.1.29861 WP_003411119.1.29869 WP_003411119.1.29883 WP_003411119.1.29890 WP_003411119.1.299 WP_003411119.1.29931 WP_003411119.1.29960 WP_003411119.1.30014 WP_003411119.1.3004 WP_003411119.1.30040 WP_003411119.1.30074 WP_003411119.1.30097 WP_003411119.1.30106 WP_003411119.1.30114 WP_003411119.1.30126 WP_003411119.1.30131 WP_003411119.1.30138 WP_003411119.1.30139 WP_003411119.1.30145 WP_003411119.1.30211 WP_003411119.1.30235 WP_003411119.1.30237 WP_003411119.1.3027 WP_003411119.1.30279 WP_003411119.1.30282 WP_003411119.1.30283 WP_003411119.1.30288 WP_003411119.1.30291 WP_003411119.1.30363 WP_003411119.1.30374 WP_003411119.1.30404 WP_003411119.1.3043 WP_003411119.1.30433 WP_003411119.1.30438 WP_003411119.1.30462 WP_003411119.1.30464 WP_003411119.1.30468 WP_003411119.1.30500 WP_003411119.1.3057 WP_003411119.1.30574 WP_003411119.1.30628 WP_003411119.1.30641 WP_003411119.1.30642 WP_003411119.1.30661 WP_003411119.1.30669 WP_003411119.1.30683 WP_003411119.1.30699 WP_003411119.1.30709 WP_003411119.1.30713 WP_003411119.1.30716 WP_003411119.1.30719 WP_003411119.1.30730 WP_003411119.1.30732 WP_003411119.1.30736 WP_003411119.1.30760 WP_003411119.1.30791 WP_003411119.1.308 WP_003411119.1.30807 WP_003411119.1.30818 WP_003411119.1.30824 WP_003411119.1.30848 WP_003411119.1.30877 WP_003411119.1.30888 WP_003411119.1.30901 WP_003411119.1.30903 WP_003411119.1.30912 WP_003411119.1.30913 WP_003411119.1.30914 WP_003411119.1.30919 WP_003411119.1.30977 WP_003411119.1.3100 WP_003411119.1.31002 WP_003411119.1.3101 WP_003411119.1.31034 WP_003411119.1.31047 WP_003411119.1.31070 WP_003411119.1.31074 WP_003411119.1.31102 WP_003411119.1.31127 WP_003411119.1.31184 WP_003411119.1.31199 WP_003411119.1.31226 WP_003411119.1.31230 WP_003411119.1.31233 WP_003411119.1.31263 WP_003411119.1.31264 WP_003411119.1.31270 WP_003411119.1.31287 WP_003411119.1.31290 WP_003411119.1.31304 WP_003411119.1.31346 WP_003411119.1.31348 WP_003411119.1.31354 WP_003411119.1.31390 WP_003411119.1.31414 WP_003411119.1.31417 WP_003411119.1.31428 WP_003411119.1.3143 WP_003411119.1.31458 WP_003411119.1.31483 WP_003411119.1.3149 WP_003411119.1.31498 WP_003411119.1.31507 WP_003411119.1.31537 WP_003411119.1.31548 WP_003411119.1.31569 WP_003411119.1.31573 WP_003411119.1.316 WP_003411119.1.31629 WP_003411119.1.31666 WP_003411119.1.31693 WP_003411119.1.31703 WP_003411119.1.31744 WP_003411119.1.31745 WP_003411119.1.31770 WP_003411119.1.31776 WP_003411119.1.31783 WP_003411119.1.318 WP_003411119.1.3184 WP_003411119.1.31840 WP_003411119.1.31880 WP_003411119.1.31911 WP_003411119.1.31930 WP_003411119.1.31932 WP_003411119.1.31955 WP_003411119.1.31985 WP_003411119.1.31991 WP_003411119.1.31995 WP_003411119.1.32004 WP_003411119.1.32039 WP_003411119.1.3204 WP_003411119.1.32045 WP_003411119.1.32071 WP_003411119.1.32098 WP_003411119.1.32132 WP_003411119.1.32157 WP_003411119.1.32164 WP_003411119.1.32179 WP_003411119.1.32198 WP_003411119.1.32297 WP_003411119.1.32317 WP_003411119.1.32383 WP_003411119.1.32400 WP_003411119.1.32403 WP_003411119.1.32416 WP_003411119.1.32421 WP_003411119.1.32433 WP_003411119.1.32461 WP_003411119.1.32482 WP_003411119.1.32503 WP_003411119.1.32556 WP_003411119.1.32562 WP_003411119.1.32569 WP_003411119.1.32592 WP_003411119.1.32620 WP_003411119.1.32647 WP_003411119.1.32653 WP_003411119.1.32654 WP_003411119.1.3268 WP_003411119.1.32695 WP_003411119.1.32706 WP_003411119.1.32716 WP_003411119.1.32738 WP_003411119.1.32752 WP_003411119.1.32780 WP_003411119.1.32781 WP_003411119.1.32793 WP_003411119.1.32799 WP_003411119.1.32822 WP_003411119.1.32833 WP_003411119.1.32862 WP_003411119.1.32880 WP_003411119.1.32897 WP_003411119.1.32909 WP_003411119.1.32935 WP_003411119.1.32974 WP_003411119.1.33007 WP_003411119.1.3302 WP_003411119.1.33028 WP_003411119.1.33044 WP_003411119.1.33054 WP_003411119.1.33082 WP_003411119.1.33141 WP_003411119.1.33148 WP_003411119.1.33155 WP_003411119.1.3321 WP_003411119.1.33215 WP_003411119.1.3325 WP_003411119.1.3327 WP_003411119.1.33278 WP_003411119.1.33288 WP_003411119.1.33305 WP_003411119.1.3331 WP_003411119.1.33319 WP_003411119.1.3333 WP_003411119.1.33393 WP_003411119.1.33403 WP_003411119.1.33452 WP_003411119.1.33467 WP_003411119.1.33477 WP_003411119.1.3349 WP_003411119.1.33519 WP_003411119.1.33542 WP_003411119.1.33601 WP_003411119.1.33602 WP_003411119.1.33633 WP_003411119.1.33646 WP_003411119.1.33673 WP_003411119.1.3369 WP_003411119.1.33705 WP_003411119.1.33762 WP_003411119.1.33783 WP_003411119.1.33789 WP_003411119.1.3383 WP_003411119.1.33832 WP_003411119.1.33839 WP_003411119.1.33848 WP_003411119.1.3387 WP_003411119.1.33886 WP_003411119.1.33895 WP_003411119.1.33912 WP_003411119.1.33954 WP_003411119.1.34042 WP_003411119.1.3405 WP_003411119.1.34055 WP_003411119.1.34056 WP_003411119.1.34065 WP_003411119.1.3408 WP_003411119.1.34090 WP_003411119.1.34109 WP_003411119.1.34111 WP_003411119.1.34152 WP_003411119.1.34163 WP_003411119.1.34181 WP_003411119.1.34197 WP_003411119.1.34198 WP_003411119.1.34215 WP_003411119.1.34219 WP_003411119.1.34255 WP_003411119.1.34260 WP_003411119.1.34275 WP_003411119.1.343 WP_003411119.1.34347 WP_003411119.1.34358 WP_003411119.1.34392 WP_003411119.1.344 WP_003411119.1.34428 WP_003411119.1.3443 WP_003411119.1.34435 WP_003411119.1.34446 WP_003411119.1.34499 WP_003411119.1.34505 WP_003411119.1.34516 WP_003411119.1.34529 WP_003411119.1.34551 WP_003411119.1.34563 WP_003411119.1.34576 WP_003411119.1.34581 WP_003411119.1.34588 WP_003411119.1.34596 WP_003411119.1.34599 WP_003411119.1.34639 WP_003411119.1.34673 WP_003411119.1.34724 WP_003411119.1.34740 WP_003411119.1.34755 WP_003411119.1.34777 WP_003411119.1.34783 WP_003411119.1.34841 WP_003411119.1.34908 WP_003411119.1.34919 WP_003411119.1.3492 WP_003411119.1.34933 WP_003411119.1.34945 WP_003411119.1.34946 WP_003411119.1.34954 WP_003411119.1.34960 WP_003411119.1.34961 WP_003411119.1.34963 WP_003411119.1.34965 WP_003411119.1.34968 WP_003411119.1.35023 WP_003411119.1.35069 WP_003411119.1.35072 WP_003411119.1.35078 WP_003411119.1.35100 WP_003411119.1.35156 WP_003411119.1.35160 WP_003411119.1.35162 WP_003411119.1.35173 WP_003411119.1.35176 WP_003411119.1.3520 WP_003411119.1.35213 WP_003411119.1.35221 WP_003411119.1.35246 WP_003411119.1.35278 WP_003411119.1.35301 WP_003411119.1.35311 WP_003411119.1.35312 WP_003411119.1.35317 WP_003411119.1.35319 WP_003411119.1.35347 WP_003411119.1.35363 WP_003411119.1.35382 WP_003411119.1.35385 WP_003411119.1.35396 WP_003411119.1.35397 WP_003411119.1.35426 WP_003411119.1.35439 WP_003411119.1.35455 WP_003411119.1.3548 WP_003411119.1.35484 WP_003411119.1.35492 WP_003411119.1.3553 WP_003411119.1.35553 WP_003411119.1.35555 WP_003411119.1.35561 WP_003411119.1.35602 WP_003411119.1.35610 WP_003411119.1.35635 WP_003411119.1.35657 WP_003411119.1.35680 WP_003411119.1.35687 WP_003411119.1.35689 WP_003411119.1.35707 WP_003411119.1.35732 WP_003411119.1.35754 WP_003411119.1.35767 WP_003411119.1.35770 WP_003411119.1.35771 WP_003411119.1.35780 WP_003411119.1.35805 WP_003411119.1.35821 WP_003411119.1.3584 WP_003411119.1.35848 WP_003411119.1.35864 WP_003411119.1.35874 WP_003411119.1.35876 WP_003411119.1.35899 WP_003411119.1.35954 WP_003411119.1.36005 WP_003411119.1.36014 WP_003411119.1.36023 WP_003411119.1.36051 WP_003411119.1.36053 WP_003411119.1.36075 WP_003411119.1.36089 WP_003411119.1.36097 WP_003411119.1.36098 WP_003411119.1.36116 WP_003411119.1.36145 WP_003411119.1.36205 WP_003411119.1.36228 WP_003411119.1.36246 WP_003411119.1.36252 WP_003411119.1.36260 WP_003411119.1.36271 WP_003411119.1.36303 WP_003411119.1.36309 WP_003411119.1.36315 WP_003411119.1.36319 WP_003411119.1.36321 WP_003411119.1.36326 WP_003411119.1.3634 WP_003411119.1.36356 WP_003411119.1.36357 WP_003411119.1.3636 WP_003411119.1.36385 WP_003411119.1.36399 WP_003411119.1.36436 WP_003411119.1.36465 WP_003411119.1.36469 WP_003411119.1.36473 WP_003411119.1.36485 WP_003411119.1.36508 WP_003411119.1.36540 WP_003411119.1.36561 WP_003411119.1.36571 WP_003411119.1.36573 WP_003411119.1.36578 WP_003411119.1.36585 WP_003411119.1.36597 WP_003411119.1.36614 WP_003411119.1.36657 WP_003411119.1.36674 WP_003411119.1.36720 WP_003411119.1.36727 WP_003411119.1.36733 WP_003411119.1.36785 WP_003411119.1.36810 WP_003411119.1.36862 WP_003411119.1.36893 WP_003411119.1.36901 WP_003411119.1.36921 WP_003411119.1.36935 WP_003411119.1.36941 WP_003411119.1.3695 WP_003411119.1.36968 WP_003411119.1.3700 WP_003411119.1.37004 WP_003411119.1.37012 WP_003411119.1.37071 WP_003411119.1.37088 WP_003411119.1.37131 WP_003411119.1.37157 WP_003411119.1.37175 WP_003411119.1.37188 WP_003411119.1.37213 WP_003411119.1.37229 WP_003411119.1.3724 WP_003411119.1.37277 WP_003411119.1.37305 WP_003411119.1.37330 WP_003411119.1.37389 WP_003411119.1.37400 WP_003411119.1.37440 WP_003411119.1.37459 WP_003411119.1.37468 WP_003411119.1.37475 WP_003411119.1.37484 WP_003411119.1.37601 WP_003411119.1.37612 WP_003411119.1.37632 WP_003411119.1.37643 WP_003411119.1.37655 WP_003411119.1.37660 WP_003411119.1.37674 WP_003411119.1.37700 WP_003411119.1.37701 WP_003411119.1.37709 WP_003411119.1.37711 WP_003411119.1.37721 WP_003411119.1.37722 WP_003411119.1.37747 WP_003411119.1.37765 WP_003411119.1.37772 WP_003411119.1.37804 WP_003411119.1.37809 WP_003411119.1.37859 WP_003411119.1.37877 WP_003411119.1.37912 WP_003411119.1.37913 WP_003411119.1.37943 WP_003411119.1.37950 WP_003411119.1.37973 WP_003411119.1.37975 WP_003411119.1.37983 WP_003411119.1.38 WP_003411119.1.38002 WP_003411119.1.3802 WP_003411119.1.38039 WP_003411119.1.38040 WP_003411119.1.38067 WP_003411119.1.38068 WP_003411119.1.38135 WP_003411119.1.38138 WP_003411119.1.38144 WP_003411119.1.38158 WP_003411119.1.38159 WP_003411119.1.38210 WP_003411119.1.38233 WP_003411119.1.38240 WP_003411119.1.38299 WP_003411119.1.38332 WP_003411119.1.38347 WP_003411119.1.38354 WP_003411119.1.38389 WP_003411119.1.38398 WP_003411119.1.38402 WP_003411119.1.38418 WP_003411119.1.38421 WP_003411119.1.38466 WP_003411119.1.38477 WP_003411119.1.38483 WP_003411119.1.3849 WP_003411119.1.385 WP_003411119.1.38530 WP_003411119.1.38594 WP_003411119.1.38601 WP_003411119.1.38611 WP_003411119.1.38638 WP_003411119.1.38639 WP_003411119.1.38646 WP_003411119.1.38648 WP_003411119.1.38654 WP_003411119.1.38660 WP_003411119.1.38666 WP_003411119.1.38671 WP_003411119.1.38672 WP_003411119.1.38677 WP_003411119.1.38750 WP_003411119.1.38772 WP_003411119.1.38812 WP_003411119.1.38821 WP_003411119.1.38844 WP_003411119.1.38863 WP_003411119.1.38873 WP_003411119.1.3889 WP_003411119.1.38894 WP_003411119.1.38909 WP_003411119.1.38939 WP_003411119.1.38974 WP_003411119.1.38975 WP_003411119.1.38991 WP_003411119.1.39025 WP_003411119.1.39070 WP_003411119.1.39072 WP_003411119.1.39095 WP_003411119.1.39106 WP_003411119.1.39165 WP_003411119.1.39174 WP_003411119.1.39176 WP_003411119.1.39178 WP_003411119.1.39190 WP_003411119.1.39201 WP_003411119.1.39207 WP_003411119.1.39236 WP_003411119.1.39239 WP_003411119.1.39252 WP_003411119.1.39288 WP_003411119.1.39295 WP_003411119.1.39306 WP_003411119.1.39359 WP_003411119.1.39364 WP_003411119.1.39400 WP_003411119.1.39447 WP_003411119.1.3945 WP_003411119.1.39450 WP_003411119.1.39455 WP_003411119.1.3949 WP_003411119.1.39521 WP_003411119.1.39560 WP_003411119.1.39592 WP_003411119.1.39593 WP_003411119.1.396 WP_003411119.1.3960 WP_003411119.1.39616 WP_003411119.1.39654 WP_003411119.1.39657 WP_003411119.1.39661 WP_003411119.1.39674 WP_003411119.1.39678 WP_003411119.1.3968 WP_003411119.1.39694 WP_003411119.1.3971 WP_003411119.1.39718 WP_003411119.1.39728 WP_003411119.1.39739 WP_003411119.1.39748 WP_003411119.1.39751 WP_003411119.1.39759 WP_003411119.1.39801 WP_003411119.1.39804 WP_003411119.1.39848 WP_003411119.1.39877 WP_003411119.1.39925 WP_003411119.1.3994 WP_003411119.1.39959 WP_003411119.1.3996 WP_003411119.1.39960 WP_003411119.1.3997 WP_003411119.1.39980 WP_003411119.1.40000 WP_003411119.1.40028 WP_003411119.1.4003 WP_003411119.1.40094 WP_003411119.1.40096 WP_003411119.1.40150 WP_003411119.1.40156 WP_003411119.1.40174 WP_003411119.1.40186 WP_003411119.1.40276 WP_003411119.1.40277 WP_003411119.1.40323 WP_003411119.1.40336 WP_003411119.1.40353 WP_003411119.1.4036 WP_003411119.1.40372 WP_003411119.1.40402 WP_003411119.1.40413 WP_003411119.1.40440 WP_003411119.1.40446 WP_003411119.1.40451 WP_003411119.1.40455 WP_003411119.1.40523 WP_003411119.1.40543 WP_003411119.1.40641 WP_003411119.1.40646 WP_003411119.1.40651 WP_003411119.1.40653 WP_003411119.1.4067 WP_003411119.1.40705 WP_003411119.1.40723 WP_003411119.1.40731 WP_003411119.1.40735 WP_003411119.1.40795 WP_003411119.1.40799 WP_003411119.1.40876 WP_003411119.1.40881 WP_003411119.1.40922 WP_003411119.1.4095 WP_003411119.1.40956 WP_003411119.1.40957 WP_003411119.1.4097 WP_003411119.1.410 WP_003411119.1.41000 WP_003411119.1.41055 WP_003411119.1.41108 WP_003411119.1.41123 WP_003411119.1.41177 WP_003411119.1.41202 WP_003411119.1.41219 WP_003411119.1.41231 WP_003411119.1.41249 WP_003411119.1.4127 WP_003411119.1.41355 WP_003411119.1.41376 WP_003411119.1.41430 WP_003411119.1.41447 WP_003411119.1.41469 WP_003411119.1.41504 WP_003411119.1.41553 WP_003411119.1.41564 WP_003411119.1.41583 WP_003411119.1.41632 WP_003411119.1.41635 WP_003411119.1.41636 WP_003411119.1.41648 WP_003411119.1.41660 WP_003411119.1.41685 WP_003411119.1.41695 WP_003411119.1.41704 WP_003411119.1.4171 WP_003411119.1.41719 WP_003411119.1.41733 WP_003411119.1.41744 WP_003411119.1.41774 WP_003411119.1.41791 WP_003411119.1.41803 WP_003411119.1.41820 WP_003411119.1.41828 WP_003411119.1.41829 WP_003411119.1.41860 WP_003411119.1.41912 WP_003411119.1.41921 WP_003411119.1.41933 WP_003411119.1.41944 WP_003411119.1.42043 WP_003411119.1.42078 WP_003411119.1.42094 WP_003411119.1.42112 WP_003411119.1.4212 WP_003411119.1.42122 WP_003411119.1.42134 WP_003411119.1.42183 WP_003411119.1.42188 WP_003411119.1.42201 WP_003411119.1.42202 WP_003411119.1.42208 WP_003411119.1.42247 WP_003411119.1.42255 WP_003411119.1.42278 WP_003411119.1.42304 WP_003411119.1.42309 WP_003411119.1.42370 WP_003411119.1.42385 WP_003411119.1.42400 WP_003411119.1.42409 WP_003411119.1.42414 WP_003411119.1.42417 WP_003411119.1.42430 WP_003411119.1.42461 WP_003411119.1.42465 WP_003411119.1.42467 WP_003411119.1.42473 WP_003411119.1.42474 WP_003411119.1.4248 WP_003411119.1.42494 WP_003411119.1.42519 WP_003411119.1.42524 WP_003411119.1.42534 WP_003411119.1.4255 WP_003411119.1.42562 WP_003411119.1.42568 WP_003411119.1.42570 WP_003411119.1.42618 WP_003411119.1.42660 WP_003411119.1.42695 WP_003411119.1.42704 WP_003411119.1.42705 WP_003411119.1.42722 WP_003411119.1.42777 WP_003411119.1.42782 WP_003411119.1.42835 WP_003411119.1.42839 WP_003411119.1.42842 WP_003411119.1.42905 WP_003411119.1.42916 WP_003411119.1.42930 WP_003411119.1.42971 WP_003411119.1.43005 WP_003411119.1.43009 WP_003411119.1.43053 WP_003411119.1.43082 WP_003411119.1.43087 WP_003411119.1.43098 WP_003411119.1.43208 WP_003411119.1.43236 WP_003411119.1.43246 WP_003411119.1.43255 WP_003411119.1.43266 WP_003411119.1.43269 WP_003411119.1.43273 WP_003411119.1.43296 WP_003411119.1.43306 WP_003411119.1.4335 WP_003411119.1.43368 WP_003411119.1.43395 WP_003411119.1.43457 WP_003411119.1.43462 WP_003411119.1.43475 WP_003411119.1.43478 WP_003411119.1.43484 WP_003411119.1.43557 WP_003411119.1.43578 WP_003411119.1.43588 WP_003411119.1.43643 WP_003411119.1.43664 WP_003411119.1.43684 WP_003411119.1.43686 WP_003411119.1.43706 WP_003411119.1.43716 WP_003411119.1.4377 WP_003411119.1.43781 WP_003411119.1.43794 WP_003411119.1.43815 WP_003411119.1.43846 WP_003411119.1.43861 WP_003411119.1.43863 WP_003411119.1.43866 WP_003411119.1.43872 WP_003411119.1.43885 WP_003411119.1.43897 WP_003411119.1.4390 WP_003411119.1.43902 WP_003411119.1.43921 WP_003411119.1.43936 WP_003411119.1.43937 WP_003411119.1.43960 WP_003411119.1.43965 WP_003411119.1.4399 WP_003411119.1.43993 WP_003411119.1.43996 WP_003411119.1.44 WP_003411119.1.44001 WP_003411119.1.44008 WP_003411119.1.44033 WP_003411119.1.44037 WP_003411119.1.44070 WP_003411119.1.44071 WP_003411119.1.44076 WP_003411119.1.44104 WP_003411119.1.44111 WP_003411119.1.44124 WP_003411119.1.44169 WP_003411119.1.44219 WP_003411119.1.44237 WP_003411119.1.44277 WP_003411119.1.44279 WP_003411119.1.44336 WP_003411119.1.44355 WP_003411119.1.44358 WP_003411119.1.4438 WP_003411119.1.44390 WP_003411119.1.44392 WP_003411119.1.4441 WP_003411119.1.44415 WP_003411119.1.44466 WP_003411119.1.44489 WP_003411119.1.44492 WP_003411119.1.44494 WP_003411119.1.44500 WP_003411119.1.44532 WP_003411119.1.44534 WP_003411119.1.44562 WP_003411119.1.44597 WP_003411119.1.44600 WP_003411119.1.44602 WP_003411119.1.44615 WP_003411119.1.4464 WP_003411119.1.44651 WP_003411119.1.44659 WP_003411119.1.44665 WP_003411119.1.44694 WP_003411119.1.44700 WP_003411119.1.44713 WP_003411119.1.44735 WP_003411119.1.44740 WP_003411119.1.44757 WP_003411119.1.4476 WP_003411119.1.44761 WP_003411119.1.44776 WP_003411119.1.44779 WP_003411119.1.44786 WP_003411119.1.44808 WP_003411119.1.44864 WP_003411119.1.44901 WP_003411119.1.44908 WP_003411119.1.44913 WP_003411119.1.4492 WP_003411119.1.44939 WP_003411119.1.44979 WP_003411119.1.44981 WP_003411119.1.45002 WP_003411119.1.45011 WP_003411119.1.4504 WP_003411119.1.45062 WP_003411119.1.45081 WP_003411119.1.45113 WP_003411119.1.45129 WP_003411119.1.45135 WP_003411119.1.45147 WP_003411119.1.45168 WP_003411119.1.4517 WP_003411119.1.45181 WP_003411119.1.45185 WP_003411119.1.45192 WP_003411119.1.45200 WP_003411119.1.45205 WP_003411119.1.45211 WP_003411119.1.45249 WP_003411119.1.4526 WP_003411119.1.45286 WP_003411119.1.45326 WP_003411119.1.45347 WP_003411119.1.45374 WP_003411119.1.45390 WP_003411119.1.454 WP_003411119.1.45407 WP_003411119.1.45451 WP_003411119.1.45453 WP_003411119.1.45460 WP_003411119.1.45463 WP_003411119.1.45470 WP_003411119.1.45474 WP_003411119.1.45491 WP_003411119.1.45510 WP_003411119.1.45563 WP_003411119.1.45584 WP_003411119.1.45590 WP_003411119.1.45619 WP_003411119.1.45626 WP_003411119.1.45631 WP_003411119.1.45666 WP_003411119.1.45697 WP_003411119.1.4571 WP_003411119.1.45731 WP_003411119.1.45743 WP_003411119.1.45765 WP_003411119.1.45776 WP_003411119.1.45805 WP_003411119.1.45815 WP_003411119.1.45849 WP_003411119.1.45867 WP_003411119.1.45923 WP_003411119.1.45926 WP_003411119.1.45963 WP_003411119.1.45989 WP_003411119.1.45992 WP_003411119.1.46025 WP_003411119.1.46083 WP_003411119.1.46090 WP_003411119.1.46092 WP_003411119.1.46100 WP_003411119.1.46101 WP_003411119.1.46103 WP_003411119.1.46107 WP_003411119.1.46127 WP_003411119.1.46128 WP_003411119.1.46129 WP_003411119.1.46141 WP_003411119.1.46150 WP_003411119.1.46201 WP_003411119.1.46226 WP_003411119.1.4624 WP_003411119.1.46253 WP_003411119.1.46268 WP_003411119.1.46285 WP_003411119.1.46300 WP_003411119.1.46313 WP_003411119.1.46336 WP_003411119.1.46365 WP_003411119.1.46370 WP_003411119.1.46381 WP_003411119.1.46411 WP_003411119.1.4644 WP_003411119.1.46442 WP_003411119.1.46453 WP_003411119.1.46478 WP_003411119.1.46492 WP_003411119.1.46521 WP_003411119.1.4653 WP_003411119.1.46532 WP_003411119.1.46539 WP_003411119.1.46568 WP_003411119.1.46585 WP_003411119.1.46609 WP_003411119.1.46613 WP_003411119.1.46625 WP_003411119.1.46642 WP_003411119.1.46647 WP_003411119.1.46724 WP_003411119.1.46758 WP_003411119.1.46773 WP_003411119.1.46777 WP_003411119.1.46786 WP_003411119.1.46792 WP_003411119.1.46847 WP_003411119.1.46851 WP_003411119.1.4687 WP_003411119.1.46936 WP_003411119.1.46980 WP_003411119.1.47011 WP_003411119.1.47066 WP_003411119.1.47077 WP_003411119.1.47083 WP_003411119.1.47106 WP_003411119.1.47142 WP_003411119.1.47147 WP_003411119.1.47166 WP_003411119.1.47178 WP_003411119.1.47179 WP_003411119.1.47194 WP_003411119.1.47207 WP_003411119.1.47210 WP_003411119.1.47261 WP_003411119.1.47262 WP_003411119.1.47402 WP_003411119.1.47423 WP_003411119.1.47467 WP_003411119.1.47502 WP_003411119.1.4751 WP_003411119.1.47511 WP_003411119.1.47537 WP_003411119.1.47540 WP_003411119.1.47568 WP_003411119.1.47572 WP_003411119.1.47588 WP_003411119.1.47636 WP_003411119.1.4764 WP_003411119.1.47653 WP_003411119.1.47679 WP_003411119.1.47681 WP_003411119.1.47690 WP_003411119.1.4771 WP_003411119.1.47717 WP_003411119.1.47743 WP_003411119.1.47754 WP_003411119.1.47773 WP_003411119.1.47776 WP_003411119.1.47780 WP_003411119.1.47805 WP_003411119.1.47832 WP_003411119.1.47847 WP_003411119.1.47858 WP_003411119.1.47861 WP_003411119.1.47868 WP_003411119.1.47893 WP_003411119.1.47899 WP_003411119.1.479 WP_003411119.1.47912 WP_003411119.1.47913 WP_003411119.1.47926 WP_003411119.1.4794 WP_003411119.1.47943 WP_003411119.1.47944 WP_003411119.1.47959 WP_003411119.1.47974 WP_003411119.1.47993 WP_003411119.1.48004 WP_003411119.1.48039 WP_003411119.1.48050 WP_003411119.1.48084 WP_003411119.1.48097 WP_003411119.1.48101 WP_003411119.1.48109 WP_003411119.1.4813 WP_003411119.1.48130 WP_003411119.1.48135 WP_003411119.1.48143 WP_003411119.1.48152 WP_003411119.1.48155 WP_003411119.1.48170 WP_003411119.1.48173 WP_003411119.1.48177 WP_003411119.1.48185 WP_003411119.1.48204 WP_003411119.1.48219 WP_003411119.1.4823 WP_003411119.1.48240 WP_003411119.1.48256 WP_003411119.1.48264 WP_003411119.1.48287 WP_003411119.1.48330 WP_003411119.1.48333 WP_003411119.1.48348 WP_003411119.1.48354 WP_003411119.1.48372 WP_003411119.1.48383 WP_003411119.1.48388 WP_003411119.1.48419 WP_003411119.1.48423 WP_003411119.1.48443 WP_003411119.1.48462 WP_003411119.1.48543 WP_003411119.1.48550 WP_003411119.1.48605 WP_003411119.1.48618 WP_003411119.1.4863 WP_003411119.1.48648 WP_003411119.1.48658 WP_003411119.1.48666 WP_003411119.1.48687 WP_003411119.1.48779 WP_003411119.1.4878 WP_003411119.1.48798 WP_003411119.1.48802 WP_003411119.1.48826 WP_003411119.1.48831 WP_003411119.1.48843 WP_003411119.1.48857 WP_003411119.1.4890 WP_003411119.1.48946 WP_003411119.1.48979 WP_003411119.1.49017 WP_003411119.1.49048 WP_003411119.1.49059 WP_003411119.1.4906 WP_003411119.1.4907 WP_003411119.1.49103 WP_003411119.1.49110 WP_003411119.1.49112 WP_003411119.1.4919 WP_003411119.1.49251 WP_003411119.1.49254 WP_003411119.1.49263 WP_003411119.1.49291 WP_003411119.1.49296 WP_003411119.1.49335 WP_003411119.1.49337 WP_003411119.1.49419 WP_003411119.1.49426 WP_003411119.1.49437 WP_003411119.1.49439 WP_003411119.1.49474 WP_003411119.1.49506 WP_003411119.1.49523 WP_003411119.1.49526 WP_003411119.1.49532 WP_003411119.1.4959 WP_003411119.1.49678 WP_003411119.1.49687 WP_003411119.1.49699 WP_003411119.1.49709 WP_003411119.1.4971 WP_003411119.1.4972 WP_003411119.1.49736 WP_003411119.1.49746 WP_003411119.1.49764 WP_003411119.1.49773 WP_003411119.1.49796 WP_003411119.1.49814 WP_003411119.1.49815 WP_003411119.1.49816 WP_003411119.1.49839 WP_003411119.1.49857 WP_003411119.1.49878 WP_003411119.1.49880 WP_003411119.1.49944 WP_003411119.1.4999 WP_003411119.1.49990 WP_003411119.1.50068 WP_003411119.1.50077 WP_003411119.1.5008 WP_003411119.1.50081 WP_003411119.1.50122 WP_003411119.1.50126 WP_003411119.1.50149 WP_003411119.1.50162 WP_003411119.1.5018 WP_003411119.1.50194 WP_003411119.1.50218 WP_003411119.1.50235 WP_003411119.1.50249 WP_003411119.1.50265 WP_003411119.1.50271 WP_003411119.1.50324 WP_003411119.1.50347 WP_003411119.1.50372 WP_003411119.1.50398 WP_003411119.1.50407 WP_003411119.1.50444 WP_003411119.1.50466 WP_003411119.1.50472 WP_003411119.1.5048 WP_003411119.1.50498 WP_003411119.1.5050 WP_003411119.1.50540 WP_003411119.1.50554 WP_003411119.1.50557 WP_003411119.1.50601 WP_003411119.1.50610 WP_003411119.1.50632 WP_003411119.1.50633 WP_003411119.1.50655 WP_003411119.1.50659 WP_003411119.1.50683 WP_003411119.1.50689 WP_003411119.1.50692 WP_003411119.1.50714 WP_003411119.1.50729 WP_003411119.1.50756 WP_003411119.1.50784 WP_003411119.1.50794 WP_003411119.1.50841 WP_003411119.1.50860 WP_003411119.1.50868 WP_003411119.1.50877 WP_003411119.1.5096 WP_003411119.1.50981 WP_003411119.1.50987 WP_003411119.1.51003 WP_003411119.1.51009 WP_003411119.1.51037 WP_003411119.1.51074 WP_003411119.1.51082 WP_003411119.1.51101 WP_003411119.1.51116 WP_003411119.1.51149 WP_003411119.1.51156 WP_003411119.1.51157 WP_003411119.1.51213 WP_003411119.1.51232 WP_003411119.1.51239 WP_003411119.1.51247 WP_003411119.1.51266 WP_003411119.1.51279 WP_003411119.1.51291 WP_003411119.1.51294 WP_003411119.1.51301 WP_003411119.1.51329 WP_003411119.1.51391 WP_003411119.1.51422 WP_003411119.1.51445 WP_003411119.1.51455 WP_003411119.1.51466 WP_003411119.1.51468 WP_003411119.1.51478 WP_003411119.1.51497 WP_003411119.1.51520 WP_003411119.1.51593 WP_003411119.1.51628 WP_003411119.1.5164 WP_003411119.1.51647 WP_003411119.1.51660 WP_003411119.1.51696 WP_003411119.1.51721 WP_003411119.1.51788 WP_003411119.1.51795 WP_003411119.1.51801 WP_003411119.1.51817 WP_003411119.1.51819 WP_003411119.1.51854 WP_003411119.1.51923 WP_003411119.1.51942 WP_003411119.1.51948 WP_003411119.1.51963 WP_003411119.1.51969 WP_003411119.1.52000 WP_003411119.1.52001 WP_003411119.1.52003 WP_003411119.1.52006 WP_003411119.1.52036 WP_003411119.1.52046 WP_003411119.1.52059 WP_003411119.1.52069 WP_003411119.1.52082 WP_003411119.1.52102 WP_003411119.1.52106 WP_003411119.1.52166 WP_003411119.1.52168 WP_003411119.1.52173 WP_003411119.1.52178 WP_003411119.1.52206 WP_003411119.1.52216 WP_003411119.1.52238 WP_003411119.1.52241 WP_003411119.1.52280 WP_003411119.1.52314 WP_003411119.1.52385 WP_003411119.1.52390 WP_003411119.1.524 WP_003411119.1.52460 WP_003411119.1.52485 WP_003411119.1.52486 WP_003411119.1.52495 WP_003411119.1.52504 WP_003411119.1.52522 WP_003411119.1.52531 WP_003411119.1.52533 WP_003411119.1.52545 WP_003411119.1.52553 WP_003411119.1.52563 WP_003411119.1.52564 WP_003411119.1.52574 WP_003411119.1.52641 WP_003411119.1.52673 WP_003411119.1.52674 WP_003411119.1.52708 WP_003411119.1.52713 WP_003411119.1.52761 WP_003411119.1.52778 WP_003411119.1.52797 WP_003411119.1.52818 WP_003411119.1.52872 WP_003411119.1.52873 WP_003411119.1.52891 WP_003411119.1.52892 WP_003411119.1.52909 WP_003411119.1.52970 WP_003411119.1.52998 WP_003411119.1.53053 WP_003411119.1.53056 WP_003411119.1.5306 WP_003411119.1.53088 WP_003411119.1.5309 WP_003411119.1.531 WP_003411119.1.53117 WP_003411119.1.53118 WP_003411119.1.53142 WP_003411119.1.53143 WP_003411119.1.53157 WP_003411119.1.53167 WP_003411119.1.53200 WP_003411119.1.53213 WP_003411119.1.53217 WP_003411119.1.53226 WP_003411119.1.53229 WP_003411119.1.53230 WP_003411119.1.53237 WP_003411119.1.53254 WP_003411119.1.53257 WP_003411119.1.5327 WP_003411119.1.53276 WP_003411119.1.53278 WP_003411119.1.533 WP_003411119.1.53306 WP_003411119.1.5334 WP_003411119.1.5335 WP_003411119.1.53353 WP_003411119.1.53381 WP_003411119.1.53413 WP_003411119.1.53458 WP_003411119.1.53460 WP_003411119.1.53480 WP_003411119.1.53517 WP_003411119.1.53522 WP_003411119.1.53525 WP_003411119.1.53526 WP_003411119.1.53553 WP_003411119.1.53606 WP_003411119.1.53609 WP_003411119.1.53628 WP_003411119.1.53643 WP_003411119.1.53667 WP_003411119.1.53679 WP_003411119.1.53715 WP_003411119.1.53730 WP_003411119.1.53742 WP_003411119.1.53743 WP_003411119.1.53754 WP_003411119.1.53775 WP_003411119.1.53787 WP_003411119.1.53803 WP_003411119.1.53818 WP_003411119.1.53853 WP_003411119.1.53865 WP_003411119.1.53888 WP_003411119.1.53900 WP_003411119.1.53912 WP_003411119.1.53914 WP_003411119.1.53952 WP_003411119.1.53973 WP_003411119.1.5398 WP_003411119.1.5408 WP_003411119.1.54089 WP_003411119.1.54093 WP_003411119.1.54099 WP_003411119.1.54112 WP_003411119.1.54125 WP_003411119.1.54141 WP_003411119.1.54162 WP_003411119.1.54179 WP_003411119.1.54206 WP_003411119.1.54218 WP_003411119.1.54225 WP_003411119.1.54227 WP_003411119.1.54232 WP_003411119.1.54241 WP_003411119.1.54245 WP_003411119.1.54247 WP_003411119.1.54260 WP_003411119.1.54275 WP_003411119.1.54280 WP_003411119.1.5429 WP_003411119.1.54294 WP_003411119.1.54314 WP_003411119.1.54351 WP_003411119.1.54370 WP_003411119.1.54428 WP_003411119.1.54449 WP_003411119.1.54494 WP_003411119.1.54502 WP_003411119.1.54514 WP_003411119.1.54519 WP_003411119.1.5452 WP_003411119.1.54531 WP_003411119.1.54537 WP_003411119.1.54553 WP_003411119.1.54555 WP_003411119.1.54575 WP_003411119.1.54633 WP_003411119.1.54686 WP_003411119.1.54687 WP_003411119.1.54705 WP_003411119.1.54730 WP_003411119.1.54732 WP_003411119.1.5475 WP_003411119.1.54797 WP_003411119.1.54807 WP_003411119.1.54836 WP_003411119.1.54838 WP_003411119.1.54860 WP_003411119.1.54888 WP_003411119.1.54897 WP_003411119.1.54905 WP_003411119.1.54909 WP_003411119.1.54937 WP_003411119.1.54939 WP_003411119.1.54944 WP_003411119.1.54945 WP_003411119.1.54953 WP_003411119.1.54964 WP_003411119.1.55015 WP_003411119.1.55022 WP_003411119.1.55023 WP_003411119.1.55051 WP_003411119.1.55072 WP_003411119.1.55106 WP_003411119.1.55126 WP_003411119.1.55128 WP_003411119.1.55140 WP_003411119.1.55150 WP_003411119.1.55210 WP_003411119.1.55227 WP_003411119.1.55248 WP_003411119.1.55257 WP_003411119.1.55258 WP_003411119.1.55267 WP_003411119.1.55279 WP_003411119.1.55307 WP_003411119.1.55326 WP_003411119.1.55328 WP_003411119.1.5533 WP_003411119.1.55345 WP_003411119.1.55396 WP_003411119.1.55398 WP_003411119.1.55441 WP_003411119.1.55459 WP_003411119.1.55501 WP_003411119.1.55578 WP_003411119.1.55626 WP_003411119.1.55641 WP_003411119.1.5569 WP_003411119.1.55723 WP_003411119.1.55735 WP_003411119.1.5574 WP_003411119.1.55772 WP_003411119.1.55802 WP_003411119.1.55819 WP_003411119.1.55821 WP_003411119.1.5583 WP_003411119.1.55849 WP_003411119.1.55856 WP_003411119.1.55860 WP_003411119.1.55882 WP_003411119.1.55883 WP_003411119.1.55894 WP_003411119.1.55902 WP_003411119.1.55908 WP_003411119.1.55909 WP_003411119.1.5591 WP_003411119.1.55961 WP_003411119.1.55977 WP_003411119.1.55983 WP_003411119.1.56028 WP_003411119.1.56057 WP_003411119.1.56060 WP_003411119.1.56107 WP_003411119.1.56132 WP_003411119.1.56163 WP_003411119.1.56167 WP_003411119.1.56178 WP_003411119.1.56287 WP_003411119.1.56292 WP_003411119.1.56327 WP_003411119.1.56341 WP_003411119.1.56359 WP_003411119.1.56365 WP_003411119.1.56394 WP_003411119.1.56443 WP_003411119.1.56473 WP_003411119.1.56478 WP_003411119.1.56500 WP_003411119.1.56517 WP_003411119.1.56577 WP_003411119.1.56593 WP_003411119.1.56625 WP_003411119.1.56637 WP_003411119.1.56670 WP_003411119.1.56697 WP_003411119.1.567 WP_003411119.1.56701 WP_003411119.1.56729 WP_003411119.1.56743 WP_003411119.1.56755 WP_003411119.1.56764 WP_003411119.1.56769 WP_003411119.1.56770 WP_003411119.1.56795 WP_003411119.1.5681 WP_003411119.1.56827 WP_003411119.1.56839 WP_003411119.1.56863 WP_003411119.1.56868 WP_003411119.1.56869 WP_003411119.1.56915 WP_003411119.1.56926 WP_003411119.1.56961 WP_003411119.1.56971 WP_003411119.1.56972 WP_003411119.1.57023 WP_003411119.1.57035 WP_003411119.1.57077 WP_003411119.1.57087 WP_003411119.1.57094 WP_003411119.1.57134 WP_003411119.1.57169 WP_003411119.1.57208 WP_003411119.1.57212 WP_003411119.1.57230 WP_003411119.1.5724 WP_003411119.1.5725 WP_003411119.1.5727 WP_003411119.1.57273 WP_003411119.1.573 WP_003411119.1.57326 WP_003411119.1.57328 WP_003411119.1.57331 WP_003411119.1.57340 WP_003411119.1.57351 WP_003411119.1.57380 WP_003411119.1.57430 WP_003411119.1.5744 WP_003411119.1.57440 WP_003411119.1.5745 WP_003411119.1.57461 WP_003411119.1.57469 WP_003411119.1.57489 WP_003411119.1.575 WP_003411119.1.57509 WP_003411119.1.57519 WP_003411119.1.57525 WP_003411119.1.57551 WP_003411119.1.57596 WP_003411119.1.57604 WP_003411119.1.57616 WP_003411119.1.57619 WP_003411119.1.57627 WP_003411119.1.57642 WP_003411119.1.57658 WP_003411119.1.57667 WP_003411119.1.57675 WP_003411119.1.57689 WP_003411119.1.57708 WP_003411119.1.57794 WP_003411119.1.57821 WP_003411119.1.57825 WP_003411119.1.57843 WP_003411119.1.57906 WP_003411119.1.57924 WP_003411119.1.57926 WP_003411119.1.57957 WP_003411119.1.57960 WP_003411119.1.57964 WP_003411119.1.57991 WP_003411119.1.58000 WP_003411119.1.58086 WP_003411119.1.58101 WP_003411119.1.58103 WP_003411119.1.58108 WP_003411119.1.5811 WP_003411119.1.58121 WP_003411119.1.58145 WP_003411119.1.58164 WP_003411119.1.58174 WP_003411119.1.582 WP_003411119.1.58209 WP_003411119.1.58215 WP_003411119.1.5824 WP_003411119.1.58250 WP_003411119.1.58259 WP_003411119.1.58283 WP_003411119.1.58288 WP_003411119.1.5830 WP_003411119.1.58303 WP_003411119.1.58311 WP_003411119.1.58330 WP_003411119.1.58359 WP_003411119.1.58386 WP_003411119.1.58393 WP_003411119.1.58431 WP_003411119.1.5844 WP_003411119.1.58457 WP_003411119.1.58488 WP_003411119.1.58518 WP_003411119.1.58534 WP_003411119.1.58559 WP_003411119.1.58567 WP_003411119.1.58573 WP_003411119.1.58602 WP_003411119.1.58612 WP_003411119.1.58619 WP_003411119.1.58630 WP_003411119.1.5865 WP_003411119.1.58671 WP_003411119.1.58690 WP_003411119.1.58702 WP_003411119.1.58743 WP_003411119.1.58754 WP_003411119.1.5879 WP_003411119.1.5881 WP_003411119.1.58824 WP_003411119.1.58848 WP_003411119.1.58857 WP_003411119.1.58891 WP_003411119.1.58892 WP_003411119.1.5890 WP_003411119.1.58904 WP_003411119.1.58921 WP_003411119.1.58930 WP_003411119.1.58953 WP_003411119.1.58961 WP_003411119.1.5898 WP_003411119.1.59025 WP_003411119.1.59029 WP_003411119.1.59037 WP_003411119.1.59044 WP_003411119.1.59085 WP_003411119.1.59088 WP_003411119.1.59112 WP_003411119.1.59130 WP_003411119.1.5914 WP_003411119.1.59147 WP_003411119.1.59166 WP_003411119.1.59205 WP_003411119.1.59209 WP_003411119.1.59237 WP_003411119.1.59240 WP_003411119.1.59253 WP_003411119.1.59254 WP_003411119.1.59262 WP_003411119.1.59270 WP_003411119.1.5928 WP_003411119.1.59304 WP_003411119.1.59305 WP_003411119.1.59309 WP_003411119.1.59326 WP_003411119.1.59328 WP_003411119.1.59333 WP_003411119.1.59338 WP_003411119.1.59388 WP_003411119.1.59428 WP_003411119.1.59487 WP_003411119.1.59537 WP_003411119.1.59561 WP_003411119.1.59677 WP_003411119.1.59722 WP_003411119.1.59727 WP_003411119.1.59732 WP_003411119.1.59738 WP_003411119.1.59750 WP_003411119.1.59757 WP_003411119.1.59761 WP_003411119.1.59808 WP_003411119.1.59850 WP_003411119.1.59860 WP_003411119.1.59861 WP_003411119.1.5987 WP_003411119.1.59878 WP_003411119.1.59888 WP_003411119.1.59952 WP_003411119.1.5996 WP_003411119.1.59961 WP_003411119.1.59974 WP_003411119.1.6000 WP_003411119.1.6003 WP_003411119.1.60047 WP_003411119.1.6007 WP_003411119.1.60091 WP_003411119.1.60121 WP_003411119.1.60125 WP_003411119.1.60135 WP_003411119.1.60139 WP_003411119.1.60152 WP_003411119.1.60171 WP_003411119.1.60197 WP_003411119.1.6020 WP_003411119.1.60205 WP_003411119.1.60207 WP_003411119.1.60215 WP_003411119.1.60217 WP_003411119.1.60267 WP_003411119.1.60288 WP_003411119.1.60291 WP_003411119.1.60301 WP_003411119.1.60305 WP_003411119.1.60312 WP_003411119.1.60313 WP_003411119.1.60314 WP_003411119.1.60367 WP_003411119.1.60376 WP_003411119.1.60403 WP_003411119.1.60413 WP_003411119.1.60421 WP_003411119.1.60451 WP_003411119.1.60460 WP_003411119.1.60487 WP_003411119.1.60512 WP_003411119.1.60573 WP_003411119.1.60583 WP_003411119.1.60632 WP_003411119.1.60657 WP_003411119.1.60687 WP_003411119.1.60689 WP_003411119.1.60727 WP_003411119.1.60738 WP_003411119.1.60763 WP_003411119.1.6077 WP_003411119.1.60791 WP_003411119.1.60834 WP_003411119.1.60878 WP_003411119.1.60879 WP_003411119.1.60913 WP_003411119.1.60978 WP_003411119.1.61000 WP_003411119.1.61001 WP_003411119.1.61012 WP_003411119.1.61014 WP_003411119.1.61015 WP_003411119.1.61037 WP_003411119.1.61052 WP_003411119.1.61065 WP_003411119.1.61100 WP_003411119.1.61101 WP_003411119.1.61138 WP_003411119.1.61142 WP_003411119.1.61198 WP_003411119.1.612 WP_003411119.1.61234 WP_003411119.1.61256 WP_003411119.1.61281 WP_003411119.1.61314 WP_003411119.1.61321 WP_003411119.1.61326 WP_003411119.1.61328 WP_003411119.1.61368 WP_003411119.1.61391 WP_003411119.1.61406 WP_003411119.1.61409 WP_003411119.1.61420 WP_003411119.1.61422 WP_003411119.1.61425 WP_003411119.1.61428 WP_003411119.1.61469 WP_003411119.1.61522 WP_003411119.1.61552 WP_003411119.1.61557 WP_003411119.1.61567 WP_003411119.1.61571 WP_003411119.1.61573 WP_003411119.1.61584 WP_003411119.1.61586 WP_003411119.1.6159 WP_003411119.1.61592 WP_003411119.1.6160 WP_003411119.1.61614 WP_003411119.1.6163 WP_003411119.1.61655 WP_003411119.1.61665 WP_003411119.1.61669 WP_003411119.1.61682 WP_003411119.1.61692 WP_003411119.1.61719 WP_003411119.1.61728 WP_003411119.1.61750 WP_003411119.1.61754 WP_003411119.1.61755 WP_003411119.1.61757 WP_003411119.1.61778 WP_003411119.1.6179 WP_003411119.1.61793 WP_003411119.1.61816 WP_003411119.1.61842 WP_003411119.1.61850 WP_003411119.1.61862 WP_003411119.1.61865 WP_003411119.1.61868 WP_003411119.1.61911 WP_003411119.1.61925 WP_003411119.1.61941 WP_003411119.1.61953 WP_003411119.1.61986 WP_003411119.1.61987 WP_003411119.1.61998 WP_003411119.1.62021 WP_003411119.1.62087 WP_003411119.1.62089 WP_003411119.1.62101 WP_003411119.1.62104 WP_003411119.1.6211 WP_003411119.1.62132 WP_003411119.1.62162 WP_003411119.1.62225 WP_003411119.1.62230 WP_003411119.1.62238 WP_003411119.1.62249 WP_003411119.1.62270 WP_003411119.1.62281 WP_003411119.1.62307 WP_003411119.1.6231 WP_003411119.1.62359 WP_003411119.1.62371 WP_003411119.1.62379 WP_003411119.1.62395 WP_003411119.1.62449 WP_003411119.1.62468 WP_003411119.1.6248 WP_003411119.1.62508 WP_003411119.1.62565 WP_003411119.1.62594 WP_003411119.1.62606 WP_003411119.1.62616 WP_003411119.1.62666 WP_003411119.1.62687 WP_003411119.1.62715 WP_003411119.1.62730 WP_003411119.1.62738 WP_003411119.1.62761 WP_003411119.1.62766 WP_003411119.1.62813 WP_003411119.1.62839 WP_003411119.1.62841 WP_003411119.1.62909 WP_003411119.1.62936 WP_003411119.1.6294 WP_003411119.1.6295 WP_003411119.1.62962 WP_003411119.1.63007 WP_003411119.1.63019 WP_003411119.1.63032 WP_003411119.1.63037 WP_003411119.1.63064 WP_003411119.1.63066 WP_003411119.1.63072 WP_003411119.1.6308 WP_003411119.1.63081 WP_003411119.1.63096 WP_003411119.1.63106 WP_003411119.1.63144 WP_003411119.1.63160 WP_003411119.1.63161 WP_003411119.1.63175 WP_003411119.1.63194 WP_003411119.1.63222 WP_003411119.1.6328 WP_003411119.1.63291 WP_003411119.1.63312 WP_003411119.1.63317 WP_003411119.1.63331 WP_003411119.1.63373 WP_003411119.1.63384 WP_003411119.1.63403 WP_003411119.1.63424 WP_003411119.1.63428 WP_003411119.1.6345 WP_003411119.1.63464 WP_003411119.1.63483 WP_003411119.1.63502 WP_003411119.1.63504 WP_003411119.1.63522 WP_003411119.1.63530 WP_003411119.1.63538 WP_003411119.1.63564 WP_003411119.1.63567 WP_003411119.1.63596 WP_003411119.1.63600 WP_003411119.1.63623 WP_003411119.1.63624 WP_003411119.1.63625 WP_003411119.1.63627 WP_003411119.1.63654 WP_003411119.1.63662 WP_003411119.1.63711 WP_003411119.1.63734 WP_003411119.1.63807 WP_003411119.1.63819 WP_003411119.1.63844 WP_003411119.1.63888 WP_003411119.1.63913 WP_003411119.1.63915 WP_003411119.1.63918 WP_003411119.1.63961 WP_003411119.1.63970 WP_003411119.1.64000 WP_003411119.1.64027 WP_003411119.1.64058 WP_003411119.1.64065 WP_003411119.1.6407 WP_003411119.1.64082 WP_003411119.1.64091 WP_003411119.1.64102 WP_003411119.1.64104 WP_003411119.1.64169 WP_003411119.1.64219 WP_003411119.1.6422 WP_003411119.1.64222 WP_003411119.1.64228 WP_003411119.1.64235 WP_003411119.1.64249 WP_003411119.1.6427 WP_003411119.1.64278 WP_003411119.1.64287 WP_003411119.1.64414 WP_003411119.1.64419 WP_003411119.1.6443 WP_003411119.1.64463 WP_003411119.1.64480 WP_003411119.1.64497 WP_003411119.1.64506 WP_003411119.1.64511 WP_003411119.1.64513 WP_003411119.1.64515 WP_003411119.1.64522 WP_003411119.1.64526 WP_003411119.1.64543 WP_003411119.1.6456 WP_003411119.1.64567 WP_003411119.1.64588 WP_003411119.1.64589 WP_003411119.1.64594 WP_003411119.1.64595 WP_003411119.1.64608 WP_003411119.1.64619 WP_003411119.1.64629 WP_003411119.1.6464 WP_003411119.1.64664 WP_003411119.1.64669 WP_003411119.1.64672 WP_003411119.1.64680 WP_003411119.1.64682 WP_003411119.1.64727 WP_003411119.1.64729 WP_003411119.1.64774 WP_003411119.1.64776 WP_003411119.1.64832 WP_003411119.1.6486 WP_003411119.1.64870 WP_003411119.1.64898 WP_003411119.1.64922 WP_003411119.1.64924 WP_003411119.1.6493 WP_003411119.1.64941 WP_003411119.1.64966 WP_003411119.1.65001 WP_003411119.1.65026 WP_003411119.1.65053 WP_003411119.1.65070 WP_003411119.1.65079 WP_003411119.1.65102 WP_003411119.1.65157 WP_003411119.1.65181 WP_003411119.1.65212 WP_003411119.1.65229 WP_003411119.1.6523 WP_003411119.1.65253 WP_003411119.1.65289 WP_003411119.1.65291 WP_003411119.1.65315 WP_003411119.1.65329 WP_003411119.1.65359 WP_003411119.1.6536 WP_003411119.1.65374 WP_003411119.1.65386 WP_003411119.1.65414 WP_003411119.1.65416 WP_003411119.1.65433 WP_003411119.1.65455 WP_003411119.1.65467 WP_003411119.1.65488 WP_003411119.1.65529 WP_003411119.1.65539 WP_003411119.1.65583 WP_003411119.1.65612 WP_003411119.1.65623 WP_003411119.1.65635 WP_003411119.1.65637 WP_003411119.1.65648 WP_003411119.1.65683 WP_003411119.1.65686 WP_003411119.1.65688 WP_003411119.1.65707 WP_003411119.1.65733 WP_003411119.1.65746 WP_003411119.1.65747 WP_003411119.1.65759 WP_003411119.1.65816 WP_003411119.1.65830 WP_003411119.1.65858 WP_003411119.1.65862 WP_003411119.1.65869 WP_003411119.1.65893 WP_003411119.1.65929 WP_003411119.1.65932 WP_003411119.1.65958 WP_003411119.1.65974 WP_003411119.1.66004 WP_003411119.1.66013 WP_003411119.1.6606 WP_003411119.1.66089 WP_003411119.1.66149 WP_003411119.1.66151 WP_003411119.1.66276 WP_003411119.1.66293 WP_003411119.1.66297 WP_003411119.1.66323 WP_003411119.1.66325 WP_003411119.1.6633 WP_003411119.1.66334 WP_003411119.1.66355 WP_003411119.1.66367 WP_003411119.1.66394 WP_003411119.1.66396 WP_003411119.1.66451 WP_003411119.1.66455 WP_003411119.1.66457 WP_003411119.1.66460 WP_003411119.1.66464 WP_003411119.1.66466 WP_003411119.1.66487 WP_003411119.1.66504 WP_003411119.1.66544 WP_003411119.1.66558 WP_003411119.1.66580 WP_003411119.1.66582 WP_003411119.1.66612 WP_003411119.1.66617 WP_003411119.1.66635 WP_003411119.1.66656 WP_003411119.1.66663 WP_003411119.1.66675 WP_003411119.1.66715 WP_003411119.1.66718 WP_003411119.1.66762 WP_003411119.1.66776 WP_003411119.1.66808 WP_003411119.1.66817 WP_003411119.1.66819 WP_003411119.1.66826 WP_003411119.1.66830 WP_003411119.1.66842 WP_003411119.1.66868 WP_003411119.1.66878 WP_003411119.1.66880 WP_003411119.1.66893 WP_003411119.1.66961 WP_003411119.1.67005 WP_003411119.1.6704 WP_003411119.1.67044 WP_003411119.1.67061 WP_003411119.1.67098 WP_003411119.1.67146 WP_003411119.1.67197 WP_003411119.1.67198 WP_003411119.1.6720 WP_003411119.1.67207 WP_003411119.1.67218 WP_003411119.1.67220 WP_003411119.1.67225 WP_003411119.1.67231 WP_003411119.1.6724 WP_003411119.1.67257 WP_003411119.1.67298 WP_003411119.1.67307 WP_003411119.1.67324 WP_003411119.1.67332 WP_003411119.1.67346 WP_003411119.1.67360 WP_003411119.1.67381 WP_003411119.1.67396 WP_003411119.1.67417 WP_003411119.1.67422 WP_003411119.1.67453 WP_003411119.1.67459 WP_003411119.1.6746 WP_003411119.1.67473 WP_003411119.1.67482 WP_003411119.1.67496 WP_003411119.1.67499 WP_003411119.1.67523 WP_003411119.1.67536 WP_003411119.1.67575 WP_003411119.1.67587 WP_003411119.1.67598 WP_003411119.1.67600 WP_003411119.1.67602 WP_003411119.1.67630 WP_003411119.1.67679 WP_003411119.1.67692 WP_003411119.1.67744 WP_003411119.1.6775 WP_003411119.1.6777 WP_003411119.1.67809 WP_003411119.1.67816 WP_003411119.1.67844 WP_003411119.1.67848 WP_003411119.1.67870 WP_003411119.1.67888 WP_003411119.1.67915 WP_003411119.1.67945 WP_003411119.1.67949 WP_003411119.1.67980 WP_003411119.1.67982 WP_003411119.1.68022 WP_003411119.1.68029 WP_003411119.1.68037 WP_003411119.1.68038 WP_003411119.1.68045 WP_003411119.1.68057 WP_003411119.1.68083 WP_003411119.1.68088 WP_003411119.1.68106 WP_003411119.1.68153 WP_003411119.1.68169 WP_003411119.1.68193 WP_003411119.1.68212 WP_003411119.1.68227 WP_003411119.1.68243 WP_003411119.1.6825 WP_003411119.1.68297 WP_003411119.1.68309 WP_003411119.1.68325 WP_003411119.1.68329 WP_003411119.1.68340 WP_003411119.1.68384 WP_003411119.1.68388 WP_003411119.1.6843 WP_003411119.1.68433 WP_003411119.1.68444 WP_003411119.1.68465 WP_003411119.1.68518 WP_003411119.1.68569 WP_003411119.1.68576 WP_003411119.1.68580 WP_003411119.1.68586 WP_003411119.1.68623 WP_003411119.1.68637 WP_003411119.1.68646 WP_003411119.1.68667 WP_003411119.1.68669 WP_003411119.1.68672 WP_003411119.1.68684 WP_003411119.1.68704 WP_003411119.1.68708 WP_003411119.1.6872 WP_003411119.1.68730 WP_003411119.1.68734 WP_003411119.1.68748 WP_003411119.1.68754 WP_003411119.1.6876 WP_003411119.1.68761 WP_003411119.1.68763 WP_003411119.1.68766 WP_003411119.1.68774 WP_003411119.1.68796 WP_003411119.1.68824 WP_003411119.1.68832 WP_003411119.1.68833 WP_003411119.1.68841 WP_003411119.1.68859 WP_003411119.1.68876 WP_003411119.1.68906 WP_003411119.1.68916 WP_003411119.1.68923 WP_003411119.1.68945 WP_003411119.1.6896 WP_003411119.1.68981 WP_003411119.1.68984 WP_003411119.1.68997 WP_003411119.1.69076 WP_003411119.1.69079 WP_003411119.1.6908 WP_003411119.1.69082 WP_003411119.1.69178 WP_003411119.1.69181 WP_003411119.1.69208 WP_003411119.1.69231 WP_003411119.1.69256 WP_003411119.1.69311 WP_003411119.1.69315 WP_003411119.1.69322 WP_003411119.1.69342 WP_003411119.1.6935 WP_003411119.1.6936 WP_003411119.1.69369 WP_003411119.1.69374 WP_003411119.1.69398 WP_003411119.1.69401 WP_003411119.1.69426 WP_003411119.1.69427 WP_003411119.1.69429 WP_003411119.1.6949 WP_003411119.1.6951 WP_003411119.1.69511 WP_003411119.1.69526 WP_003411119.1.69528 WP_003411119.1.69547 WP_003411119.1.69573 WP_003411119.1.69581 WP_003411119.1.6960 WP_003411119.1.69617 WP_003411119.1.69634 WP_003411119.1.69647 WP_003411119.1.69659 WP_003411119.1.69673 WP_003411119.1.69682 WP_003411119.1.69684 WP_003411119.1.69686 WP_003411119.1.69707 WP_003411119.1.69709 WP_003411119.1.69723 WP_003411119.1.69736 WP_003411119.1.69778 WP_003411119.1.69800 WP_003411119.1.69802 WP_003411119.1.69845 WP_003411119.1.69870 WP_003411119.1.69873 WP_003411119.1.69898 WP_003411119.1.69913 WP_003411119.1.69931 WP_003411119.1.69938 WP_003411119.1.69955 WP_003411119.1.69957 WP_003411119.1.69981 WP_003411119.1.69990 WP_003411119.1.70 WP_003411119.1.70000 WP_003411119.1.70017 WP_003411119.1.70032 WP_003411119.1.70055 WP_003411119.1.70062 WP_003411119.1.70072 WP_003411119.1.70131 WP_003411119.1.70132 WP_003411119.1.7022 WP_003411119.1.70227 WP_003411119.1.70255 WP_003411119.1.70271 WP_003411119.1.70274 WP_003411119.1.7029 WP_003411119.1.70325 WP_003411119.1.70328 WP_003411119.1.70356 WP_003411119.1.70364 WP_003411119.1.70368 WP_003411119.1.70369 WP_003411119.1.70418 WP_003411119.1.70422 WP_003411119.1.70435 WP_003411119.1.70444 WP_003411119.1.70463 WP_003411119.1.70471 WP_003411119.1.70480 WP_003411119.1.70494 WP_003411119.1.70498 WP_003411119.1.70525 WP_003411119.1.70573 WP_003411119.1.70577 WP_003411119.1.70610 WP_003411119.1.70615 WP_003411119.1.70618 WP_003411119.1.70622 WP_003411119.1.70626 WP_003411119.1.70668 WP_003411119.1.70699 WP_003411119.1.70704 WP_003411119.1.70729 WP_003411119.1.70757 WP_003411119.1.70782 WP_003411119.1.70796 WP_003411119.1.70830 WP_003411119.1.70834 WP_003411119.1.7084 WP_003411119.1.70840 WP_003411119.1.70864 WP_003411119.1.70871 WP_003411119.1.70915 WP_003411119.1.70958 WP_003411119.1.70964 WP_003411119.1.70976 WP_003411119.1.71015 WP_003411119.1.71063 WP_003411119.1.71076 WP_003411119.1.71083 WP_003411119.1.7111 WP_003411119.1.71118 WP_003411119.1.71128 WP_003411119.1.7113 WP_003411119.1.71187 WP_003411119.1.71191 WP_003411119.1.71255 WP_003411119.1.71258 WP_003411119.1.71259 WP_003411119.1.71289 WP_003411119.1.71326 WP_003411119.1.71329 WP_003411119.1.71331 WP_003411119.1.71344 WP_003411119.1.71390 WP_003411119.1.71399 WP_003411119.1.71414 WP_003411119.1.71440 WP_003411119.1.71457 WP_003411119.1.7146 WP_003411119.1.71464 WP_003411119.1.71490 WP_003411119.1.71492 WP_003411119.1.71509 WP_003411119.1.71516 WP_003411119.1.71517 WP_003411119.1.71527 WP_003411119.1.71532 WP_003411119.1.71545 WP_003411119.1.71546 WP_003411119.1.71569 WP_003411119.1.71604 WP_003411119.1.71621 WP_003411119.1.71630 WP_003411119.1.71638 WP_003411119.1.71654 WP_003411119.1.71664 WP_003411119.1.71665 WP_003411119.1.71701 WP_003411119.1.71718 WP_003411119.1.71731 WP_003411119.1.71778 WP_003411119.1.71781 WP_003411119.1.71803 WP_003411119.1.71820 WP_003411119.1.71847 WP_003411119.1.7185 WP_003411119.1.71851 WP_003411119.1.71871 WP_003411119.1.71909 WP_003411119.1.71957 WP_003411119.1.71970 WP_003411119.1.72047 WP_003411119.1.72061 WP_003411119.1.72062 WP_003411119.1.72072 WP_003411119.1.72111 WP_003411119.1.72122 WP_003411119.1.72143 WP_003411119.1.72168 WP_003411119.1.72179 WP_003411119.1.72209 WP_003411119.1.72218 WP_003411119.1.72219 WP_003411119.1.72227 WP_003411119.1.7224 WP_003411119.1.72268 WP_003411119.1.72332 WP_003411119.1.72380 WP_003411119.1.72401 WP_003411119.1.72405 WP_003411119.1.72420 WP_003411119.1.72441 WP_003411119.1.72451 WP_003411119.1.72452 WP_003411119.1.72457 WP_003411119.1.72459 WP_003411119.1.72460 WP_003411119.1.72466 WP_003411119.1.72487 WP_003411119.1.72488 WP_003411119.1.72492 WP_003411119.1.72506 WP_003411119.1.72543 WP_003411119.1.7256 WP_003411119.1.72576 WP_003411119.1.72578 WP_003411119.1.72585 WP_003411119.1.72591 WP_003411119.1.72592 WP_003411119.1.72640 WP_003411119.1.7266 WP_003411119.1.72661 WP_003411119.1.72684 WP_003411119.1.72739 WP_003411119.1.72744 WP_003411119.1.72755 WP_003411119.1.72759 WP_003411119.1.72784 WP_003411119.1.72792 WP_003411119.1.72826 WP_003411119.1.72831 WP_003411119.1.72852 WP_003411119.1.72853 WP_003411119.1.72879 WP_003411119.1.72880 WP_003411119.1.72938 WP_003411119.1.72954 WP_003411119.1.72957 WP_003411119.1.72959 WP_003411119.1.72982 WP_003411119.1.72988 WP_003411119.1.72993 WP_003411119.1.73006 WP_003411119.1.73013 WP_003411119.1.73025 WP_003411119.1.73028 WP_003411119.1.73042 WP_003411119.1.73045 WP_003411119.1.73092 WP_003411119.1.73118 WP_003411119.1.7312 WP_003411119.1.73127 WP_003411119.1.73134 WP_003411119.1.73154 WP_003411119.1.73163 WP_003411119.1.73182 WP_003411119.1.73205 WP_003411119.1.7321 WP_003411119.1.73310 WP_003411119.1.73315 WP_003411119.1.73365 WP_003411119.1.73391 WP_003411119.1.73404 WP_003411119.1.73424 WP_003411119.1.73436 WP_003411119.1.73445 WP_003411119.1.73453 WP_003411119.1.73465 WP_003411119.1.73466 WP_003411119.1.73470 WP_003411119.1.73471 WP_003411119.1.73478 WP_003411119.1.73482 WP_003411119.1.73507 WP_003411119.1.73532 WP_003411119.1.73550 WP_003411119.1.73564 WP_003411119.1.73623 WP_003411119.1.73629 WP_003411119.1.73644 WP_003411119.1.7366 WP_003411119.1.73661 WP_003411119.1.7368 WP_003411119.1.73688 WP_003411119.1.73723 WP_003411119.1.73744 WP_003411119.1.73750 WP_003411119.1.73774 WP_003411119.1.7379 WP_003411119.1.73813 WP_003411119.1.73840 WP_003411119.1.73876 WP_003411119.1.7389 WP_003411119.1.74016 WP_003411119.1.74039 WP_003411119.1.74083 WP_003411119.1.74101 WP_003411119.1.74107 WP_003411119.1.74129 WP_003411119.1.74144 WP_003411119.1.7417 WP_003411119.1.74190 WP_003411119.1.74210 WP_003411119.1.7423 WP_003411119.1.74259 WP_003411119.1.74262 WP_003411119.1.74269 WP_003411119.1.74282 WP_003411119.1.74291 WP_003411119.1.74296 WP_003411119.1.74304 WP_003411119.1.7432 WP_003411119.1.74347 WP_003411119.1.7436 WP_003411119.1.74378 WP_003411119.1.74382 WP_003411119.1.74395 WP_003411119.1.74400 WP_003411119.1.74432 WP_003411119.1.74442 WP_003411119.1.74477 WP_003411119.1.74487 WP_003411119.1.74499 WP_003411119.1.74504 WP_003411119.1.74511 WP_003411119.1.74523 WP_003411119.1.74525 WP_003411119.1.74551 WP_003411119.1.74555 WP_003411119.1.74628 WP_003411119.1.74641 WP_003411119.1.74653 WP_003411119.1.74660 WP_003411119.1.74683 WP_003411119.1.7469 WP_003411119.1.74725 WP_003411119.1.74760 WP_003411119.1.74786 WP_003411119.1.74809 WP_003411119.1.74820 WP_003411119.1.74870 WP_003411119.1.74881 WP_003411119.1.74888 WP_003411119.1.74952 WP_003411119.1.7496 WP_003411119.1.74988 WP_003411119.1.75043 WP_003411119.1.75045 WP_003411119.1.75055 WP_003411119.1.75078 WP_003411119.1.75081 WP_003411119.1.75120 WP_003411119.1.75163 WP_003411119.1.75188 WP_003411119.1.75200 WP_003411119.1.75202 WP_003411119.1.75234 WP_003411119.1.75239 WP_003411119.1.75263 WP_003411119.1.75342 WP_003411119.1.7535 WP_003411119.1.75376 WP_003411119.1.75391 WP_003411119.1.75395 WP_003411119.1.75441 WP_003411119.1.75510 WP_003411119.1.75581 WP_003411119.1.75598 WP_003411119.1.75635 WP_003411119.1.75665 WP_003411119.1.75671 WP_003411119.1.75741 WP_003411119.1.75749 WP_003411119.1.75772 WP_003411119.1.75774 WP_003411119.1.75833 WP_003411119.1.7585 WP_003411119.1.75868 WP_003411119.1.75878 WP_003411119.1.75927 WP_003411119.1.75946 WP_003411119.1.75968 WP_003411119.1.75974 WP_003411119.1.76016 WP_003411119.1.76032 WP_003411119.1.76037 WP_003411119.1.7604 WP_003411119.1.76045 WP_003411119.1.76052 WP_003411119.1.76058 WP_003411119.1.76064 WP_003411119.1.76110 WP_003411119.1.76126 WP_003411119.1.76133 WP_003411119.1.76138 WP_003411119.1.76157 WP_003411119.1.76172 WP_003411119.1.76177 WP_003411119.1.76183 WP_003411119.1.76209 WP_003411119.1.76239 WP_003411119.1.76272 WP_003411119.1.76277 WP_003411119.1.76281 WP_003411119.1.76291 WP_003411119.1.76297 WP_003411119.1.76360 WP_003411119.1.76379 WP_003411119.1.76403 WP_003411119.1.76413 WP_003411119.1.76414 WP_003411119.1.76427 WP_003411119.1.76436 WP_003411119.1.76442 WP_003411119.1.76443 WP_003411119.1.76456 WP_003411119.1.76533 WP_003411119.1.76616 WP_003411119.1.76625 WP_003411119.1.76629 WP_003411119.1.76635 WP_003411119.1.76638 WP_003411119.1.76640 WP_003411119.1.76644 WP_003411119.1.76677 WP_003411119.1.76678 WP_003411119.1.76679 WP_003411119.1.76734 WP_003411119.1.76744 WP_003411119.1.76750 WP_003411119.1.76754 WP_003411119.1.76757 WP_003411119.1.76781 WP_003411119.1.76818 WP_003411119.1.76824 WP_003411119.1.76835 WP_003411119.1.76873 WP_003411119.1.76888 WP_003411119.1.76900 WP_003411119.1.7691 WP_003411119.1.76947 WP_003411119.1.76954 WP_003411119.1.76955 WP_003411119.1.76963 WP_003411119.1.76976 WP_003411119.1.770 WP_003411119.1.77000 WP_003411119.1.77008 WP_003411119.1.77021 WP_003411119.1.77056 WP_003411119.1.77065 WP_003411119.1.77075 WP_003411119.1.77093 WP_003411119.1.77107 WP_003411119.1.77115 WP_003411119.1.77118 WP_003411119.1.77125 WP_003411119.1.77141 WP_003411119.1.77142 WP_003411119.1.77166 WP_003411119.1.77250 WP_003411119.1.77260 WP_003411119.1.77266 WP_003411119.1.77285 WP_003411119.1.77312 WP_003411119.1.77348 WP_003411119.1.77351 WP_003411119.1.77352 WP_003411119.1.77361 WP_003411119.1.774 WP_003411119.1.77404 WP_003411119.1.77425 WP_003411119.1.77463 WP_003411119.1.77474 WP_003411119.1.7748 WP_003411119.1.77484 WP_003411119.1.77491 WP_003411119.1.77499 WP_003411119.1.77510 WP_003411119.1.77530 WP_003411119.1.77554 WP_003411119.1.77559 WP_003411119.1.77599 WP_003411119.1.7762 WP_003411119.1.77627 WP_003411119.1.77649 WP_003411119.1.77654 WP_003411119.1.7766 WP_003411119.1.77667 WP_003411119.1.77704 WP_003411119.1.77706 WP_003411119.1.77774 WP_003411119.1.7778 WP_003411119.1.77790 WP_003411119.1.77809 WP_003411119.1.77820 WP_003411119.1.77843 WP_003411119.1.77855 WP_003411119.1.77865 WP_003411119.1.77868 WP_003411119.1.77879 WP_003411119.1.77890 WP_003411119.1.77909 WP_003411119.1.77911 WP_003411119.1.77931 WP_003411119.1.77984 WP_003411119.1.78020 WP_003411119.1.78024 WP_003411119.1.78075 WP_003411119.1.78086 WP_003411119.1.7809 WP_003411119.1.78098 WP_003411119.1.78105 WP_003411119.1.78113 WP_003411119.1.78136 WP_003411119.1.78162 WP_003411119.1.78200 WP_003411119.1.78216 WP_003411119.1.78236 WP_003411119.1.78238 WP_003411119.1.78322 WP_003411119.1.78338 WP_003411119.1.7836 WP_003411119.1.78360 WP_003411119.1.78386 WP_003411119.1.78429 WP_003411119.1.78435 WP_003411119.1.7844 WP_003411119.1.78459 WP_003411119.1.78488 WP_003411119.1.7849 WP_003411119.1.78499 WP_003411119.1.785 WP_003411119.1.78516 WP_003411119.1.78524 WP_003411119.1.78526 WP_003411119.1.78538 WP_003411119.1.78544 WP_003411119.1.78545 WP_003411119.1.78547 WP_003411119.1.78574 WP_003411119.1.78580 WP_003411119.1.7860 WP_003411119.1.78620 WP_003411119.1.78646 WP_003411119.1.78648 WP_003411119.1.78649 WP_003411119.1.78655 WP_003411119.1.78657 WP_003411119.1.78659 WP_003411119.1.7869 WP_003411119.1.78692 WP_003411119.1.78760 WP_003411119.1.78766 WP_003411119.1.78776 WP_003411119.1.78778 WP_003411119.1.78784 WP_003411119.1.78788 WP_003411119.1.78790 WP_003411119.1.78848 WP_003411119.1.78860 WP_003411119.1.7887 WP_003411119.1.78884 WP_003411119.1.78932 WP_003411119.1.78969 WP_003411119.1.78977 WP_003411119.1.78980 WP_003411119.1.79005 WP_003411119.1.79016 WP_003411119.1.79033 WP_003411119.1.79064 WP_003411119.1.79066 WP_003411119.1.79068 WP_003411119.1.79095 WP_003411119.1.79112 WP_003411119.1.79122 WP_003411119.1.79145 WP_003411119.1.79152 WP_003411119.1.79163 WP_003411119.1.79182 WP_003411119.1.79213 WP_003411119.1.79218 WP_003411119.1.79268 WP_003411119.1.79278 WP_003411119.1.79290 WP_003411119.1.79319 WP_003411119.1.79325 WP_003411119.1.7933 WP_003411119.1.79330 WP_003411119.1.79339 WP_003411119.1.79394 WP_003411119.1.79399 WP_003411119.1.79413 WP_003411119.1.79422 WP_003411119.1.79445 WP_003411119.1.79447 WP_003411119.1.79455 WP_003411119.1.79471 WP_003411119.1.79480 WP_003411119.1.79482 WP_003411119.1.79488 WP_003411119.1.79500 WP_003411119.1.79502 WP_003411119.1.79508 WP_003411119.1.79514 WP_003411119.1.79561 WP_003411119.1.79565 WP_003411119.1.79578 WP_003411119.1.79588 WP_003411119.1.79598 WP_003411119.1.79615 WP_003411119.1.79684 WP_003411119.1.79698 WP_003411119.1.797 WP_003411119.1.79744 WP_003411119.1.79784 WP_003411119.1.79806 WP_003411119.1.79819 WP_003411119.1.79826 WP_003411119.1.79828 WP_003411119.1.79851 WP_003411119.1.79853 WP_003411119.1.79863 WP_003411119.1.79881 WP_003411119.1.79885 WP_003411119.1.79898 WP_003411119.1.7990 WP_003411119.1.79900 WP_003411119.1.79913 WP_003411119.1.79918 WP_003411119.1.79947 WP_003411119.1.79948 WP_003411119.1.7995 WP_003411119.1.7997 WP_003411119.1.80004 WP_003411119.1.80022 WP_003411119.1.80030 WP_003411119.1.80054 WP_003411119.1.80084 WP_003411119.1.80099 WP_003411119.1.80129 WP_003411119.1.80177 WP_003411119.1.80234 WP_003411119.1.8026 WP_003411119.1.80275 WP_003411119.1.8029 WP_003411119.1.80299 WP_003411119.1.80304 WP_003411119.1.80326 WP_003411119.1.8037 WP_003411119.1.80370 WP_003411119.1.80387 WP_003411119.1.8044 WP_003411119.1.80451 WP_003411119.1.80458 WP_003411119.1.80461 WP_003411119.1.80490 WP_003411119.1.80503 WP_003411119.1.80507 WP_003411119.1.80552 WP_003411119.1.80576 WP_003411119.1.80588 WP_003411119.1.80599 WP_003411119.1.8060 WP_003411119.1.80624 WP_003411119.1.80636 WP_003411119.1.80669 WP_003411119.1.80673 WP_003411119.1.80711 WP_003411119.1.80714 WP_003411119.1.80743 WP_003411119.1.80784 WP_003411119.1.80815 WP_003411119.1.80853 WP_003411119.1.80918 WP_003411119.1.8093 WP_003411119.1.80967 WP_003411119.1.8097 WP_003411119.1.80988 WP_003411119.1.81007 WP_003411119.1.81013 WP_003411119.1.8105 WP_003411119.1.81059 WP_003411119.1.81063 WP_003411119.1.81066 WP_003411119.1.81075 WP_003411119.1.81091 WP_003411119.1.81119 WP_003411119.1.81125 WP_003411119.1.81136 WP_003411119.1.8114 WP_003411119.1.81189 WP_003411119.1.81192 WP_003411119.1.812 WP_003411119.1.81230 WP_003411119.1.81249 WP_003411119.1.81250 WP_003411119.1.81264 WP_003411119.1.8128 WP_003411119.1.81287 WP_003411119.1.81297 WP_003411119.1.8138 WP_003411119.1.81407 WP_003411119.1.8143 WP_003411119.1.81439 WP_003411119.1.81465 WP_003411119.1.81529 WP_003411119.1.81538 WP_003411119.1.81541 WP_003411119.1.81560 WP_003411119.1.81561 WP_003411119.1.81567 WP_003411119.1.81583 WP_003411119.1.81686 WP_003411119.1.81712 WP_003411119.1.81720 WP_003411119.1.81731 WP_003411119.1.81774 WP_003411119.1.81788 WP_003411119.1.81820 WP_003411119.1.81850 WP_003411119.1.81883 WP_003411119.1.81891 WP_003411119.1.81911 WP_003411119.1.81918 WP_003411119.1.82011 WP_003411119.1.82048 WP_003411119.1.82069 WP_003411119.1.82071 WP_003411119.1.82108 WP_003411119.1.82136 WP_003411119.1.82142 WP_003411119.1.8215 WP_003411119.1.82158 WP_003411119.1.82209 WP_003411119.1.82210 WP_003411119.1.82228 WP_003411119.1.82236 WP_003411119.1.82251 WP_003411119.1.82271 WP_003411119.1.82305 WP_003411119.1.82307 WP_003411119.1.82309 WP_003411119.1.82317 WP_003411119.1.8232 WP_003411119.1.82346 WP_003411119.1.82374 WP_003411119.1.82385 WP_003411119.1.82429 WP_003411119.1.82460 WP_003411119.1.82483 WP_003411119.1.82494 WP_003411119.1.82531 WP_003411119.1.82546 WP_003411119.1.82547 WP_003411119.1.82549 WP_003411119.1.82577 WP_003411119.1.82592 WP_003411119.1.82597 WP_003411119.1.82598 WP_003411119.1.82625 WP_003411119.1.82642 WP_003411119.1.82651 WP_003411119.1.82653 WP_003411119.1.82681 WP_003411119.1.82685 WP_003411119.1.8271 WP_003411119.1.82712 WP_003411119.1.8273 WP_003411119.1.82743 WP_003411119.1.82757 WP_003411119.1.82774 WP_003411119.1.82803 WP_003411119.1.82836 WP_003411119.1.82860 WP_003411119.1.82871 WP_003411119.1.82892 WP_003411119.1.82935 WP_003411119.1.82957 WP_003411119.1.82983 WP_003411119.1.83004 WP_003411119.1.83009 WP_003411119.1.83044 WP_003411119.1.83074 WP_003411119.1.83146 WP_003411119.1.83149 WP_003411119.1.83159 WP_003411119.1.8317 WP_003411119.1.83173 WP_003411119.1.83181 WP_003411119.1.83182 WP_003411119.1.83191 WP_003411119.1.83197 WP_003411119.1.83212 WP_003411119.1.8326 WP_003411119.1.83262 WP_003411119.1.83268 WP_003411119.1.83273 WP_003411119.1.83309 WP_003411119.1.83332 WP_003411119.1.83334 WP_003411119.1.83341 WP_003411119.1.83349 WP_003411119.1.8335 WP_003411119.1.83353 WP_003411119.1.83367 WP_003411119.1.83380 WP_003411119.1.83381 WP_003411119.1.83389 WP_003411119.1.83408 WP_003411119.1.83409 WP_003411119.1.83435 WP_003411119.1.83470 WP_003411119.1.83524 WP_003411119.1.83526 WP_003411119.1.8358 WP_003411119.1.83589 WP_003411119.1.83601 WP_003411119.1.83611 WP_003411119.1.83638 WP_003411119.1.83656 WP_003411119.1.83667 WP_003411119.1.83689 WP_003411119.1.83692 WP_003411119.1.83704 WP_003411119.1.83705 WP_003411119.1.83766 WP_003411119.1.83793 WP_003411119.1.83794 WP_003411119.1.83802 WP_003411119.1.83805 WP_003411119.1.83839 WP_003411119.1.83842 WP_003411119.1.83850 WP_003411119.1.83861 WP_003411119.1.83884 WP_003411119.1.83920 WP_003411119.1.83929 WP_003411119.1.83930 WP_003411119.1.83975 WP_003411119.1.83991 WP_003411119.1.8400 WP_003411119.1.84027 WP_003411119.1.8404 WP_003411119.1.84057 WP_003411119.1.84070 WP_003411119.1.8409 WP_003411119.1.84112 WP_003411119.1.84146 WP_003411119.1.8415 WP_003411119.1.84176 WP_003411119.1.84192 WP_003411119.1.84228 WP_003411119.1.8424 WP_003411119.1.84244 WP_003411119.1.84259 WP_003411119.1.8426 WP_003411119.1.84277 WP_003411119.1.84287 WP_003411119.1.8434 WP_003411119.1.84388 WP_003411119.1.84409 WP_003411119.1.84438 WP_003411119.1.84460 WP_003411119.1.84488 WP_003411119.1.84504 WP_003411119.1.84525 WP_003411119.1.84620 WP_003411119.1.84623 WP_003411119.1.84641 WP_003411119.1.84655 WP_003411119.1.84666 WP_003411119.1.84670 WP_003411119.1.84739 WP_003411119.1.84748 WP_003411119.1.84766 WP_003411119.1.84772 WP_003411119.1.84774 WP_003411119.1.848 WP_003411119.1.84812 WP_003411119.1.84836 WP_003411119.1.84839 WP_003411119.1.84846 WP_003411119.1.84873 WP_003411119.1.84911 WP_003411119.1.84938 WP_003411119.1.84968 WP_003411119.1.84973 WP_003411119.1.84981 WP_003411119.1.84985 WP_003411119.1.8503 WP_003411119.1.85038 WP_003411119.1.85043 WP_003411119.1.8505 WP_003411119.1.85074 WP_003411119.1.8509 WP_003411119.1.8512 WP_003411119.1.85148 WP_003411119.1.8518 WP_003411119.1.8522 WP_003411119.1.85242 WP_003411119.1.85276 WP_003411119.1.85281 WP_003411119.1.85284 WP_003411119.1.85314 WP_003411119.1.85319 WP_003411119.1.85330 WP_003411119.1.85341 WP_003411119.1.8535 WP_003411119.1.85363 WP_003411119.1.85371 WP_003411119.1.85377 WP_003411119.1.85387 WP_003411119.1.85399 WP_003411119.1.85458 WP_003411119.1.8546 WP_003411119.1.85478 WP_003411119.1.85480 WP_003411119.1.85488 WP_003411119.1.85495 WP_003411119.1.85551 WP_003411119.1.85557 WP_003411119.1.85577 WP_003411119.1.85599 WP_003411119.1.85610 WP_003411119.1.8563 WP_003411119.1.85648 WP_003411119.1.85679 WP_003411119.1.85704 WP_003411119.1.85717 WP_003411119.1.85727 WP_003411119.1.85737 WP_003411119.1.85763 WP_003411119.1.85808 WP_003411119.1.85819 WP_003411119.1.85820 WP_003411119.1.85823 WP_003411119.1.85832 WP_003411119.1.8586 WP_003411119.1.85872 WP_003411119.1.85894 WP_003411119.1.85909 WP_003411119.1.85913 WP_003411119.1.85953 WP_003411119.1.85986 WP_003411119.1.86000 WP_003411119.1.86025 WP_003411119.1.86032 WP_003411119.1.86048 WP_003411119.1.86052 WP_003411119.1.86067 WP_003411119.1.86103 WP_003411119.1.86122 WP_003411119.1.86124 WP_003411119.1.86160 WP_003411119.1.86164 WP_003411119.1.86168 WP_003411119.1.86190 WP_003411119.1.86204 WP_003411119.1.86208 WP_003411119.1.86235 WP_003411119.1.86249 WP_003411119.1.86260 WP_003411119.1.86290 WP_003411119.1.863 WP_003411119.1.86327 WP_003411119.1.86334 WP_003411119.1.86337 WP_003411119.1.86368 WP_003411119.1.86377 WP_003411119.1.86425 WP_003411119.1.86459 WP_003411119.1.8649 WP_003411119.1.86499 WP_003411119.1.86520 WP_003411119.1.86561 WP_003411119.1.86568 WP_003411119.1.86575 WP_003411119.1.86584 WP_003411119.1.86605 WP_003411119.1.86626 WP_003411119.1.86648 WP_003411119.1.86684 WP_003411119.1.86696 WP_003411119.1.86705 WP_003411119.1.86718 WP_003411119.1.86725 WP_003411119.1.86757 WP_003411119.1.86801 WP_003411119.1.86814 WP_003411119.1.86820 WP_003411119.1.86825 WP_003411119.1.86834 WP_003411119.1.8685 WP_003411119.1.86851 WP_003411119.1.86855 WP_003411119.1.86867 WP_003411119.1.86877 WP_003411119.1.86883 WP_003411119.1.8689 WP_003411119.1.86892 WP_003411119.1.86933 WP_003411119.1.86941 WP_003411119.1.86950 WP_003411119.1.86962 WP_003411119.1.86963 WP_003411119.1.86979 WP_003411119.1.8700 WP_003411119.1.87002 WP_003411119.1.87031 WP_003411119.1.87116 WP_003411119.1.87117 WP_003411119.1.87162 WP_003411119.1.87178 WP_003411119.1.87191 WP_003411119.1.87201 WP_003411119.1.87209 WP_003411119.1.87240 WP_003411119.1.87273 WP_003411119.1.87275 WP_003411119.1.8733 WP_003411119.1.87345 WP_003411119.1.8737 WP_003411119.1.87401 WP_003411119.1.87409 WP_003411119.1.87444 WP_003411119.1.87446 WP_003411119.1.87459 WP_003411119.1.87472 WP_003411119.1.87489 WP_003411119.1.87494 WP_003411119.1.87496 WP_003411119.1.87582 WP_003411119.1.87588 WP_003411119.1.87617 WP_003411119.1.87619 WP_003411119.1.87620 WP_003411119.1.87634 WP_003411119.1.87643 WP_003411119.1.8765 WP_003411119.1.87650 WP_003411119.1.87654 WP_003411119.1.87658 WP_003411119.1.87665 WP_003411119.1.87676 WP_003411119.1.87677 WP_003411119.1.87684 WP_003411119.1.87692 WP_003411119.1.87707 WP_003411119.1.87732 WP_003411119.1.87784 WP_003411119.1.87809 WP_003411119.1.87817 WP_003411119.1.87827 WP_003411119.1.87831 WP_003411119.1.87835 WP_003411119.1.87837 WP_003411119.1.87866 WP_003411119.1.8789 WP_003411119.1.87911 WP_003411119.1.87924 WP_003411119.1.87951 WP_003411119.1.87956 WP_003411119.1.87991 WP_003411119.1.88 WP_003411119.1.88002 WP_003411119.1.88037 WP_003411119.1.88039 WP_003411119.1.88072 WP_003411119.1.88077 WP_003411119.1.88121 WP_003411119.1.88191 WP_003411119.1.88205 WP_003411119.1.88217 WP_003411119.1.88219 WP_003411119.1.88245 WP_003411119.1.88253 WP_003411119.1.88294 WP_003411119.1.88315 WP_003411119.1.88316 WP_003411119.1.88320 WP_003411119.1.88338 WP_003411119.1.8840 WP_003411119.1.88437 WP_003411119.1.88453 WP_003411119.1.88469 WP_003411119.1.88489 WP_003411119.1.88507 WP_003411119.1.88530 WP_003411119.1.88537 WP_003411119.1.88541 WP_003411119.1.88592 WP_003411119.1.88616 WP_003411119.1.88618 WP_003411119.1.8862 WP_003411119.1.88625 WP_003411119.1.88632 WP_003411119.1.88634 WP_003411119.1.88649 WP_003411119.1.8870 WP_003411119.1.88737 WP_003411119.1.88756 WP_003411119.1.888 WP_003411119.1.88824 WP_003411119.1.88886 WP_003411119.1.88965 WP_003411119.1.88985 WP_003411119.1.8902 WP_003411119.1.89025 WP_003411119.1.89041 WP_003411119.1.89046 WP_003411119.1.89082 WP_003411119.1.89162 WP_003411119.1.89168 WP_003411119.1.8917 WP_003411119.1.89205 WP_003411119.1.89207 WP_003411119.1.89225 WP_003411119.1.8925 WP_003411119.1.89277 WP_003411119.1.89286 WP_003411119.1.89293 WP_003411119.1.89320 WP_003411119.1.8935 WP_003411119.1.89371 WP_003411119.1.89378 WP_003411119.1.89392 WP_003411119.1.89406 WP_003411119.1.89451 WP_003411119.1.89453 WP_003411119.1.89473 WP_003411119.1.89475 WP_003411119.1.89483 WP_003411119.1.895 WP_003411119.1.89513 WP_003411119.1.89517 WP_003411119.1.89522 WP_003411119.1.8954 WP_003411119.1.89543 WP_003411119.1.8957 WP_003411119.1.89572 WP_003411119.1.89589 WP_003411119.1.89607 WP_003411119.1.89613 WP_003411119.1.89625 WP_003411119.1.89648 WP_003411119.1.8967 WP_003411119.1.89670 WP_003411119.1.89676 WP_003411119.1.89729 WP_003411119.1.89739 WP_003411119.1.89762 WP_003411119.1.8977 WP_003411119.1.89802 WP_003411119.1.89808 WP_003411119.1.8982 WP_003411119.1.89829 WP_003411119.1.89831 WP_003411119.1.89844 WP_003411119.1.89849 WP_003411119.1.8989 WP_003411119.1.89901 WP_003411119.1.89903 WP_003411119.1.89909 WP_003411119.1.8992 WP_003411119.1.89922 WP_003411119.1.89926 WP_003411119.1.89963 WP_003411119.1.89971 WP_003411119.1.8998 WP_003411119.1.89987 WP_003411119.1.900 WP_003411119.1.90048 WP_003411119.1.9007 WP_003411119.1.90080 WP_003411119.1.90130 WP_003411119.1.90134 WP_003411119.1.90137 WP_003411119.1.90157 WP_003411119.1.90184 WP_003411119.1.90199 WP_003411119.1.90231 WP_003411119.1.90245 WP_003411119.1.90308 WP_003411119.1.90322 WP_003411119.1.90328 WP_003411119.1.90372 WP_003411119.1.90481 WP_003411119.1.90499 WP_003411119.1.9050 WP_003411119.1.90527 WP_003411119.1.90550 WP_003411119.1.90560 WP_003411119.1.90612 WP_003411119.1.90640 WP_003411119.1.90672 WP_003411119.1.90687 WP_003411119.1.90691 WP_003411119.1.90711 WP_003411119.1.90722 WP_003411119.1.90744 WP_003411119.1.9075 WP_003411119.1.90756 WP_003411119.1.90767 WP_003411119.1.90771 WP_003411119.1.90785 WP_003411119.1.90788 WP_003411119.1.90800 WP_003411119.1.90810 WP_003411119.1.90816 WP_003411119.1.90819 WP_003411119.1.9082 WP_003411119.1.90831 WP_003411119.1.90884 WP_003411119.1.90899 WP_003411119.1.90906 WP_003411119.1.90958 WP_003411119.1.90976 WP_003411119.1.90977 WP_003411119.1.90987 WP_003411119.1.9102 WP_003411119.1.91026 WP_003411119.1.91032 WP_003411119.1.91053 WP_003411119.1.91082 WP_003411119.1.91106 WP_003411119.1.91112 WP_003411119.1.91144 WP_003411119.1.91151 WP_003411119.1.91157 WP_003411119.1.91167 WP_003411119.1.91169 WP_003411119.1.91192 WP_003411119.1.91201 WP_003411119.1.91207 WP_003411119.1.91208 WP_003411119.1.91211 WP_003411119.1.91214 WP_003411119.1.91230 WP_003411119.1.91244 WP_003411119.1.91251 WP_003411119.1.91260 WP_003411119.1.9128 WP_003411119.1.91284 WP_003411119.1.91294 WP_003411119.1.91303 WP_003411119.1.91322 WP_003411119.1.91386 WP_003411119.1.9139 WP_003411119.1.91398 WP_003411119.1.91411 WP_003411119.1.91430 WP_003411119.1.91436 WP_003411119.1.91483 WP_003411119.1.91496 WP_003411119.1.91507 WP_003411119.1.91508 WP_003411119.1.91576 WP_003411119.1.91589 WP_003411119.1.91694 WP_003411119.1.91695 WP_003411119.1.91716 WP_003411119.1.91717 WP_003411119.1.91728 WP_003411119.1.91743 WP_003411119.1.91759 WP_003411119.1.91784 WP_003411119.1.91785 WP_003411119.1.91786 WP_003411119.1.91802 WP_003411119.1.91822 WP_003411119.1.91828 WP_003411119.1.9189 WP_003411119.1.91896 WP_003411119.1.9190 WP_003411119.1.91915 WP_003411119.1.91931 WP_003411119.1.91937 WP_003411119.1.91944 WP_003411119.1.91953 WP_003411119.1.91957 WP_003411119.1.91976 WP_003411119.1.92083 WP_003411119.1.92127 WP_003411119.1.92144 WP_003411119.1.92150 WP_003411119.1.92153 WP_003411119.1.92190 WP_003411119.1.92192 WP_003411119.1.92200 WP_003411119.1.92220 WP_003411119.1.92221 WP_003411119.1.92222 WP_003411119.1.92273 WP_003411119.1.92289 WP_003411119.1.9229 WP_003411119.1.92294 WP_003411119.1.92300 WP_003411119.1.92317 WP_003411119.1.92334 WP_003411119.1.92338 WP_003411119.1.92345 WP_003411119.1.92356 WP_003411119.1.92364 WP_003411119.1.92380 WP_003411119.1.92416 WP_003411119.1.92428 WP_003411119.1.92447 WP_003411119.1.92456 WP_003411119.1.92467 WP_003411119.1.92471 WP_003411119.1.92490 WP_003411119.1.92508 WP_003411119.1.9251 WP_003411119.1.92511 WP_003411119.1.92523 WP_003411119.1.92527 WP_003411119.1.92536 WP_003411119.1.92592 WP_003411119.1.92603 WP_003411119.1.92606 WP_003411119.1.92610 WP_003411119.1.92613 WP_003411119.1.9263 WP_003411119.1.9265 WP_003411119.1.92650 WP_003411119.1.92660 WP_003411119.1.92677 WP_003411119.1.92685 WP_003411119.1.92689 WP_003411119.1.92690 WP_003411119.1.92706 WP_003411119.1.92714 WP_003411119.1.92736 WP_003411119.1.9274 WP_003411119.1.92752 WP_003411119.1.92760 WP_003411119.1.92777 WP_003411119.1.92803 WP_003411119.1.92833 WP_003411119.1.92856 WP_003411119.1.92881 WP_003411119.1.92892 WP_003411119.1.92907 WP_003411119.1.92908 WP_003411119.1.9291 WP_003411119.1.92917 WP_003411119.1.92996 WP_003411119.1.93006 WP_003411119.1.93008 WP_003411119.1.93009 WP_003411119.1.93015 WP_003411119.1.93043 WP_003411119.1.9307 WP_003411119.1.93083 WP_003411119.1.93097 WP_003411119.1.93137 WP_003411119.1.93192 WP_003411119.1.93199 WP_003411119.1.93203 WP_003411119.1.93212 WP_003411119.1.93234 WP_003411119.1.93245 WP_003411119.1.93257 WP_003411119.1.93265 WP_003411119.1.93297 WP_003411119.1.93320 WP_003411119.1.93328 WP_003411119.1.93337 WP_003411119.1.93343 WP_003411119.1.93349 WP_003411119.1.93363 WP_003411119.1.93377 WP_003411119.1.9338 WP_003411119.1.93407 WP_003411119.1.93417 WP_003411119.1.93419 WP_003411119.1.93426 WP_003411119.1.9344 WP_003411119.1.93443 WP_003411119.1.93447 WP_003411119.1.93470 WP_003411119.1.93483 WP_003411119.1.93487 WP_003411119.1.93495 WP_003411119.1.93499 WP_003411119.1.93516 WP_003411119.1.93536 WP_003411119.1.93544 WP_003411119.1.93555 WP_003411119.1.93560 WP_003411119.1.93564 WP_003411119.1.9357 WP_003411119.1.93573 WP_003411119.1.93576 WP_003411119.1.93588 WP_003411119.1.9363 WP_003411119.1.93645 WP_003411119.1.93649 WP_003411119.1.93659 WP_003411119.1.93677 WP_003411119.1.9368 WP_003411119.1.93689 WP_003411119.1.93693 WP_003411119.1.93698 WP_003411119.1.93706 WP_003411119.1.9371 WP_003411119.1.93792 WP_003411119.1.93823 WP_003411119.1.93871 WP_003411119.1.9388 WP_003411119.1.93894 WP_003411119.1.93903 WP_003411119.1.93907 WP_003411119.1.93913 WP_003411119.1.93946 WP_003411119.1.93950 WP_003411119.1.93953 WP_003411119.1.93954 WP_003411119.1.93988 WP_003411119.1.9407 WP_003411119.1.94143 WP_003411119.1.94154 WP_003411119.1.94184 WP_003411119.1.94204 WP_003411119.1.94205 WP_003411119.1.94226 WP_003411119.1.94231 WP_003411119.1.94256 WP_003411119.1.94261 WP_003411119.1.94281 WP_003411119.1.94292 WP_003411119.1.94297 WP_003411119.1.9431 WP_003411119.1.94326 WP_003411119.1.94339 WP_003411119.1.94392 WP_003411119.1.94416 WP_003411119.1.94421 WP_003411119.1.94456 WP_003411119.1.94470 WP_003411119.1.94480 WP_003411119.1.94495 WP_003411119.1.94511 WP_003411119.1.94512 WP_003411119.1.94528 WP_003411119.1.94564 WP_003411119.1.946 WP_003411119.1.94623 WP_003411119.1.94629 WP_003411119.1.9465 WP_003411119.1.94673 WP_003411119.1.94714 WP_003411119.1.94730 WP_003411119.1.94736 WP_003411119.1.94776 WP_003411119.1.9478 WP_003411119.1.94834 WP_003411119.1.94852 WP_003411119.1.94872 WP_003411119.1.9488 WP_003411119.1.94902 WP_003411119.1.94916 WP_003411119.1.94979 WP_003411119.1.94994 WP_003411119.1.94996 WP_003411119.1.94998 WP_003411119.1.95007 WP_003411119.1.95010 WP_003411119.1.95015 WP_003411119.1.95034 WP_003411119.1.95068 WP_003411119.1.95081 WP_003411119.1.95082 WP_003411119.1.9509 WP_003411119.1.95096 WP_003411119.1.95112 WP_003411119.1.95138 WP_003411119.1.9514 WP_003411119.1.95179 WP_003411119.1.95188 WP_003411119.1.95190 WP_003411119.1.95234 WP_003411119.1.95245 WP_003411119.1.95257 WP_003411119.1.95279 WP_003411119.1.9531 WP_003411119.1.95335 WP_003411119.1.95344 WP_003411119.1.9535 WP_003411119.1.95370 WP_003411119.1.95392 WP_003411119.1.95416 WP_003411119.1.95417 WP_003411119.1.95454 WP_003411119.1.95455 WP_003411119.1.95491 WP_003411119.1.95497 WP_003411119.1.95508 WP_003411119.1.95509 WP_003411119.1.95529 WP_003411119.1.95556 WP_003411119.1.95557 WP_003411119.1.95565 WP_003411119.1.95578 WP_003411119.1.95580 WP_003411119.1.95585 WP_003411119.1.95643 WP_003411119.1.95679 WP_003411119.1.95685 WP_003411119.1.957 WP_003411119.1.95724 WP_003411119.1.95727 WP_003411119.1.95730 WP_003411119.1.95735 WP_003411119.1.95758 WP_003411119.1.95772 WP_003411119.1.95797 WP_003411119.1.95839 WP_003411119.1.9585 WP_003411119.1.9590 WP_003411119.1.95902 WP_003411119.1.95908 WP_003411119.1.95924 WP_003411119.1.95926 WP_003411119.1.95953 WP_003411119.1.95958 WP_003411119.1.95964 WP_003411119.1.95973 WP_003411119.1.96006 WP_003411119.1.9602 WP_003411119.1.96036 WP_003411119.1.96062 WP_003411119.1.96065 WP_003411119.1.96098 WP_003411119.1.96146 WP_003411119.1.96171 WP_003411119.1.96182 WP_003411119.1.96204 WP_003411119.1.96230 WP_003411119.1.96242 WP_003411119.1.96245 WP_003411119.1.96254 WP_003411119.1.96259 WP_003411119.1.96286 WP_003411119.1.96313 WP_003411119.1.96318 WP_003411119.1.96345 WP_003411119.1.96360 WP_003411119.1.96373 WP_003411119.1.96456 WP_003411119.1.96486 WP_003411119.1.96560 WP_003411119.1.96569 WP_003411119.1.96573 WP_003411119.1.96576 WP_003411119.1.96611 WP_003411119.1.96621 WP_003411119.1.9667 WP_003411119.1.96681 WP_003411119.1.96726 WP_003411119.1.96733 WP_003411119.1.96742 WP_003411119.1.96754 WP_003411119.1.9678 WP_003411119.1.96832 WP_003411119.1.9685 WP_003411119.1.97008 WP_003411119.1.97009 WP_003411119.1.97056 WP_003411119.1.97084 WP_003411119.1.97087 WP_003411119.1.97094 WP_003411119.1.97096 WP_003411119.1.97099 WP_003411119.1.97108 WP_003411119.1.97113 WP_003411119.1.97122 WP_003411119.1.97129 WP_003411119.1.97136 WP_003411119.1.9716 WP_003411119.1.97176 WP_003411119.1.97222 WP_003411119.1.97237 WP_003411119.1.97242 WP_003411119.1.97270 WP_003411119.1.97283 WP_003411119.1.97296 WP_003411119.1.97321 WP_003411119.1.97325 WP_003411119.1.97330 WP_003411119.1.97366 WP_003411119.1.97376 WP_003411119.1.97380 WP_003411119.1.97462 WP_003411119.1.97517 WP_003411119.1.97519 WP_003411119.1.97535 WP_003411119.1.97540 WP_003411119.1.97545 WP_003411119.1.97546 WP_003411119.1.97550 WP_003411119.1.97568 WP_003411119.1.97577 WP_003411119.1.97584 WP_003411119.1.9759 WP_003411119.1.97591 WP_003411119.1.97596 WP_003411119.1.97609 WP_003411119.1.97618 WP_003411119.1.9763 WP_003411119.1.97669 WP_003411119.1.97673 WP_003411119.1.97700 WP_003411119.1.97701 WP_003411119.1.9773 WP_003411119.1.97730 WP_003411119.1.97740 WP_003411119.1.97751 WP_003411119.1.97754 WP_003411119.1.97797 WP_003411119.1.9782 WP_003411119.1.9784 WP_003411119.1.97888 WP_003411119.1.9790 WP_003411119.1.9795 WP_003411119.1.97951 WP_003411119.1.97958 WP_003411119.1.97966 WP_003411119.1.97977 WP_003411119.1.97979 WP_003411119.1.97995 WP_003411119.1.98018 WP_003411119.1.98034 WP_003411119.1.98052 WP_003411119.1.98071 WP_003411119.1.98072 WP_003411119.1.98113 WP_003411119.1.98114 WP_003411119.1.98128 WP_003411119.1.98188 WP_003411119.1.98189 WP_003411119.1.98213 WP_003411119.1.98225 WP_003411119.1.98291 WP_003411119.1.98335 WP_003411119.1.98350 WP_003411119.1.98395 WP_003411119.1.98412 WP_003411119.1.98441 WP_003411119.1.98443 WP_003411119.1.98462 WP_003411119.1.9848 WP_003411119.1.98482 WP_003411119.1.98486 WP_003411119.1.98488 WP_003411119.1.98503 WP_003411119.1.98516 WP_003411119.1.98536 WP_003411119.1.98541 WP_003411119.1.98566 WP_003411119.1.98576 WP_003411119.1.98590 WP_003411119.1.98594 WP_003411119.1.98599 WP_003411119.1.98629 WP_003411119.1.98645 WP_003411119.1.98646 WP_003411119.1.98649 WP_003411119.1.98656 WP_003411119.1.9867 WP_003411119.1.98674 WP_003411119.1.98697 WP_003411119.1.98701 WP_003411119.1.98739 WP_003411119.1.98749 WP_003411119.1.98765 WP_003411119.1.98770 WP_003411119.1.98777 WP_003411119.1.98778 WP_003411119.1.98838 WP_003411119.1.98906 WP_003411119.1.98935 WP_003411119.1.98948 WP_003411119.1.98953 WP_003411119.1.98984 WP_003411119.1.99000 WP_003411119.1.99023 WP_003411119.1.99030 WP_003411119.1.99037 WP_003411119.1.99055 WP_003411119.1.99062 WP_003411119.1.99086 WP_003411119.1.99115 WP_003411119.1.99161 WP_003411119.1.99176 WP_003411119.1.99211 WP_003411119.1.99216 WP_003411119.1.99222 WP_003411119.1.99251 WP_003411119.1.99269 WP_003411119.1.99294 WP_003411119.1.99312 WP_003411119.1.99315 WP_003411119.1.99316 WP_003411119.1.99322 WP_003411119.1.99328 WP_003411119.1.99365 WP_003411119.1.99368 WP_003411119.1.99379 WP_003411119.1.99396 WP_003411119.1.99402 WP_003411119.1.99419 WP_003411119.1.99438 WP_003411119.1.99460 WP_003411119.1.99468 WP_003411119.1.99473 WP_003411119.1.99513 WP_003411119.1.99529 WP_003411119.1.99548 WP_003411119.1.99572 WP_003411119.1.99575 WP_003411119.1.99578 WP_003411119.1.99605 WP_003411119.1.99609 WP_003411119.1.99617 WP_003411119.1.99635 WP_003411119.1.99650 WP_003411119.1.99672 WP_003411119.1.99701 WP_003411119.1.99711 WP_003411119.1.99716 WP_003411119.1.99740 WP_003411119.1.99745 WP_003411119.1.99749 WP_003411119.1.9976 WP_003411119.1.99798 WP_003411119.1.99817 WP_003411119.1.99847 WP_003411119.1.99852 WP_003411119.1.99886 WP_003411119.1.99897 WP_003411119.1.99899 WP_003411119.1.99915 WP_003411119.1.99991 rv2140c gi|31793320|ref|NP_855813.1| 233413.Mb2164c 336982.TBFG_12170 410289.BCG_2157c 419947.MRA_2154 478434.TBMG_01842 561275.JTY_2151 83331.MT2198 83332.Rv2140c gi|392432263|ref|YP_006473307.1| gi|15841631|ref|NP_336668.1| gi|148823349|ref|YP_001288103.1| gi|433635209|ref|YP_007268836.1| gi|494696528|ref|YP_007962031.1| gi|449064197|ref|YP_007431280.1| gi|148661955|ref|YP_001283478.1| gi|433627257|ref|YP_007260886.1| gi|15609277|ref|NP_216656.1| gi|479056101|ref|YP_007351907.1| gi|392386786|ref|YP_005308415.1| gi|479315069|ref|YP_007855121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]