SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392418603|ref|YP_006455208.1| from Mycobacterium chubuense NBB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392418603|ref|YP_006455208.1|
Domain Number 1 Region: 4-477
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.7e-197
Family Heme-dependent catalases 0.000000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392418603|ref|YP_006455208.1|
Sequence length 481
Comment catalase [Mycobacterium chubuense NBB4]
Sequence
MTENYATTDAGAPIPTVEHSLTVGPDGPILLQDHYLIEQMANFNRERIPERQPHAKGGGA
FGQFEVTQDVSAYTKAAFLQPGVKTEMVARFSTVAGERGSPDTWRDPRGFALKFYTSEGN
FDMVGNNTPVFFVRDPMKFQNFIRSQKRMQATNLRDHNMQWDFWTLSPESAHQVTWLMGD
RGIPKTWRHMNGYSSHTYSWLNANDEMFWVKYHFKTDQGIDYLTQEDADRLAGEDADYHQ
RDLYTAIEEGNLPSWTLHVQIMPFEDAKTYRFNPFDLTKVWPHSDYPLHEVGKMTLNRNV
VDYHAQIEQAAFEPNNIVPGTGLSPDKMLLARGFSYSDAHRHRLGVNYKQIPVNEPKVEV
RAYSKDGPMRIRNVTDPIYAPNSMGGPEADPRRASEVHWASDGDMVRSAYALRAEDSDWG
QAGTLVRDVLDDAARDRLVHNIVGHVSDGVKEPVLSRVFEYWKNVDADLGKRVEEGVRNG
S
Download sequence
Identical sequences I4BQH2
gi|392418603|ref|YP_006455208.1| WP_014817995.1.73529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]