SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379745402|ref|YP_005336223.1| from Mycobacterium intracellulare ATCC 13950

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|379745402|ref|YP_005336223.1|
Domain Number - Region: 112-232
Classification Level Classification E-value
Superfamily Cytochrome P450 0.0079
Family Cytochrome P450 0.021
Further Details:      
 
Domain Number - Region: 25-145
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.0693
Family Heme-dependent catalases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379745402|ref|YP_005336223.1|
Sequence length 285
Comment hypothetical protein OCU_06820 [Mycobacterium intracellulare ATCC 13950]
Sequence
MLQGPWAGSMQNMHPQLGAAVLDHSTFFRERWPRLLRSLYPIGGVVFDGERAPVTGAEVR
DYHTDIKGVDDQGRRYHALNPDVFYWAHSTFFMGTIHVAERFCGGITEAQKRQLFDEHVE
WYRMYGMSMRPVPKSWEEFQAYWDHMCRNVLESNEAARAVLDLSELPKPPFAQWIPEPLW
ALQRKLLAPFFVWLTVGLYDPPVRELMGYRWSRRDEWLHRRFGDLVRFVFALVPSRFRKH
PRARAGLDRASGRIPLDTPLVQTPARNLPPIDERGDPKHYCPMVS
Download sequence
Identical sequences H8IQ70
gi|379760129|ref|YP_005346526.1| gi|379745402|ref|YP_005336223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]