SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392414791|ref|YP_006451396.1| from Mycobacterium chubuense NBB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392414791|ref|YP_006451396.1|
Domain Number 1 Region: 99-293
Classification Level Classification E-value
Superfamily Formyltransferase 9.29e-54
Family Formyltransferase 0.00036
Further Details:      
 
Domain Number 2 Region: 16-92
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000084
Family SP0238-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392414791|ref|YP_006451396.1|
Sequence length 293
Comment formyltetrahydrofolate deformylase [Mycobacterium chubuense NBB4]
Sequence
MGDRTSAVSGRDVGRLLLRCEDRPGLVAAVSGFLTGHGANIISLDQHSTAQSGGMFMQRT
IFHLPGLTAVRDALERSFAEDVACEFGMDFRLTEAAKPKRVAILASREDHCVLDLLWRNR
RGELDMSVVMVIANHPDLADDVRPFGVPFIHIPAHKGIRAEAEQRQLELLRGNADLVVLA
RYMQILTPRFIEEVGCPLINIHHSFLPAFIGAAPYRRAKERGVKLVGATAHYVTDDLDEG
PIIEQDVVRVDHRHDVTDLARLGADVERAVLSRAVLWHCEDRIIRFGNQTIVF
Download sequence
Identical sequences I4BEL0
gi|392414791|ref|YP_006451396.1| WP_014814206.1.73529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]