SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379745660|ref|YP_005336481.1| from Mycobacterium intracellulare ATCC 13950

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379745660|ref|YP_005336481.1|
Domain Number 1 Region: 9-550
Classification Level Classification E-value
Superfamily SIS domain 1.47e-202
Family Phosphoglucose isomerase, PGI 0.000000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379745660|ref|YP_005336481.1|
Sequence length 554
Comment glucose-6-phosphate isomerase [Mycobacterium intracellulare ATCC 13950]
Sequence
MTSLHTLPDITATPAWDALRRHHERIGATHLRQFFDEDPDRGRELTVSVGDLYIDYSKHR
ITRETLRLLVDLARTANLEQRRDQMFAGVHINTSEDRAVLHTALRLPRDAELTVDGQNVV
EDVHAVLDRMGDFTDRLRSGEWTGATGKRISTVVNIGIGGSDLGPVMVYQALRHYADAGI
SARFVSNVDPADLIATLADLDPATTLFIVASKTFSTLETLTNATAARRWVTDTLGDAAVA
QHFVAVSTNKRLVDDFGINTDNMFGFWDWVGGRYSVDSAIGLSVMAAIGREAFADFLSGF
HIVDRHFKTAPLESNAPVLLGLIGLWYSNFMGAQSRAVLPYSNDLARFAAYLQQLTMESN
GKSTRADGSPVTTDTGEIFWGEPGTNGQHAFYQLLHQGTRLVPADFIGFSQPIDDLPTAE
GDGSMHDLLMSNFFAQTQVLAFGKTAEEIAAEGTPADIVPHKVMPGNRPSTSILADRLTP
SVLGQLIALYEHQVFTEGVIWGIDSFDQWGVELGKTQAKALLPVLTAEASPAPQSDSSTD
ALVRRYRSERGRTS
Download sequence
Identical sequences H8ITK5
WP_014379276.1.3602 WP_014379276.1.92968 gi|379745660|ref|YP_005336481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]