SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340627589|ref|YP_004746041.1| from Mycobacterium canettii CIPT 140010059

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340627589|ref|YP_004746041.1|
Domain Number 1 Region: 117-295,419-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.89e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000011
Further Details:      
 
Domain Number 2 Region: 292-414
Classification Level Classification E-value
Superfamily GAD domain-like 1.46e-33
Family GAD domain 0.00037
Further Details:      
 
Domain Number 3 Region: 5-109
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.35e-29
Family Anticodon-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340627589|ref|YP_004746041.1|
Sequence length 596
Comment putative aspartyl-tRNA synthetase ASPS [Mycobacterium canettii CIPT 140010059]
Sequence
MFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQDTEV
LAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPA
GEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDF
LVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEM
SFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECT
DFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGG
PVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWA
FVWVVDPPLFEPADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYD
IVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGW
DRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVEQA
Download sequence
Identical sequences G0TQ52
WP_014001338.1.13667 WP_014001338.1.45062 WP_014001338.1.60091 WP_014001338.1.71399 WP_014001338.1.73315 WP_014001338.1.80669 gi|433627704|ref|YP_007261333.1| gi|433642771|ref|YP_007288530.1| gi|340627589|ref|YP_004746041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]