SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379747325|ref|YP_005338146.1| from Mycobacterium intracellulare ATCC 13950

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379747325|ref|YP_005338146.1|
Domain Number 1 Region: 71-211
Classification Level Classification E-value
Superfamily PEBP-like 2.49e-34
Family Prokaryotic PEBP-like proteins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379747325|ref|YP_005338146.1|
Sequence length 213
Comment phosphatidylethanolamine-binding protein [Mycobacterium intracellulare ATCC 13950]
Sequence
MLSRRARAGQTVFMDSSHVFRRTAALIGAAVLLGPLTGCGGTGDSHPTSSPAPKVTTLGK
TAPKAPAGGSLTISSPAFADGAPIPVQYTCKGADVAPPLVWSAPLGAALVVDDPDAPAGL
YVHWVVIGIAPGPGSTAEGQTPAGATTLPNTAGQSAYQGPCPPNGTGTHRYRFTLYQLPD
DYQLPGGLAGVQAAQTIAGAATAQAQLVGAFGG
Download sequence
Identical sequences A0A249BMA8 H8ILC3
gi|379754630|ref|YP_005343302.1| gi|379747325|ref|YP_005338146.1| WP_014380147.1.33860 WP_014380147.1.3602 WP_014380147.1.37776 WP_014380147.1.69645 WP_014380147.1.8050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]