SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62391910|ref|YP_227312.1| from Corynebacterium glutamicum ATCC 13032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62391910|ref|YP_227312.1|
Domain Number 1 Region: 1046-1291
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.9e-24
Family GpdQ-like 0.039
Further Details:      
 
Weak hits

Sequence:  gi|62391910|ref|YP_227312.1|
Domain Number - Region: 271-336
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.000772
Family Lamin A/C globular tail domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62391910|ref|YP_227312.1|
Sequence length 1461
Comment phosphoesterase [Corynebacterium glutamicum ATCC 13032]
Sequence
MNISKLGLRIAVTATATTTALALGGTHMAVGQETDLLNAMETLAGVPSDLVVTEILPDTT
SYDNFEFFEVHNTGSAPVTIGEGEYTFAYSFDDSADTSRDKALDLGGEVTVDAGETIVVW
IEYSSSTVDTAAFSEQDFRDFYGMDSSARIFRATGQAGLANGGDRGIRVLYNGEVSGWSH
YPSDSAAVQKGIDFALPKVGEQASIAVRTKTDPTPGSITSDQLIPGGLDTPEEPEAPEDS
LFEGRTPPRDAAPLILTELMVNSTNMGSSDGFEYVEITNTTAEPIDFSDYTLNYLYPQDE
FTNTNEAVWAAEPGDVIIQPGKSLVFWIKNGPNDEATAADFNAEYGTNLEAGKDLVEISS
GGMANGTARGMQIQTNTGHIVNRGFYNMAGASDVKANEGLHFAVDESDLLKQTLVGSGAP
TPGTVYTSQIPNPLSAVIADSSVPLITDNTATSINPAEPFTFAFNITDDVQVRTATLHVT
SSAGEAATTINLTEDDGSFNWALPAADLTGKSWFEYTVTATDGFNSVTTEPVRVTVDGAN
TDPLRLNLEENQWVSGTTDVIGASDVFGDKLELLIDDAPAVTNSSLSAAPTFAMEVTQTD
VFFRNGILAGGEELRIFDQGTYANTETISTPVPLYHINEDGTLTVSVYAGTKAAPEIDLN
ENNDDFQIRNLRLILPDGRTLTPAGISDSNAWLNMGDSAGKLDFFDATFALPEDAFTGVA
HAWDTTQSTDGEHHITISREDGGEISRTIRVDNTAPELTVSGVEEGQELRGTVEIDAQAT
DAGAGVKSVETLLDGERVQLPLTTGSIALDKGEHTLVIRAEDEVGNRTEKTITFSTPDEN
PISGDYAPSNGATVGVGDVKLSARASDPSGDTVKMTFLEADSPKLDSGRVRMSSGTVEDA
GSVSRAEAKMLERGDVEKLSSLDGLGMEVTSDAALPYQLFEVDAADALAADTEVRLNWAG
SADGRAQVIMYVFDGEAWVEVDRHLTGDELEEFTLQGVVNAEKFAIGGTVTVLIQHSEGF
AGADHSTRNSDVTAAHPDDVARSEYDFTLAWESDTQYYNEEFHEHQTNIHDYVLAERENK
NIQFMFHTGDVVDDWDQPAQWATANPEYQRLDDAGLPYSVLAGNHDVGHTSNDYTEFSRH
FGEQRYVDNPWYGESYQDNRGHYDLFSAGGIDFINVAMGWGPDDEEIAWMNEVLAKHPER
VAILNLHEFMLTTGGLGPIPQRILDEVAATNPNVSMIMSGHYHDAFQRTDSFDDDGDGVD
DRTVTSMLFDYQGLPEGGQGYLRLLHFDNQGQKMMVRTYSPSLKDYNSDEPSLLGPAEDP
NMYQEFEVSYEQLGIKPEGRTLIGDSFSADFLTSNEIGIVDEVPSGTIASTNWKDVTEGR
HSWYVRSEDPFGGVEISPVQSFIAGEEAGGNAPGTGSSNGGSSHGLWGALAGFFAGAAAL
AGAAIAFVPGIWDYVTNAFKR
Download sequence
Identical sequences A0A286MB65
gi|62391910|ref|YP_227312.1| gi|62391910|ref|YP_227312.1| gi|530316933|ref|YP_008402897.1| gi|62391910|ref|YP_227312.1| 196627.cg3393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]