SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392416194|ref|YP_006452799.1| from Mycobacterium chubuense NBB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392416194|ref|YP_006452799.1|
Domain Number 1 Region: 116-294,418-587
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.05e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000105
Further Details:      
 
Domain Number 2 Region: 291-413
Classification Level Classification E-value
Superfamily GAD domain-like 5.67e-34
Family GAD domain 0.00049
Further Details:      
 
Domain Number 3 Region: 3-108
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4e-28
Family Anticodon-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392416194|ref|YP_006452799.1|
Sequence length 592
Comment aspartyl-tRNA synthetase [Mycobacterium chubuense NBB4]
Sequence
MLRTRTAGSLRAADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGLEEGQVL
AAAHRLRAEFCVAVTGVVEIRPEGNANPEIATGDVEVNATALTVLGESAPLPFQLDENAG
EEARLKYRYLDLRREGPGSAIRLRSKANAAARAVLAAHDFVEIETPTLTRSTPEGARDFL
VPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMS
FVDADDVIAVSEEVLRALWALVGYDLPLPLPRISYADAMRRFGTDKPDLRFGLELVECTD
YFSDTPFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGELTGP
VAKNLSDTERDGLAAHVGANPGDCVFFAAGTPKGARALLGATRIEIAKRLDMIDPGAWAF
TWVVDWPLFEPADEATASGDVAVGSGAWTAAHHAFTAPTPESEATFDTDPGSAMADAYDI
VCNGNEIGGGSIRIHRRDVQERVFAMMGIDHDEARDKFGFLLDAFTFGAPPHGGIAFGWD
RITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITAQQRKESGIDAKPEPK
Download sequence
Identical sequences I4BIL3
WP_014815600.1.73529 gi|392416194|ref|YP_006452799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]