SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379745712|ref|YP_005336533.1| from Mycobacterium intracellulare ATCC 13950

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379745712|ref|YP_005336533.1|
Domain Number 1 Region: 13-198
Classification Level Classification E-value
Superfamily SIS domain 4.04e-48
Family mono-SIS domain 0.000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379745712|ref|YP_005336533.1|
Sequence length 202
Comment phosphoheptose isomerase [Mycobacterium intracellulare ATCC 13950]
Sequence
MTGSDAVSPSVELVQQRLAETIAVKQQMQQGDVAAQTVEVARAIIVSLRAGGKVIFFGNG
GSAQDAGHLAAELMGRFAFDRPGLAAISLPDATAAITAISNDYSYDEVFARQVLATGRPG
DVVIGLTTSGNSPNVVRALEVAGQAGMTTVTLTGALGGKVADVAKICIRVPSDDTARVQE
ACLHLGHSICEMVEAALFPGPS
Download sequence
Identical sequences A0A249BIQ0 H8ITQ7
WP_009957789.1.3602 WP_009957789.1.69645 WP_009957789.1.8050 WP_009957789.1.92968 gi|379745712|ref|YP_005336533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]