SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62389174|ref|YP_224576.1| from Corynebacterium glutamicum ATCC 13032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62389174|ref|YP_224576.1|
Domain Number 1 Region: 54-302
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 7.93e-24
Family GpdQ-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62389174|ref|YP_224576.1|
Sequence length 305
Comment phosphohydrolase [Corynebacterium glutamicum ATCC 13032]
Sequence
MNKVSTIAKTLTFSSAALLGAGIATAAWGYSELKKFELKTVELPILKPGTLRGKKEFRLL
HISDLHMIPGQETKKAWVSALDSLSPDLVINTGDNLSDEKAVPDVLRALGPLMNRPGAFV
FGTNDYWAPRPVNPFGYLFGKKREVSHIDLPWRAMRAAFIEHGWQDANQKRLEFQVGSVR
LAISGVDDPHHDLDDYTEIAGAPNVDADLSIALLHAPEPRVLAQFEADGYQLSLSGHTHG
GQLCLPGSKPIVTNCGIDRKRATGLNKFGDMWMHVSNGLGTSKFVPFRIFCRPSATLIKI
TEQAL
Download sequence
Identical sequences Q8NTN0
CgR100 gi|62389174|ref|YP_224576.1| gi|62389174|ref|YP_224576.1| 196627.cg0334 gi|62389174|ref|YP_224576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]