SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379747062|ref|YP_005337883.1| from Mycobacterium intracellulare ATCC 13950

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379747062|ref|YP_005337883.1|
Domain Number 1 Region: 17-174
Classification Level Classification E-value
Superfamily PEBP-like 7.98e-50
Family Prokaryotic PEBP-like proteins 0.0000661
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379747062|ref|YP_005337883.1|
Sequence length 176
Comment hypothetical protein OCU_23430 [Mycobacterium intracellulare ATCC 13950]
Sequence
MSTAPDPYASLPKLPTFTLTSQSVTDGQPLAKPQVSGIMGAGGEDVSPQLSWSGFPEGTR
SFAVTVYDPDAPTASGFWHWAVANLPADVTELAEGAGDGSNLPGDALTLVNDAGLRRYLG
AAPPAGHGPHRYYIAVHAVDTDKLDLPEDASPAFLGFNLFQHAIARAVIHATYEQK
Download sequence
Identical sequences H8IWN6 J9WID6
gi|406030430|ref|YP_006729321.1| gi|379747062|ref|YP_005337883.1| WP_014380005.1.3602 WP_014380005.1.39679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]