SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340627389|ref|YP_004745841.1| from Mycobacterium canettii CIPT 140010059

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340627389|ref|YP_004745841.1|
Domain Number 1 Region: 3-240
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000168
Family C-terminal domain of adrenodoxin reductase-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340627389|ref|YP_004745841.1|
Sequence length 431
Comment lysine-N-oxygenase MBTG [Mycobacterium canettii CIPT 140010059]
Sequence
MNPTLAVLGAGAKAVAVAAKASVLRDMGVDVPDVIAVERIGVGANWQASGGWTDGAHRLG
TSPEKDVGFPYRSALVPRRNAELDERMTRYSWQSYLIATASFAEWIDRGRPAPTHRRWSQ
YLAWVADHIGLKVIHGEVERLAVTGDRWALCTHETTVQADALMITGPGQAEKSLLPGNPR
VLSIAQFWDRAAGHDRINAERVAVIGGGETAASMLNELFRHRVSTITVISPQVTLFTRGE
GFFENSLFSDPTDWAALTFDERRDALARTDRGVFSSTVQEALLADDRIHHLRGRVAHAVG
RQGQIRLTLSTNRGSENFETVHGFDLVIDGSGADPLWFTSLFSQHTLDLLELGLGGPLTA
DRLQEAIGYDLAVTDVTPKLFLPTLSGLTQGPGFPNLSCLGLLSDRVLGAGIFTPTKHND
TRRSGEHQSFR
Download sequence
Identical sequences G0TP61
gi|340627389|ref|YP_004745841.1| WP_014001243.1.45062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]