SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392416770|ref|YP_006453375.1| from Mycobacterium chubuense NBB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392416770|ref|YP_006453375.1|
Domain Number 1 Region: 28-173
Classification Level Classification E-value
Superfamily PEBP-like 1.15e-38
Family Prokaryotic PEBP-like proteins 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392416770|ref|YP_006453375.1|
Sequence length 174
Comment phospholipid-binding protein, PBP family [Mycobacterium chubuense NBB4]
Sequence
MLGTLSVLAVVAAGLATAAAVSAAPAQFELTSPAFADNSQIPAEFSCHGRNVPPPLQWQN
APQGTQSLALVVDDPDAVGGLYIHWVVSGIPPSATGMVDGVLPEGAHVSANSGGSATYLG
PCPPAGTGVHHYRFQLFALKNSLTLTPATPARTAVQTITGAALAVASTVGLFGA
Download sequence
Identical sequences I4BK89
gi|392416770|ref|YP_006453375.1| WP_014816173.1.73529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]