SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62391106|ref|YP_226508.1| from Corynebacterium glutamicum ATCC 13032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62391106|ref|YP_226508.1|
Domain Number 1 Region: 142-434
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.22e-29
Family Purple acid phosphatase-like 0.059
Further Details:      
 
Weak hits

Sequence:  gi|62391106|ref|YP_226508.1|
Domain Number - Region: 68-123
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.00458
Family Purple acid phosphatase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62391106|ref|YP_226508.1|
Sequence length 516
Comment alkaline phosphatase precursor [Corynebacterium glutamicum ATCC 13032]
Sequence
MPQLSRRQFLQTTAVTAGLATFAGTPARAEERQFQHGVASGDPTATSAILWTRLTPIPDA
TPGSGLGPDSPVTWEVSPTPDFASITRSGTVITSAASDHTVHAHATGLSPSTRYFYRFIS
STGEVSPVGRTQTTSLVDAPLPHLRFALASCANWEAGFFAAYGDIARRADAGELEMLIFL
GDYIYEYATGMFAGKDGVVRPHQPLHETITLEHYRTRYGHYRSDNHLQAAHAALPWIVMW
DDHESANNSNREGAQNHSADEGSWVDRQNAARQVFLEWMPIRQEDTLYRSFTFGDLATLS
LLDLRSFRDPAPSQQQWLEGQRADTMMGSQQFEWLKSNVEHTTTTWNIIGSSVMFAPMAI
TGQPLFQIPEPIPANLDQWDGYSRERDRLLAVLADFATPTLFLSGDIHSEWANAIRFNGR
EIGVEAVCSSITSANVNDFAKLPEDNPVSLQAEQVIRANSSHVRHVDLDAHGYATVNLTQ
DGAHMVWHRVADLSLPDSEVAPAIALEWKPGVGFTT
Download sequence
Identical sequences A0A2H5IAQ0
196627.cg2485 gi|62391106|ref|YP_226508.1| NP_601465.1.3765 WP_011014996.1.21641 WP_011014996.1.3871 WP_011014996.1.4395 WP_011014996.1.80527 gi|62391106|ref|YP_226508.1| gi|530316166|ref|YP_008402130.1| gi|62391106|ref|YP_226508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]