SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379749493|ref|YP_005340314.1| from Mycobacterium intracellulare ATCC 13950

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379749493|ref|YP_005340314.1|
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily L28p-like 7.46e-21
Family Ribosomal protein L31p 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379749493|ref|YP_005340314.1|
Sequence length 84
Comment 50S ribosomal protein L31 [Mycobacterium intracellulare ATCC 13950]
Sequence
MKPGVHPDYHPVVFQDATTGAMFLTRSTRTSPRMVEWQTARGTRTYPLVVVDVTADSHPF
WTGSRRIVDSAGQVEKFHRRYGRR
Download sequence
Identical sequences A0A249BTL1 H8IWA9
gi|379749493|ref|YP_005340314.1| gi|379756793|ref|YP_005345465.1| WP_009952522.1.33860 WP_009952522.1.3602 WP_009952522.1.37514 WP_009952522.1.37776 WP_009952522.1.69645 WP_009952522.1.8050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]