SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379747991|ref|YP_005338812.1| from Mycobacterium intracellulare ATCC 13950

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379747991|ref|YP_005338812.1|
Domain Number 1 Region: 112-290,414-583
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.47e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000966
Further Details:      
 
Domain Number 2 Region: 287-409
Classification Level Classification E-value
Superfamily GAD domain-like 4.14e-33
Family GAD domain 0.00056
Further Details:      
 
Domain Number 3 Region: 3-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.9e-29
Family Anticodon-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379747991|ref|YP_005338812.1|
Sequence length 591
Comment aspartyl-tRNA synthetase [Mycobacterium intracellulare ATCC 13950]
Sequence
MLRSHAAGSLRSSDAGQQVTLAGWVARRRDHGGVIFIDLRDASGITQVVFRAEDVLAQAH
RLRAEFCVAVSGVVEIRPEGNANPEIATGEIEVNATALTVLGESAPLPFQLDEPAGEELR
LKYRYLDLRRDGPAEAIRLRSKVNAAARAVLAQHDFVEIETPTITRSTPEGARDFLVPAR
LHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDA
EDILAISEEILSALWALIGYQIPTPIPRISYAEAMRRFGSDKPDMRFGLELVDCTEFFKD
TTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEWAKQRGHRGLAYVLIADDGTLGGPVAKN
LSDAERDGLAAHVGAEPGDCVFFSAGPPKPSRALLGAARGEIAHRLGMIDPDAWAFVWVV
DPPLFEPADDATAAGDVAVGSGAWTAVHHAFTSPKPGHEDAIDTDPGNVLADAYDIVCNG
NEIGGGSIRIHRRDIQERVFAVMGLDHAEAEEKFGFLLEAFTFGAPPHGGIAFGWDRINA
LLSGVDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAKPEKVDRA
Download sequence
Identical sequences A0A249BP92 H8IU31
WP_009957659.1.33860 WP_009957659.1.3602 WP_009957659.1.37776 WP_009957659.1.69645 WP_009957659.1.8050 WP_009957659.1.92968 gi|379755294|ref|YP_005343966.1| gi|379747991|ref|YP_005338812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]